


| Basic Information | |
|---|---|
| Family ID | F044018 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 155 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MFTVISRKTQTAVCMILSAVIVSGSLSLGAFAAERAAHDGYSVTITQIQ |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 155 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 76.13 % |
| % of genes near scaffold ends (potentially truncated) | 34.84 % |
| % of genes from short scaffolds (< 2000 bps) | 82.58 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.581 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.903 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.677 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.258 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 49.35% β-sheet: 0.00% Coil/Unstructured: 50.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 155 Family Scaffolds |
|---|---|---|
| PF13537 | GATase_7 | 12.26 |
| PF13522 | GATase_6 | 5.81 |
| PF00440 | TetR_N | 4.52 |
| PF00144 | Beta-lactamase | 4.52 |
| PF11695 | DUF3291 | 2.58 |
| PF00583 | Acetyltransf_1 | 1.94 |
| PF10067 | DUF2306 | 1.94 |
| PF14015 | DUF4231 | 1.94 |
| PF00174 | Oxidored_molyb | 1.29 |
| PF16859 | TetR_C_11 | 1.29 |
| PF01925 | TauE | 0.65 |
| PF00072 | Response_reg | 0.65 |
| PF00891 | Methyltransf_2 | 0.65 |
| PF03795 | YCII | 0.65 |
| PF01979 | Amidohydro_1 | 0.65 |
| PF12680 | SnoaL_2 | 0.65 |
| PF12695 | Abhydrolase_5 | 0.65 |
| PF13485 | Peptidase_MA_2 | 0.65 |
| PF03705 | CheR_N | 0.65 |
| PF01569 | PAP2 | 0.65 |
| PF01738 | DLH | 0.65 |
| PF01243 | Putative_PNPOx | 0.65 |
| PF14246 | TetR_C_7 | 0.65 |
| PF07045 | DUF1330 | 0.65 |
| PF02586 | SRAP | 0.65 |
| PF01740 | STAS | 0.65 |
| PF04389 | Peptidase_M28 | 0.65 |
| PF01131 | Topoisom_bac | 0.65 |
| PF14497 | GST_C_3 | 0.65 |
| PF01381 | HTH_3 | 0.65 |
| PF09980 | DUF2214 | 0.65 |
| PF14312 | FG-GAP_2 | 0.65 |
| PF08883 | DOPA_dioxygen | 0.65 |
| PF04828 | GFA | 0.65 |
| PF07676 | PD40 | 0.65 |
| PF14534 | DUF4440 | 0.65 |
| PF13520 | AA_permease_2 | 0.65 |
| PF07638 | Sigma70_ECF | 0.65 |
| PF06739 | SBBP | 0.65 |
| PF13451 | zf-trcl | 0.65 |
| PF00202 | Aminotran_3 | 0.65 |
| PF12973 | Cupin_7 | 0.65 |
| PF00326 | Peptidase_S9 | 0.65 |
| PF12833 | HTH_18 | 0.65 |
| PF04235 | DUF418 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
|---|---|---|---|
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 4.52 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 4.52 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 4.52 |
| COG1352 | Methylase of chemotaxis methyl-accepting proteins | Signal transduction mechanisms [T] | 1.29 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 1.29 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 1.29 |
| COG0550 | DNA topoisomerase IA | Replication, recombination and repair [L] | 0.65 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.65 |
| COG1110 | Reverse gyrase | Replication, recombination and repair [L] | 0.65 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.65 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.65 |
| COG2311 | Uncharacterized membrane protein YeiB | Function unknown [S] | 0.65 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.65 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.65 |
| COG3805 | Aromatic ring-cleaving dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.65 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.58 % |
| Unclassified | root | N/A | 17.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_8719313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter cummioxidans | 1634 | Open in IMG/M |
| 2088090015|GPICI_8742273 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11155 | Open in IMG/M |
| 2088090015|GPICI_9268854 | All Organisms → cellular organisms → Bacteria | 5287 | Open in IMG/M |
| 2228664022|INPgaii200_c0533277 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101394047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agariperforans | 1061 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101989387 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300000890|JGI11643J12802_10893976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 559 | Open in IMG/M |
| 3300000956|JGI10216J12902_106216034 | Not Available | 843 | Open in IMG/M |
| 3300003319|soilL2_10112709 | All Organisms → cellular organisms → Bacteria | 5329 | Open in IMG/M |
| 3300003319|soilL2_10162938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 1659 | Open in IMG/M |
| 3300003324|soilH2_10286004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 1105 | Open in IMG/M |
| 3300003972|Ga0064067_1006112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 19139 | Open in IMG/M |
| 3300004114|Ga0062593_100005721 | All Organisms → cellular organisms → Bacteria | 5195 | Open in IMG/M |
| 3300004114|Ga0062593_100034154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 2947 | Open in IMG/M |
