


| Basic Information | |
|---|---|
| Family ID | F043879 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 155 |
| Average Sequence Length | 44 residues |
| Representative Sequence | TPAAAGGYVEELLNRPGPMNDDERKQLRERYRWEIVGPNPL |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 155 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.94 % |
| % of genes near scaffold ends (potentially truncated) | 92.26 % |
| % of genes from short scaffolds (< 2000 bps) | 90.97 % |
| Associated GOLD sequencing projects | 129 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.903 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (13.548 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.935 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.935 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 155 Family Scaffolds |
|---|---|---|
| PF04264 | YceI | 10.32 |
| PF00583 | Acetyltransf_1 | 9.68 |
| PF01958 | Asp_DH_C | 8.39 |
| PF03447 | NAD_binding_3 | 5.16 |
| PF01156 | IU_nuc_hydro | 2.58 |
| PF16864 | Dimerisation2 | 2.58 |
| PF13561 | adh_short_C2 | 1.29 |
| PF03795 | YCII | 1.29 |
| PF13302 | Acetyltransf_3 | 1.29 |
| PF13563 | 2_5_RNA_ligase2 | 1.29 |
| PF04909 | Amidohydro_2 | 1.29 |
| PF12840 | HTH_20 | 1.29 |
| PF07690 | MFS_1 | 1.29 |
| PF01925 | TauE | 0.65 |
| PF01434 | Peptidase_M41 | 0.65 |
| PF13191 | AAA_16 | 0.65 |
| PF00496 | SBP_bac_5 | 0.65 |
| PF13847 | Methyltransf_31 | 0.65 |
| PF13410 | GST_C_2 | 0.65 |
| PF00581 | Rhodanese | 0.65 |
| PF03364 | Polyketide_cyc | 0.65 |
| PF13489 | Methyltransf_23 | 0.65 |
| PF01661 | Macro | 0.65 |
| PF13439 | Glyco_transf_4 | 0.65 |
| PF00732 | GMC_oxred_N | 0.65 |
| PF00892 | EamA | 0.65 |
| PF01738 | DLH | 0.65 |
| PF01243 | Putative_PNPOx | 0.65 |
| PF13701 | DDE_Tnp_1_4 | 0.65 |
| PF00561 | Abhydrolase_1 | 0.65 |
| PF01435 | Peptidase_M48 | 0.65 |
| PF13360 | PQQ_2 | 0.65 |
| PF02826 | 2-Hacid_dh_C | 0.65 |
| PF06537 | DHOR | 0.65 |
| PF12706 | Lactamase_B_2 | 0.65 |
| PF00528 | BPD_transp_1 | 0.65 |
| PF07969 | Amidohydro_3 | 0.65 |
| PF05988 | DUF899 | 0.65 |
| PF12773 | DZR | 0.65 |
| PF07521 | RMMBL | 0.65 |
| PF13452 | MaoC_dehydrat_N | 0.65 |
| PF13751 | DDE_Tnp_1_6 | 0.65 |
| PF00082 | Peptidase_S8 | 0.65 |
| PF09363 | XFP_C | 0.65 |
| PF06739 | SBBP | 0.65 |
| PF00753 | Lactamase_B | 0.65 |
| PF08240 | ADH_N | 0.65 |
| PF01878 | EVE | 0.65 |
| PF08734 | GYD | 0.65 |
| PF13491 | FtsK_4TM | 0.65 |
| PF12973 | Cupin_7 | 0.65 |
| PF03466 | LysR_substrate | 0.65 |
| PF02515 | CoA_transf_3 | 0.65 |
| PF13495 | Phage_int_SAM_4 | 0.65 |
| PF13473 | Cupredoxin_1 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 155 Family Scaffolds |
|---|---|---|---|
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 10.32 |
| COG1712 | L-aspartate dehydrogenase, NAD(P)-dependent | Amino acid transport and metabolism [E] | 8.39 |
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 2.58 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.29 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.65 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.65 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.65 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.65 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.65 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.65 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.65 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.90 % |
| Unclassified | root | N/A | 7.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c1058039 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101508661 | Not Available | 1065 | Open in IMG/M |
| 3300000955|JGI1027J12803_106037544 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300002908|JGI25382J43887_10340410 | Not Available | 639 | Open in IMG/M |
| 3300003319|soilL2_10246816 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
| 3300005172|Ga0066683_10801946 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005178|Ga0066688_10050474 | All Organisms → cellular organisms → Bacteria | 2403 | Open in IMG/M |
| 3300005295|Ga0065707_10147665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1695 | Open in IMG/M |
| 3300005332|Ga0066388_102644677 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300005445|Ga0070708_101117774 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300005450|Ga0066682_10208424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1253 | Open in IMG/M |
| 3300005467|Ga0070706_101556917 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 603 | Open in IMG/M |
| 3300005468|Ga0070707_101283571 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 698 | Open in IMG/M |
| 3300005530|Ga0070679_100934299 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300005540|Ga0066697_10635895 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 588 | Open in IMG/M |
| 3300005546|Ga0070696_101780707 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005552|Ga0066701_10069599 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
| 3300005555|Ga0066692_10277807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1060 | Open in IMG/M |
| 3300005557|Ga0066704_10644680 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 674 | Open in IMG/M |
| 3300005559|Ga0066700_10070256 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2218 | Open in IMG/M |
| 3300005560|Ga0066670_10169584 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300005586|Ga0066691_10074252 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
| 3300005598|Ga0066706_11145325 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005713|Ga0066905_100243393 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300005764|Ga0066903_105770653 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005764|Ga0066903_107698329 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 554 | Open in IMG/M |
| 3300005843|Ga0068860_100428927 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300006031|Ga0066651_10128470 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1309 | Open in IMG/M |
| 3300006032|Ga0066696_10740873 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 629 | Open in IMG/M |
| 3300006034|Ga0066656_11067401 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006755|Ga0079222_10331640 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1015 | Open in IMG/M |
| 3300006846|Ga0075430_100126192 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2133 | Open in IMG/M |
| 3300006847|Ga0075431_100191587 | All Organisms → cellular organisms → Bacteria | 2095 | Open in IMG/M |
| 3300006852|Ga0075433_10742686 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 859 | Open in IMG/M |
| 3300006880|Ga0075429_101848993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 524 | Open in IMG/M |
| 3300006914|Ga0075436_101221586 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006954|Ga0079219_10710927 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300007076|Ga0075435_100709019 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 875 | Open in IMG/M |
| 3300007255|Ga0099791_10305985 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300009090|Ga0099827_10443473 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300009137|Ga0066709_102054205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 791 | Open in IMG/M |
| 3300009174|Ga0105241_10274085 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300009174|Ga0105241_12475502 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300009553|Ga0105249_10900126 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 952 | Open in IMG/M |
| 3300009691|Ga0114944_1473080 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 532 | Open in IMG/M |
| 3300009777|Ga0105164_10042020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2483 | Open in IMG/M |
| 3300009806|Ga0105081_1026712 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 743 | Open in IMG/M |
| 3300009807|Ga0105061_1016740 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300009815|Ga0105070_1107533 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 554 | Open in IMG/M |
| 3300009816|Ga0105076_1029077 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300009820|Ga0105085_1110940 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 543 | Open in IMG/M |
| 3300009837|Ga0105058_1096789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300010047|Ga0126382_10177363 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300010047|Ga0126382_12540050 | Not Available | 500 | Open in IMG/M |
| 3300010048|Ga0126373_10709502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1064 | Open in IMG/M |
| 3300010303|Ga0134082_10117722 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1060 | Open in IMG/M |
| 3300010359|Ga0126376_10607164 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1036 | Open in IMG/M |
| 3300010359|Ga0126376_11534384 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 696 | Open in IMG/M |
| 3300010361|Ga0126378_12168702 | Not Available | 634 | Open in IMG/M |
| 3300010366|Ga0126379_13348146 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300010391|Ga0136847_10876508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2276 | Open in IMG/M |
| 3300010391|Ga0136847_11936017 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300010397|Ga0134124_11864287 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300010398|Ga0126383_10369077 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1462 | Open in IMG/M |