| 3300004114|Ga0062593_103375664 | Not Available | 512 | Open in IMG/M |
| 3300004157|Ga0062590_100178595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1501 | Open in IMG/M |
| 3300004157|Ga0062590_102239278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300004463|Ga0063356_100043100 | All Organisms → cellular organisms → Bacteria | 4480 | Open in IMG/M |
| 3300004463|Ga0063356_102504389 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300004479|Ga0062595_101053527 | Not Available | 705 | Open in IMG/M |
| 3300005093|Ga0062594_101309784 | Not Available | 728 | Open in IMG/M |
| 3300005294|Ga0065705_10537758 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005329|Ga0070683_101769059 | Not Available | 594 | Open in IMG/M |
| 3300005331|Ga0070670_100011510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7569 | Open in IMG/M |
| 3300005332|Ga0066388_103036313 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300005332|Ga0066388_106018441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → unclassified Mycobacteriaceae → Mycobacteriaceae bacterium 1482268.1 | 613 | Open in IMG/M |
| 3300005333|Ga0070677_10526392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → unclassified Mycobacteriaceae → Mycobacteriaceae bacterium 1482268.1 | 644 | Open in IMG/M |
| 3300005334|Ga0068869_100316796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 1264 | Open in IMG/M |
| 3300005338|Ga0068868_100080347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2613 | Open in IMG/M |
| 3300005344|Ga0070661_100230836 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300005455|Ga0070663_101776374 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005458|Ga0070681_10633625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 984 | Open in IMG/M |
| 3300005458|Ga0070681_10681971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 943 | Open in IMG/M |
| 3300005459|Ga0068867_101614716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 606 | Open in IMG/M |
| 3300005530|Ga0070679_100248947 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300005530|Ga0070679_100262777 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300005535|Ga0070684_101993867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 548 | Open in IMG/M |
| 3300005548|Ga0070665_100095299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2981 | Open in IMG/M |
| 3300005564|Ga0070664_101853844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → unclassified Mycobacteriaceae → Mycobacteriaceae bacterium 1482268.1 | 572 | Open in IMG/M |
| 3300005564|Ga0070664_101876275 | Not Available | 568 | Open in IMG/M |
| 3300005577|Ga0068857_101182981 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005616|Ga0068852_100971059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 868 | Open in IMG/M |
| 3300005983|Ga0081540_1067413 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300006049|Ga0075417_10022292 | All Organisms → cellular organisms → Bacteria | 2538 | Open in IMG/M |
| 3300006196|Ga0075422_10285319 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300006196|Ga0075422_10303951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 684 | Open in IMG/M |
| 3300006755|Ga0079222_12391953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 529 | Open in IMG/M |
| 3300006844|Ga0075428_100003526 | All Organisms → cellular organisms → Bacteria | 17138 | Open in IMG/M |
| 3300006845|Ga0075421_100191388 | All Organisms → cellular organisms → Bacteria | 2537 | Open in IMG/M |
| 3300006845|Ga0075421_101672378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → unclassified Mycobacteriaceae → Mycobacteriaceae bacterium 1482268.1 | 689 | Open in IMG/M |
| 3300006853|Ga0075420_101020365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter cummioxidans | 712 | Open in IMG/M |
| 3300006876|Ga0079217_10811422 | Not Available | 651 | Open in IMG/M |
| 3300006876|Ga0079217_11709742 | Not Available | 507 | Open in IMG/M |
| 3300006881|Ga0068865_100166770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1685 | Open in IMG/M |
| 3300006894|Ga0079215_10152628 | Not Available | 1105 | Open in IMG/M |
| 3300006894|Ga0079215_11019039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → unclassified Mycobacteriaceae → Mycobacteriaceae bacterium 1482268.1 | 611 | Open in IMG/M |
| 3300006903|Ga0075426_11186266 | Not Available | 579 | Open in IMG/M |
| 3300006918|Ga0079216_11271314 | Not Available | 598 | Open in IMG/M |
| 3300006948|Ga0099826_10036327 | Not Available | 3488 | Open in IMG/M |
| 3300007004|Ga0079218_10176509 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300007004|Ga0079218_11298625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300007004|Ga0079218_12408274 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300009100|Ga0075418_10156291 | All Organisms → cellular organisms → Bacteria | 2427 | Open in IMG/M |