| 3300010398|Ga0126383_13360135 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 523 | Open in IMG/M |
| 3300010403|Ga0134123_11276803 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 769 | Open in IMG/M |
| 3300010880|Ga0126350_10567875 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300011270|Ga0137391_11424590 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012096|Ga0137389_11197592 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300012203|Ga0137399_10125220 | All Organisms → cellular organisms → Bacteria | 2024 | Open in IMG/M |
| 3300012205|Ga0137362_10036457 | All Organisms → cellular organisms → Bacteria | 3933 | Open in IMG/M |
| 3300012205|Ga0137362_11673335 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300012208|Ga0137376_11271625 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300012209|Ga0137379_10319314 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300012224|Ga0134028_1169743 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 692 | Open in IMG/M |
| 3300012285|Ga0137370_10146533 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300012353|Ga0137367_10980581 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012358|Ga0137368_10616362 | Not Available | 688 | Open in IMG/M |
| 3300012363|Ga0137390_10426865 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300012671|Ga0137318_1004286 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300012918|Ga0137396_10221698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1393 | Open in IMG/M |
| 3300012918|Ga0137396_10892654 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012922|Ga0137394_10794068 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300012925|Ga0137419_10009579 | All Organisms → cellular organisms → Bacteria | 5163 | Open in IMG/M |
| 3300012930|Ga0137407_10529359 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300012948|Ga0126375_10078909 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300012948|Ga0126375_11598181 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300012960|Ga0164301_11363008 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300013308|Ga0157375_12423039 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 626 | Open in IMG/M |
| 3300015358|Ga0134089_10448380 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300015359|Ga0134085_10068349 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1443 | Open in IMG/M |
| 3300015359|Ga0134085_10465932 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 574 | Open in IMG/M |
| 3300015372|Ga0132256_101812018 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
| 3300015374|Ga0132255_100351471 | All Organisms → cellular organisms → Bacteria | 2135 | Open in IMG/M |
| 3300017657|Ga0134074_1103120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 981 | Open in IMG/M |
| 3300017659|Ga0134083_10155048 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 929 | Open in IMG/M |
| 3300017997|Ga0184610_1291543 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
| 3300018032|Ga0187788_10279099 | Not Available | 671 | Open in IMG/M |
| 3300018054|Ga0184621_10149315 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 841 | Open in IMG/M |
| 3300018056|Ga0184623_10356384 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300018074|Ga0184640_10358478 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300018075|Ga0184632_10238626 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 796 | Open in IMG/M |
| 3300018079|Ga0184627_10218126 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300018082|Ga0184639_10394029 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 716 | Open in IMG/M |
| 3300018431|Ga0066655_10466092 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 835 | Open in IMG/M |
| 3300018466|Ga0190268_11550525 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
| 3300019885|Ga0193747_1094648 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300020004|Ga0193755_1046380 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300020583|Ga0210401_10578686 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 985 | Open in IMG/M |
| 3300021178|Ga0210408_11028195 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 636 | Open in IMG/M |
| 3300022527|Ga0242664_1074817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 660 | Open in IMG/M |
| 3300022563|Ga0212128_10564786 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300022756|Ga0222622_11140520 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 574 | Open in IMG/M |
| 3300025905|Ga0207685_10556098 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
| 3300025910|Ga0207684_10063458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3136 | Open in IMG/M |