| 3300009100|Ga0075418_10824056 | Not Available | 1002 | Open in IMG/M |
| 3300009147|Ga0114129_11538115 | Not Available | 816 | Open in IMG/M |
| 3300009156|Ga0111538_11184043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter cummioxidans | 966 | Open in IMG/M |
| 3300009156|Ga0111538_11887988 | Not Available | 752 | Open in IMG/M |
| 3300009156|Ga0111538_13746793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter cummioxidans | 526 | Open in IMG/M |
| 3300009162|Ga0075423_10838949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 973 | Open in IMG/M |
| 3300009551|Ga0105238_11189937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum | 786 | Open in IMG/M |
| 3300010362|Ga0126377_10009037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7666 | Open in IMG/M |
| 3300010399|Ga0134127_11639482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → unclassified Mycobacteriaceae → Mycobacteriaceae bacterium 1482268.1 | 718 | Open in IMG/M |
| 3300012212|Ga0150985_101121534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
| 3300012469|Ga0150984_104480615 | Not Available | 500 | Open in IMG/M |
| 3300012469|Ga0150984_106327218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300012469|Ga0150984_115374936 | Not Available | 630 | Open in IMG/M |
| 3300012882|Ga0157304_1118057 | Not Available | 504 | Open in IMG/M |
| 3300012940|Ga0164243_10059677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4161 | Open in IMG/M |
| 3300012943|Ga0164241_10009089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Solimonas → Solimonas soli | 8636 | Open in IMG/M |
| 3300012943|Ga0164241_10194855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1449 | Open in IMG/M |
| 3300013296|Ga0157374_11092931 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300015371|Ga0132258_10045367 | All Organisms → cellular organisms → Bacteria | 10018 | Open in IMG/M |
| 3300015371|Ga0132258_11035402 | All Organisms → cellular organisms → Bacteria | 2074 | Open in IMG/M |
| 3300015374|Ga0132255_104946360 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300018422|Ga0190265_10213903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → unclassified Mycobacteriaceae → Mycobacteriaceae bacterium 1482268.1 | 1950 | Open in IMG/M |
| 3300018422|Ga0190265_10425186 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300018422|Ga0190265_11375116 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300018429|Ga0190272_10826761 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300018429|Ga0190272_11257909 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300018429|Ga0190272_13286301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agaridevorans | 504 | Open in IMG/M |
| 3300018465|Ga0190269_10594048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 746 | Open in IMG/M |
| 3300018465|Ga0190269_10698200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → unclassified Mycobacteriaceae → Mycobacteriaceae bacterium 1482268.1 | 708 | Open in IMG/M |
| 3300018476|Ga0190274_10429721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1293 | Open in IMG/M |
| 3300018476|Ga0190274_10965695 | Not Available | 924 | Open in IMG/M |
| 3300018476|Ga0190274_12302216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter cummioxidans | 636 | Open in IMG/M |
| 3300019269|Ga0184644_1669721 | Not Available | 605 | Open in IMG/M |
| 3300019356|Ga0173481_10526991 | Not Available | 607 | Open in IMG/M |
| 3300019361|Ga0173482_10076887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1157 | Open in IMG/M |
| 3300019377|Ga0190264_10009410 | All Organisms → cellular organisms → Bacteria | 2834 | Open in IMG/M |
| 3300019377|Ga0190264_10124907 | Not Available | 1269 | Open in IMG/M |
| 3300020027|Ga0193752_1054319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. CCH12-B4 | 1734 | Open in IMG/M |
| 3300020137|Ga0206107_1061301 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300022892|Ga0247753_1031017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 636 | Open in IMG/M |
| 3300022897|Ga0247764_1055737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → unclassified Mycobacteriaceae → Mycobacteriaceae bacterium 1482268.1 | 1232 | Open in IMG/M |
| 3300022898|Ga0247745_1065944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Povalibacter → Povalibacter uvarum | 590 | Open in IMG/M |
| 3300023274|Ga0247763_1030432 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1542 | Open in IMG/M |
| 3300023275|Ga0247776_10358911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 537 | Open in IMG/M |
| 3300025167|Ga0209642_10528136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium sufflavum | 649 | Open in IMG/M |
| 3300025315|Ga0207697_10510483 | Not Available | 530 | Open in IMG/M |
| 3300025735|Ga0207713_1161020 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300025901|Ga0207688_10628839 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300025920|Ga0207649_10370527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter cummioxidans | 1065 | Open in IMG/M |
| 3300025920|Ga0207649_10538900 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300025921|Ga0207652_10393919 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300025921|Ga0207652_10636446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 954 | Open in IMG/M |
| 3300025932|Ga0207690_10288262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1281 | Open in IMG/M |
| 3300025942|Ga0207689_10331119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 1264 | Open in IMG/M |
| 3300025945|Ga0207679_11317945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Povalibacter → Povalibacter uvarum | 663 | Open in IMG/M |
| 3300026023|Ga0207677_10199494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1589 | Open in IMG/M |
| 3300026067|Ga0207678_11711243 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300026118|Ga0207675_100007519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10294 | Open in IMG/M |
| 3300026118|Ga0207675_100377729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → unclassified Mycobacteriaceae → Mycobacteriaceae bacterium 1482268.1 | 1393 | Open in IMG/M |
| 3300026834|Ga0207583_1003347 | Not Available | 599 | Open in IMG/M |
| 3300027873|Ga0209814_10060314 | Not Available | 1588 | Open in IMG/M |
| 3300027873|Ga0209814_10098323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → unclassified Mycobacteriaceae → Mycobacteriaceae bacterium 1482268.1 | 1241 | Open in IMG/M |
| 3300027886|Ga0209486_10222237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → unclassified Mycobacteriaceae → Mycobacteriaceae bacterium 1482268.1 | 1078 | Open in IMG/M |
| 3300027886|Ga0209486_10712376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → unclassified Mycobacteriaceae → Mycobacteriaceae bacterium 1482268.1 | 648 | Open in IMG/M |
| 3300027907|Ga0207428_10033336 | All Organisms → cellular organisms → Bacteria | 4231 | Open in IMG/M |
| 3300027907|Ga0207428_10104239 | All Organisms → cellular organisms → Bacteria | 2189 | Open in IMG/M |
| 3300027909|Ga0209382_10000164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 103642 | Open in IMG/M |
| 3300028381|Ga0268264_11022528 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300028592|Ga0247822_11174826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae | 640 | Open in IMG/M |
| 3300031228|Ga0299914_10131726 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2213 | Open in IMG/M |
| 3300031481|Ga0314816_1037829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 629 | Open in IMG/M |
| 3300031538|Ga0310888_10295394 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300031547|Ga0310887_10484390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 742 | Open in IMG/M |
| 3300031548|Ga0307408_100528394 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300031548|Ga0307408_101108386 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300031548|Ga0307408_101925895 | Not Available | 567 | Open in IMG/M |
| 3300031562|Ga0310886_10323435 | Not Available | 888 | Open in IMG/M |
| 3300031731|Ga0307405_10864433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 762 | Open in IMG/M |
| 3300031847|Ga0310907_10233704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 896 | Open in IMG/M |
| 3300031854|Ga0310904_10180635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 1255 | Open in IMG/M |
| 3300031854|Ga0310904_10233788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → unclassified Mycobacteriaceae → Mycobacteriaceae bacterium 1482268.1 | 1128 | Open in IMG/M |
| 3300031858|Ga0310892_10078048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → unclassified Mycobacteriaceae → Mycobacteriaceae bacterium 1482268.1 | 1743 | Open in IMG/M |
| 3300031892|Ga0310893_10102816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1051 | Open in IMG/M |
| 3300031913|Ga0310891_10111239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 853 | Open in IMG/M |
| 3300032002|Ga0307416_103426406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300032002|Ga0307416_103872693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300032003|Ga0310897_10291858 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300032005|Ga0307411_10138710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → unclassified Xanthomonadaceae → Xanthomonadaceae bacterium | 1790 | Open in IMG/M |
| 3300032005|Ga0307411_10806200 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 827 | Open in IMG/M |
| 3300032005|Ga0307411_11540844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → unclassified Mycobacteriaceae → Mycobacteriaceae bacterium 1482268.1 | 612 | Open in IMG/M |