| 3300025910|Ga0207684_10346274 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1279 | Open in IMG/M |
| 3300025912|Ga0207707_10758379 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 811 | Open in IMG/M |
| 3300025922|Ga0207646_10054533 | All Organisms → cellular organisms → Bacteria | 3575 | Open in IMG/M |
| 3300025922|Ga0207646_11157595 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300025922|Ga0207646_11439064 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 598 | Open in IMG/M |
| 3300025930|Ga0207701_10415750 | Not Available | 1157 | Open in IMG/M |
| 3300025934|Ga0207686_11086713 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300026041|Ga0207639_11458941 | Not Available | 642 | Open in IMG/M |
| 3300026306|Ga0209468_1170802 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300026334|Ga0209377_1048831 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1904 | Open in IMG/M |
| 3300026334|Ga0209377_1183334 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 725 | Open in IMG/M |
| 3300026358|Ga0257166_1030512 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300026528|Ga0209378_1160941 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 865 | Open in IMG/M |
| 3300026557|Ga0179587_10626268 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300027610|Ga0209528_1127716 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300027671|Ga0209588_1152278 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 732 | Open in IMG/M |
| 3300027874|Ga0209465_10211404 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300028608|Ga0247819_10999390 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 529 | Open in IMG/M |
| 3300028711|Ga0307293_10043039 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1392 | Open in IMG/M |
| 3300028812|Ga0247825_10498947 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300028878|Ga0307278_10318479 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300031226|Ga0307497_10171207 | Not Available | 919 | Open in IMG/M |
| 3300031229|Ga0299913_10787510 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → unclassified Nitrospira → Nitrospira bacterium SG8_3 | 925 | Open in IMG/M |
| 3300031455|Ga0307505_10103796 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300031681|Ga0318572_10752063 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
| 3300031720|Ga0307469_10815890 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 857 | Open in IMG/M |
| 3300031720|Ga0307469_11847521 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300031740|Ga0307468_100877253 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 775 | Open in IMG/M |
| 3300031820|Ga0307473_11097327 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 586 | Open in IMG/M |
| 3300031820|Ga0307473_11371746 | Not Available | 532 | Open in IMG/M |
| 3300032174|Ga0307470_11585726 | Not Available | 547 | Open in IMG/M |
| 3300032174|Ga0307470_11603430 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300032180|Ga0307471_100338104 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300032180|Ga0307471_102735982 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300032180|Ga0307471_102854845 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 613 | Open in IMG/M |
| 3300032180|Ga0307471_103634654 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300032205|Ga0307472_100086190 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
| 3300032205|Ga0307472_100660603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 933 | Open in IMG/M |
| 3300033500|Ga0326730_1070289 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 659 | Open in IMG/M |
| 3300033812|Ga0364926_114097 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 564 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.10% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.16% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.23% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.29% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.29% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.29% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.29% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.29% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.29% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.65% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.65% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.65% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.65% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.65% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.65% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.65% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.65% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012671 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT300_2 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