| 3300032075|Ga0310890_10017782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3573 | Open in IMG/M |
| 3300032126|Ga0307415_101487705 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 7.10% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 6.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.16% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.16% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.87% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.94% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.29% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.29% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.29% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.65% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.65% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.65% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.65% |
| Filter Cake Produced In Cane Sugar Milling Plant | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Filter Cake Produced In Cane Sugar Milling Plant | 0.65% |
| Ant Dump | Host-Associated → Arthropoda → Ant Dump → Unclassified → Unclassified → Ant Dump | 0.65% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.65% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.65% |
| Root Nodules | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003972 | Composted filter cake microbial communities from Nova Europa, Brazil, from a cane sugar milling plant | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012940 | Organic Plus compost microbial communities from Emeryville, California, USA - Original compost - Organic plus compost (OP) | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300020137 | Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 2B0 | Host-Associated | Open in IMG/M |
| 3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
| 3300022897 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L051-202B-4 | Environmental | Open in IMG/M |
| 3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
| 3300023274 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L141-409B-4 | Environmental | Open in IMG/M |
| 3300023275 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026834 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A1-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031481 | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_02677410 | 2088090015 | Soil | MFTAISRKAQTAVCMILSAVIVSGSLSLGAFAADRAGHDGYSVTITQIS |
| GPICI_01860770 | 2088090015 | Soil | MFTISRKSQSAVCMILSAVIVTVGLSLGAFAFDHAAHNGYAVTITQIQ |
| GPICI_02695050 | 2088090015 | Soil | MLTSISRKTQSVVCMILSAVIVSGSLSLGAFAAERAERAAAHEGYSVTITQIS |
| INPgaii200_05332772 | 2228664022 | Soil | MFTSISRKTQTAVCMILSAVIVSGSLSLGAFAAEHAEHAHDGYSVTITQIQ |
| INPhiseqgaiiFebDRAFT_1013940473 | 3300000364 | Soil | MFTVTSRKVQSAVCMVLSAVIVSVGLSLGAFAADYAAHDGYSVTITQIQ* |
| INPhiseqgaiiFebDRAFT_1019893873 | 3300000364 | Soil | MFTSISRKTQTAVCMILSAVIVSGSLSLGAFAAEHAEHAHDGYSVTITQIQ* |
| JGI11643J12802_108939761 | 3300000890 | Soil | MITTLSRKTQTAVCMILSAVIVTVGLSLGAFAAERAAHHGYSVTIT |
| JGI10216J12902_1062160341 | 3300000956 | Soil | MFTASRTTQTAVCMILSAVIVTVSLSFGAFVAERAAHHGYSVTITQIQ* |
| soilL2_101127094 | 3300003319 | Sugarcane Root And Bulk Soil | MFTAISRKAQNAVCMILSAVIVSGSLSLGAFAADRASHDGYSVTITQIS* |
| soilL2_101629382 | 3300003319 | Sugarcane Root And Bulk Soil | MFTSISRKTQSIVCMILSAVIVSGSLSLGAFAAERAEHAAAHDGYSVTITQIS* |
| soilH2_102860042 | 3300003324 | Sugarcane Root And Bulk Soil | MFTSISRKTQSIVCMILSAVIVSGSLSLGAFAAERAEHAAAHEGYSVTITQIS* |
| Ga0064067_100611218 | 3300003972 | Filter Cake Produced In Cane Sugar Milling Plant | MFAISRTTQNAVCMILSAVIVSISLSLGALAAERAAHDGYTVTITQLQ* |
| Ga0062593_1000057216 | 3300004114 | Soil | MITSTSRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHEGYSVTITQIQ* |
| Ga0062593_1000341543 | 3300004114 | Soil | MFTISRKAQTAVCMILSAVIVSVGLSLGAFAAEHAAHHGYSVTITQIQ* |
| Ga0062593_1033756642 | 3300004114 | Soil | MFTALSRKAQNAVCMILSAVIVSGSLSLGAFAADRASHDGYSVTITQIS* |
| Ga0062590_1001785954 | 3300004157 | Soil | SRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHEGYSVTITQIQ* |
| Ga0062590_1022392782 | 3300004157 | Soil | MLTSISRKTQSVVCMILSAVIVSGSLSLGAFAAERAERAAAHEGYSVTITQIS* |
| Ga0063356_1000431002 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MFTAISRKAQTAVCMILSAVIVSGSLSLGAFAADRAGHDGYSVTITQIS* |
| Ga0063356_1025043892 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MFTLSRKAQNAVCMILSAVIVSGSLSLGAFAADRASHDGYSVTITQIS* |
| Ga0062595_1010535272 | 3300004479 | Soil | MITSISRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHEGYSVTITQIQ* |
| Ga0062594_1013097841 | 3300005093 | Soil | MLTSISRKTQSLICMILSAVIVSGSLSLGAFAAERAERAAAHEGYSVTITQIS* |
| Ga0065705_105377582 | 3300005294 | Switchgrass Rhizosphere | MITSISRKTQTAVCMILSAVIVSVGLSLGAFAAEHAGHHDGYSVTITQIQ* |
| Ga0070683_1017690592 | 3300005329 | Corn Rhizosphere | MYAVTSKIQSAVCMILSAVIISASLSLGAVAAERATHHQGYSVTVTELQ* |
| Ga0070670_1000115101 | 3300005331 | Switchgrass Rhizosphere | MITSTSRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHEGYSV |
| Ga0066388_1030363132 | 3300005332 | Tropical Forest Soil | RTSQRETEETVMFTAISRNTQTAVCMILSAVIVSVSLSLGAFAAERAEHAAHPGYSVTITQLQ* |
| Ga0066388_1060184412 | 3300005332 | Tropical Forest Soil | MITSISRKTQTAVCMILSAVIVSAGLSLGAFAAERAAHHDGYSVTIT |
| Ga0070677_105263922 | 3300005333 | Miscanthus Rhizosphere | MITSISRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHDGYSVTITQIQ* |
| Ga0068869_1003167961 | 3300005334 | Miscanthus Rhizosphere | MFTISRKAQTAVCMILSAVIVSVGLSLGAFAAEHAAHHGYSVTITQMQ* |
| Ga0068868_1000803471 | 3300005338 | Miscanthus Rhizosphere | REIEETVMITSTSRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHEGYSVTITQIQ* |
| Ga0070661_1002308362 | 3300005344 | Corn Rhizosphere | MYAMTNKIQSAVCMILSAVIISASLSVGAFAADRAVHHQGYSVTITELQ* |
| Ga0070663_1017763742 | 3300005455 | Corn Rhizosphere | QSAVCIILSAVIISASLSVGAFAADRAVHHQGYSVTITELQ* |
| Ga0070681_106336251 | 3300005458 | Corn Rhizosphere | MFTISRKAQTAVCMILSAVIVSVGLSLGAFAAEHAAHHGYSVTITQI |
| Ga0070681_106819712 | 3300005458 | Corn Rhizosphere | MFTAISRTTQTAVCMILSAVIVTVGLSLGAFAFDHAAHNAYAVTVTQIQ* |
| Ga0068867_1016147161 | 3300005459 | Miscanthus Rhizosphere | FTISRKAQTAVCMILSAVIVSVGLSLGAFAAEHAAHHGYSVTITQIQ* |
| Ga0070679_1002489472 | 3300005530 | Corn Rhizosphere | MFAITHKLESAVCMILSAVIISASLSLGAFAAERATHQHGYSVTVTELQ* |
| Ga0070679_1002627772 | 3300005530 | Corn Rhizosphere | MFTISRKSQSAVCMILSAVIVTVGLSLGAFAFDHAAHNAYAVTVTQIQ* |
| Ga0070684_1019938671 | 3300005535 | Corn Rhizosphere | PEETVMFTISRKAQTAVCMILSAVIVSVGLSLGAFAAEHAAHHGYSVTITQIQ* |
| Ga0070665_1000952992 | 3300005548 | Switchgrass Rhizosphere | MFTAISRKTQTAVCMLLSAVIVSASLSLGAFAAERATHDGYSVTITQIQ* |
| Ga0070664_1018538441 | 3300005564 | Corn Rhizosphere | MFTSISRKAQSAVCMILAAVIVSVSLSLGAFAAEHAAAHEGYSVTITQIQ* |
| Ga0070664_1018762752 | 3300005564 | Corn Rhizosphere | SRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHDGYSVTITQIQ* |
| Ga0068857_1011829812 | 3300005577 | Corn Rhizosphere | TQTAVCMILSAVIVSTGLSLGAFAADHVAAHDGYSVTITQIQ* |
| Ga0068852_1009710591 | 3300005616 | Corn Rhizosphere | MITSTSRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHDGYSVTITQIQ* |
| Ga0081540_10674132 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MFTTISRKTQSIVCMILSAVIVSGSLSLGAFAAERAEHAASHEGYSVTITQIS* |
| Ga0075417_100222922 | 3300006049 | Populus Rhizosphere | MFTVISRKTQTAVCMILSAVIVSGSLSLGAFAAERAAHDGYSVTITQIQ* |
| Ga0075422_102853191 | 3300006196 | Populus Rhizosphere | MFTVASRKTQSAVCMILSAVIVTVGLSLGSFAADSAYHDGYSVTITQIQ* |
| Ga0075422_103039511 | 3300006196 | Populus Rhizosphere | MLTTISRKTQTVVCMILSAVIVSGSLSLGAFAAEHAERAAAHEGYSVTITQIS* |
| Ga0079222_123919532 | 3300006755 | Agricultural Soil | MFTASRKTQTAVCMILSAVIVSVSLSLGAFAAERAAHHDGYSVTITQIQ* |
| Ga0075428_1000035264 | 3300006844 | Populus Rhizosphere | MITTLSRKTQTAVCMILSAVIVTVGLSLGAFAAERAAHHGYSVTITQIQ* |
| Ga0075421_1001913883 | 3300006845 | Populus Rhizosphere | MFTISRKAQTAVCMILSAVIVSVGLSLGAFAAEHAAHHGYSVTITQ |
| Ga0075421_1016723782 | 3300006845 | Populus Rhizosphere | MFTISRKAQTAVCMILSAVIVSVGLSLGAFAAEHAAHLGYSVTITQIQ* |
| Ga0075420_1010203652 | 3300006853 | Populus Rhizosphere | RDQETVMFTAISRKAQTAVCMILSAVIVSGSLSLGAFAADRAGHDGYSVTITQIS* |
| Ga0079217_108114222 | 3300006876 | Agricultural Soil | MFTVISRKAQNVVCMILSAVIVSSSLSLGAFAAERAAHDGYSVTVTQIQ* |
| Ga0079217_117097422 | 3300006876 | Agricultural Soil | ETQEIVMFTAISRKTQAVVCMFLSAVIVSGSLSLGAFAAEVAAPSGYSVTVTQIQ* |
| Ga0068865_1001667701 | 3300006881 | Miscanthus Rhizosphere | EIEETVMITSTSRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHEGYSVTITQIQ* |
| Ga0079215_101526281 | 3300006894 | Agricultural Soil | MFTAISRKAQNVVCMILSAVIVSSSLSLGAFAAERAAHDGYSVTITQIQ* |
| Ga0079215_110190391 | 3300006894 | Agricultural Soil | MFTAISRKSQNVVCMILSAVIVSASLSLGAFAAERAAHDGYSVTVTQIQ* |
| Ga0075426_111862662 | 3300006903 | Populus Rhizosphere | MITSISRKTQTAVCMILSAVIVSAGLSLGAFAAERAAHHDGYSVTITQIQ* |
| Ga0079216_112713141 | 3300006918 | Agricultural Soil | MFTVISRNTQTVVCMILSAVIVSGSLSLGALAAERAAHDGYSVTVTQIQ* |
| Ga0099826_100363272 | 3300006948 | Root Nodules | MFTAISRNTQTAVCMMLSAVIVSVSLSLGAFAAERAAHGGYSVTITQLQ* |
| Ga0079218_101765093 | 3300007004 | Agricultural Soil | MFTAISRKTQTAVCMILSAVIVSVGLSLGALAADYAARDGYSVTVTQIQ* |
| Ga0079218_112986252 | 3300007004 | Agricultural Soil | MFTVTSRTTQNAVCMILSAVIVTVSLSLGAFAAERAAHDGYSVTITQIQ* |
| Ga0079218_124082742 | 3300007004 | Agricultural Soil | MFTAISRKSQNVVCMILSAVIVSASLSLGAFAAERAAHDGYTVTVTQIQ* |
| Ga0075418_101562912 | 3300009100 | Populus Rhizosphere | MFTISRKAQTAVCMILSAVIVSVGLSLGAFAAEHAGHHDGYSVTITQIQ* |
| Ga0075418_108240562 | 3300009100 | Populus Rhizosphere | MLTSISRKTQSLICMILSAVIVSGSLSLGAFAAEHAERAAAHEGYSVTITQIS* |
| Ga0114129_115381152 | 3300009147 | Populus Rhizosphere | MFTAISRKAQTAVCMFLSAVIVSGSLSLGAFAAERAEHAAAHDGYSV |
| Ga0111538_111840432 | 3300009156 | Populus Rhizosphere | VERDQETVMFTAISRKAQTAVCMILSAVIVSGSLSLGAFAADRAGHDGYSVTITQIS* |
| Ga0111538_118879882 | 3300009156 | Populus Rhizosphere | SRKTQTAVCMILSAVIVTVGLSLGAFAAERAAHHGYSVTITQIQ* |
| Ga0111538_137467932 | 3300009156 | Populus Rhizosphere | DQETVMFTAISRKAQTAVCMILSAVIVSGSLSLGAFAADRAGHDGYSVTITQIS* |
| Ga0075423_108389493 | 3300009162 | Populus Rhizosphere | MFTISRKAQTAVCMILSAVIVSVGLSLGAFAADHAAHHGYSVTITQIQ* |
| Ga0105238_111899371 | 3300009551 | Corn Rhizosphere | NADTAKRDQETVMFTLSRKAQNAVCMILSAVIVSGSLSLGAFAADRASHDGYSVTITQIS |
| Ga0126377_100090372 | 3300010362 | Tropical Forest Soil | MFSVTSSKIQSAVCMILSAVIVSASLSLGAFAAEHAAHNGYSVTITQIA* |
| Ga0134127_116394821 | 3300010399 | Terrestrial Soil | MFTASRKVQNAVCMILSAVIVSASLSLGAFAAERAEHAHDGYSVTITQIQ |
| Ga0150985_1011215341 | 3300012212 | Avena Fatua Rhizosphere | TRTSQRQIEETVMITTISRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHDGYSVTITQIQ* |
| Ga0150984_1044806151 | 3300012469 | Avena Fatua Rhizosphere | RGPSQRPKEIAMYAMTNKIQSAVCMILSAVIISASLSVGAFAADRAAHHQGYSVTITELQ |
| Ga0150984_1063272181 | 3300012469 | Avena Fatua Rhizosphere | TTRTSQRQIEETVMITTISRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHDGYSVTITQIQ* |
| Ga0150984_1153749361 | 3300012469 | Avena Fatua Rhizosphere | KIQSAVCMILSAVIISASLSLGAVAAERATHHQGYSVTVTELQ* |
| Ga0157304_11180572 | 3300012882 | Soil | MITSTSRKTQTAVCMILSAIIVSVGLSLGAFAAEHAAHHDGYSVTITQIQ* |
| Ga0164243_100596775 | 3300012940 | Compost | MFAISNRTTQSAVCMILSAVIVSISLSLGALAAERAAYDGYTVTITQLQ* |
| Ga0164241_100090897 | 3300012943 | Soil | MFSVTGRNIQNAVCMILSAVIVSVSLSLGAFAAERAEHSGYSVTITQIG* |
| Ga0164241_101948552 | 3300012943 | Soil | MFTVVNRKNQSAICMILSAVIVSLSLSLGALAAEHAAHDGYSVTVTQIQ* |
| Ga0157374_110929312 | 3300013296 | Miscanthus Rhizosphere | MITSTSRKTKTAVCMILSAVIVSVGLSLGAFAAEHAAHHEGYSVTITQIQ* |
| Ga0132258_100453677 | 3300015371 | Arabidopsis Rhizosphere | MITSISRKTQTAVCMILSAVIVSLGLSLGAFAAEHAGHHDGYSVTITQIQ* |
| Ga0132258_110354024 | 3300015371 | Arabidopsis Rhizosphere | MITSISRKTQTAVCMILSAVIVSAGLSLGAFAAEHAAHHDGYSVTITQIQ* |
| Ga0132255_1049463601 | 3300015374 | Arabidopsis Rhizosphere | MFAVTHKIESAVCMILSAVIISASLSLGAFAAERATQQHGYSVTITELQ* |
| Ga0190265_102139031 | 3300018422 | Soil | MFTAISRKSQNVVCMILSAVIVSASLSLGAFAAERAAHDGYSVTVTQIQ |
| Ga0190265_104251863 | 3300018422 | Soil | MFTAISRKAQNVVCMILSAVIVSSSLSLGAFAAERAAHDGYSVTVTQIQ |
| Ga0190265_113751162 | 3300018422 | Soil | MFTVISRKAQNVVCMILSAVIVSSSLSLGAFAAERAAHDGYSVTITQIQ |
| Ga0190272_108267612 | 3300018429 | Soil | MFTAISRKSQNVVCMILSAVIVSGSLSLGAFAAERAAHGGYSVTVTQIQ |
| Ga0190272_112579092 | 3300018429 | Soil | MFTVISRKAQNVVCMILSAVIVSSSLSLGAFAAERAAHDGYSVTVTQIQ |
| Ga0190272_132863011 | 3300018429 | Soil | MFTAISRKTQNVVCMILSAVIVSASLSLGAFAAERAAHDGYSVTITQIQ |
| Ga0190269_105940482 | 3300018465 | Soil | MFTAISRNTQTVVCMMLSAVIVSVSLSLGAFAAERAAQDGYSVTITQIQ |
| Ga0190269_106982001 | 3300018465 | Soil | MFTAISRKSQNVICMILSAVIVSASLSLGAFAAERAAHDG |
| Ga0190274_104297212 | 3300018476 | Soil | MFTAINRKTQSAVCMILSAVIVCAGLSLGAFAAEHAAAHDGYSVTITQIQ |
| Ga0190274_109656953 | 3300018476 | Soil | MFTVTSRKTQNAICMILSAVIVSVGLSLGAFAAEHAGQTGHDGYSVTITQIQ |
| Ga0190274_123022161 | 3300018476 | Soil | NADVAEKRSKETVMFTISRKSQSAVCMILSAVIVSVGLSLGAFAFDHAAHNGYAVTVTQI |
| Ga0184644_16697211 | 3300019269 | Groundwater Sediment | MFTAISRTTQKAVCMILSAVIVSVSLSLGAFAAERAAHDGYSVTITQIQ |
| Ga0173481_105269912 | 3300019356 | Soil | MITSTSRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHEGYSVTITQIQ |
| Ga0173482_100768872 | 3300019361 | Soil | MITSISRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHDGYSVTITQIQ |
| Ga0190264_100094102 | 3300019377 | Soil | MFTAISRKSQNVVCMILSAVIVSASLSLGAFAAERAARDGYSVTVTQIQ |
| Ga0190264_101249072 | 3300019377 | Soil | MFTVISRKAQTVVCMILSAVIVSSSLSLGAFAAERAAHDGYSVTVTQIQ |
| Ga0193752_10543193 | 3300020027 | Soil | MFTVTSRKTQSVVCMILSAVIVSLGLSLSAFAAERAAHDGYSVTVTQIQ |
| Ga0206107_10613011 | 3300020137 | Ant Dump | MFALTVNNSKMQSAVCMVLSAIIVSVGLSLGAFAAERAADVGYSVTITQLS |
| Ga0247753_10310173 | 3300022892 | Soil | TVMFTISRKAQTAVCMILSAVIVSVGLSLGAFAAEHAAHHGYSVTITQIQ |
| Ga0247764_10557372 | 3300022897 | Plant Litter | MFTASRTTQNAVCMFLSAVIVSVSLSLGAFAADRAAHSGYSVTITQLR |
| Ga0247745_10659441 | 3300022898 | Soil | MFTISRKAQTAVCMILSAVIVSVGLSLGAFAAEHAAHHGYSVTITQIQ |
| Ga0247763_10304321 | 3300023274 | Plant Litter | MFTASRTTQNAVCMFLSAVIVSVSLSLGAFAAERAAHSGYSVTITQLR |
| Ga0247776_103589112 | 3300023275 | Plant Litter | MFAVTHKFQSAVCMILSAVIVSASLSLGAFAADRAAHVGY |
| Ga0209642_105281362 | 3300025167 | Soil | MFTAISRKTQSVVCMILSAVIVSASLSLGAFAAERAAHDGYSVTITQIQ |
| Ga0207697_105104831 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MITSISRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHEGYSVTITQIQ |
| Ga0207713_11610201 | 3300025735 | Switchgrass Rhizosphere | TSTSRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHEGYSVTITQIQ |
| Ga0207688_106288392 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MFTALSRKAQNAVCMILSAVIVSGSLSLGAFAADRASHDGYSVTITQIS |
| Ga0207649_103705272 | 3300025920 | Corn Rhizosphere | MYAVTSKIQSAVCMILSAVIISASLSLGAVAAERATHHQGYSVTVTELQ |
| Ga0207649_105389002 | 3300025920 | Corn Rhizosphere | MYAMTNKIQSAVCMILSAVIISASLSVGAFAADRAVHHQGYSVTITELQ |
| Ga0207652_103939193 | 3300025921 | Corn Rhizosphere | MFTISRKSQSAVCMILSAVIVTVGLSLGAFAFDHAAHNAYAVTVTQIQ |
| Ga0207652_106364462 | 3300025921 | Corn Rhizosphere | MFAITHKLESAVCMILSAVIISASLSLGAFAAERATHQQGYSVTVTELQ |
| Ga0207690_102882622 | 3300025932 | Corn Rhizosphere | MITSVSRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHEGYSVTITQIQ |
| Ga0207689_103311194 | 3300025942 | Miscanthus Rhizosphere | MFTISRKAQTAVCMILSAVIVSVGLSLGAFAAEHAAHHGYSVTITQMQ |
| Ga0207679_113179451 | 3300025945 | Corn Rhizosphere | MFTSISRKAQSAVCMILAAVIVSVSLSLGAFAAEHAAAHEGYSVTITQIQ |
| Ga0207677_101994944 | 3300026023 | Miscanthus Rhizosphere | REIEETVMITSTSRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHEGYSVTITQIQ |
| Ga0207678_117112431 | 3300026067 | Corn Rhizosphere | QSAVCIILSAVIISASLSVGAFAADRAVHHQGYSVTITELQ |
| Ga0207675_10000751912 | 3300026118 | Switchgrass Rhizosphere | MITSTSRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHNEGYS |
| Ga0207675_1003777291 | 3300026118 | Switchgrass Rhizosphere | MITSISRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHDGYSAAKAPSD |
| Ga0207583_10033472 | 3300026834 | Soil | ETVMITSTSRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHEGYSVTITQIQ |
| Ga0209814_100603142 | 3300027873 | Populus Rhizosphere | MFTVISRKTQTAVCMILSAVIVSGSLSLGAFAAERAAHDGYSVTITQIQ |
| Ga0209814_100983232 | 3300027873 | Populus Rhizosphere | MITTLSRKTQTAVCMILSAVIVTVGLSLGAFAAERAAHHGYSVTITQIQ |
| Ga0209486_102222371 | 3300027886 | Agricultural Soil | MFTAISRKTQTAVCMILSAVIVSVGLSLGALAADYAARDGYSVTVTQIQ |
| Ga0209486_107123761 | 3300027886 | Agricultural Soil | MFTAISRKSQNVICMILSAVIVSASLSLGAFAAERAAHDGYTVTVTQIQ |
| Ga0207428_100333362 | 3300027907 | Populus Rhizosphere | MLTTISRKTQTVVCMILSAVIVSGSLSLGAFAAEHAERAAAHEGYSVTITQIS |
| Ga0207428_101042395 | 3300027907 | Populus Rhizosphere | QRETKEIVMFTVASRKTQSAVCMILSAVIVTVGLSLGSFAADSAYHDGYSVTITQIQ |
| Ga0209382_1000016421 | 3300027909 | Populus Rhizosphere | MFTVASRKTQSAVCMILSAVIVTVGLSLGSFAADSAYHDGYSVTITQIQ |
| Ga0268264_110225282 | 3300028381 | Switchgrass Rhizosphere | RTEETVMITSISRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHHDGYSVTITQIQ |
| Ga0247822_111748261 | 3300028592 | Soil | KRPKETVMFTVISRKNQSAVCMILSAVIVSFSLSLGAFAAEHAAHDGYSVTITQIQ |
| Ga0299914_101317262 | 3300031228 | Soil | MFTNISRKTQTAVCMILSAVIVSGSLSLGAFAAERAVHDGYSVTITQIQ |
| Ga0314816_10378291 | 3300031481 | Soil | REETEETAMLTSISRKTQSLICMILSAVIVSGSLSLGAFAAERAERAAAHEGYSVTITQI |
| Ga0310888_102953942 | 3300031538 | Soil | MLTSISRKTQSLICMILSAVIVSGSLSLGAFAAERAERAAAHEGYSVTITQIS |
| Ga0310887_104843901 | 3300031547 | Soil | MFTISRKAQTAVCMILSAVIVSVGLSLGAFAAEHAAHHGYSVTITQIQCV |
| Ga0307408_1005283942 | 3300031548 | Rhizosphere | MFTAISRKSQSAVCMILSAVIVTVGLSLGAFAFDHAAHNGYAVTITQIQ |
| Ga0307408_1011083861 | 3300031548 | Rhizosphere | MITSISRKTQTAVCMILSAVIVSAGLSLGAFAAEHAARHDGYSVTITQIQ |
| Ga0307408_1019258952 | 3300031548 | Rhizosphere | MFTVISRKAQTAVCMILSAVIVSGSLSLGAFAADRAAHDGYSVTITQIS |
| Ga0310886_103234351 | 3300031562 | Soil | EETVMFTVISRKTQTAVCMILSAVIVSGSLSLGAFAAERAAHDGYSVTITQIQ |
| Ga0307405_108644332 | 3300031731 | Rhizosphere | ERTEETVMITSISRKTQTAVCMILSAVIVSAGLSLGAFAAEHAARHDGYSVTITQIQ |
| Ga0310907_102337041 | 3300031847 | Soil | MFTISRKAQTAVCMILSAVIVSVGLSLGAFAAEHAERAAAHEGYSVTI |
| Ga0310904_101806351 | 3300031854 | Soil | RKAQTAVCMILSAVIVSVGLSLGAFAAEHAAHHGYSVTITQIQ |
| Ga0310904_102337882 | 3300031854 | Soil | MITSISRKTQTAVCMILSAVIVSVGLSLGAFAAEHAGHHDGYSVTITQIQ |
| Ga0310892_100780483 | 3300031858 | Soil | MFTISRKAQTAVCMILSAVIVSVGLSLGAFAAEHAAHHGYSVSITQIQ |
| Ga0310893_101028162 | 3300031892 | Soil | MFTISRKAQTAVCMILSAVIVSVGLSLGAFAAEHAAQNGYSVTITQIQ |
| Ga0310891_101112391 | 3300031913 | Soil | MITSTSRKTQTAVCMILSAVIVSVGLSLGAFAAEHAAHNEGYSVTITQIQ |
| Ga0307416_1034264062 | 3300032002 | Rhizosphere | MFTAISRKAQTVVCMFLSAVIVSGSLSLGAFAAESATHDGYSVTVTQIQ |
| Ga0307416_1038726932 | 3300032002 | Rhizosphere | SRKSLKVICMILSAFIVSASLSLGAFAAERAAHDGYTVTVTQIQ |
| Ga0310897_102918581 | 3300032003 | Soil | RKTQTAVCMILSAVIVSVGLSLGAFAAEHAGHHDGYSVTITQIQ |
| Ga0307411_101387102 | 3300032005 | Rhizosphere | MLTSISRKTQSVVCMILSAVIVSGSLSLSAFAAERAERAAAHEGYSVTITQIS |
| Ga0307411_108062001 | 3300032005 | Rhizosphere | HKIQSAVCMILSAVIVSASLSLGAFAAERAAHVGYTVTITQLA |
| Ga0307411_115408442 | 3300032005 | Rhizosphere | MITTLSRKTQTAVCMILSAVIVSVGLSLGAFAAERAAHHGYSVTITQIQ |
| Ga0310890_100177824 | 3300032075 | Soil | MITTLSRKTQTAVCMILSAVIVTVGLSLGAFAAERAAHHGYSVTI |
| Ga0307415_1014877052 | 3300032126 | Rhizosphere | MFTSISRNAQSAVCMILSAVIVIAGLSLGAFAAEHAAAHDGYSVTITQIQ |
| ⦗Top⦘ |