| 3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_10580392 | 2228664022 | Soil | GGYVEELLHRPGPMNDDERKQLRERYRWEIVGPNPL |
| INPhiseqgaiiFebDRAFT_1015086611 | 3300000364 | Soil | YTPASAGGYVEELMHRSECAAPPMNDDERKELRERYQWEVVGPNPL* |
| JGI1027J12803_1060375441 | 3300000955 | Soil | YTPAAAGGYVEELLNCPGPMNDDERRTLRERYRWEVVGPNPL* |
| JGI25382J43887_103404102 | 3300002908 | Grasslands Soil | AWKSTGRETGRVLFMYTPAAAGGYVEELLNHRPTNDDERNQLRDRYHWEVVGPNPL* |
| soilL2_102468164 | 3300003319 | Sugarcane Root And Bulk Soil | SGSDTGRVVFLYTPAAAGGYVEELLHNRPMTDEKREELRARYRWEVVGLNPL* |
| Ga0066683_108019462 | 3300005172 | Soil | PAAAGGYVEELLKRSGPINDDERNKLRERYRWEVVGPNPL* |
| Ga0066688_100504741 | 3300005178 | Soil | TPAAAGGYVEELLNHRPINDDERNQLRDRYHWEVVGPNPL* |
| Ga0065707_101476653 | 3300005295 | Switchgrass Rhizosphere | AAAGGYVEELLRRPGGPIDDDERNKLRERFRWEVVGPNPL* |
| Ga0066388_1026446771 | 3300005332 | Tropical Forest Soil | ETGRALFLYTPAAAGGYVEELLHRSRPMSDQQRKELFDRYRWEIVGPNPL* |
| Ga0070708_1011177741 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | PAAAGGYVEELLKRPAGPISDNEGNKLRARYRWEVVGPNPL* |
| Ga0066682_102084243 | 3300005450 | Soil | ETGRVLFMYTPAAAGGYVEDLLKRPGPINDDERNELRERYRWEVVGPNPL* |
| Ga0070706_1015569171 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TGRVLFMYTPAAAGGYVEELSNHRPINDDERKQLRDRYHWEVVGPNPL* |
| Ga0070707_1012835712 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LYTPASAGGYVEELMHRAGAPMNDKERLALRERYQWEVVGPNPL* |
| Ga0070679_1009342992 | 3300005530 | Corn Rhizosphere | TGQETSRVVFFYTPAAAGGYVEELLNRPGPMNDDQRKELRERYRWEIVGPNPL* |
| Ga0066697_106358952 | 3300005540 | Soil | VLFMYTPAAAGGYVEELLNHRPINDDERNQLRDRYHWEVVGPNPL* |
| Ga0070696_1017807071 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GRVLFMYTPASAGGYVEELLERRPLNDDERKELRERYRWEVVGPNPL* |
| Ga0066701_100695993 | 3300005552 | Soil | VLFLYTPAAAGGYVEELLNCPGPINDDERNKLRERYRWEVVGPNPL* |
| Ga0066692_102778072 | 3300005555 | Soil | GRVLFMYTPAAAGGYVEELLNHRPIDDDERKQLRDRYQWEVIGPNPL* |
| Ga0066704_106446801 | 3300005557 | Soil | GGYVEELLNHRPINDDERNQLRDRYHWEVVGPNPL* |
| Ga0066700_100702563 | 3300005559 | Soil | GSEPGRVLFMYTPAAAGGYVEELLNHRPIDDDERKQLRDRYQWEVIGPNPL* |
| Ga0066670_101695842 | 3300005560 | Soil | FLYTPAAAGGYVEALLKRPAGSMDDAERNELRERYRWEVVGPNPL* |
| Ga0066691_100742523 | 3300005586 | Soil | YVEELLNCPGPINDDERNKLRERYRWEVVGPNPL* |
| Ga0066706_111453251 | 3300005598 | Soil | ETGRVLFLYTPAAAGGYVEELLNRSAGPISDDERNTLRERYRWEVVGPNPL* |
| Ga0066905_1002433931 | 3300005713 | Tropical Forest Soil | LYTPAAAGGYVEELSRRPADPMNDDERNQLRERYHWEVVGPNPL* |
| Ga0066903_1057706531 | 3300005764 | Tropical Forest Soil | YTPASAGGYVEELLHRNGPMNDAERKELRERYHWEIVGPNPL* |
| Ga0066903_1076983292 | 3300005764 | Tropical Forest Soil | PAAAGGYVEELVNRPRPMSDDERRDLRQRYRWEVVGPNPL* |
| Ga0068860_1004289271 | 3300005843 | Switchgrass Rhizosphere | LYTPAAAGGYVEALLQRRGPMNDDERREPRERYRWEIVGPNPL* |
| Ga0066651_101284704 | 3300006031 | Soil | FLYTPAAAGGYVEELLKRPAAPINDDERNKLRERYRWEVVGPNPL* |
| Ga0066696_107408731 | 3300006032 | Soil | VLFMYTPAAAGGCVEELLNHRPINDDERNQLRDRYHWEVVGPNPL* |
| Ga0066656_110674013 | 3300006034 | Soil | YTPAAAGGYLEELLNRAGPMNDDERQQLRERYRWEIVGPNPL* |
| Ga0079222_103316402 | 3300006755 | Agricultural Soil | FLYTPAAAGGYVEELRNRPGPMNDDERKELRERYRWEIVGPNPL* |
| Ga0075430_1001261921 | 3300006846 | Populus Rhizosphere | YVEELMRRGGVPMNDDERKDLRERYRWEIVGPNPL* |
| Ga0075431_1001915873 | 3300006847 | Populus Rhizosphere | ETGRAVYLYTPAAAGGYIEALLNRPGPMDPDEGKRLREQYRWEVVGPNPL* |
| Ga0075433_107426861 | 3300006852 | Populus Rhizosphere | AGGYVEELLNHRPINDDERNQLRDRYHWEVVGPNPL* |
| Ga0075429_1018489931 | 3300006880 | Populus Rhizosphere | AAGGFVEEMLHRPGPMTDAERKELRDRYHWEIVGPNPL* |
| Ga0075436_1012215862 | 3300006914 | Populus Rhizosphere | AWKSSGRETGRVLFMYTPASAGGYVEELLERRPLNDDERKELRERYRWEVVGPNPL* |
| Ga0079219_107109272 | 3300006954 | Agricultural Soil | AGGYVEELMHRDGALSDEERKKRLDHYRWEVVGPNPL* |
| Ga0075435_1007090191 | 3300007076 | Populus Rhizosphere | LYTPAAAGGYVEELLKRAPGSLDDDERNTLRERYRWEVVGPNPL* |
| Ga0099791_103059852 | 3300007255 | Vadose Zone Soil | MEGEELLKRPGPINDDERNELRERYRREVVGPKPL* |
| Ga0099827_104434732 | 3300009090 | Vadose Zone Soil | MLGRIPAAKPAAYAGGYVEGLLKRPGSMNEDERNELRERYRWEVVGPNPL* |
| Ga0066709_1020542051 | 3300009137 | Grasslands Soil | TPAAAGGYVEELLKRSGPINDDERNKLRERYRWEVVGPNPL* |
| Ga0105241_102740851 | 3300009174 | Corn Rhizosphere | ELMHRRERAAPPMNDDERKELRERYQWEIVGPNPL* |
| Ga0105241_124755021 | 3300009174 | Corn Rhizosphere | GGYVEELLNRPNPLTDDDRNALRERYQWEVVGPNPL* |
| Ga0105249_109001261 | 3300009553 | Switchgrass Rhizosphere | GGYVEEFANHRPTNDDERKQLRDRYQWEVVGPNPL* |
| Ga0114944_14730801 | 3300009691 | Thermal Springs | FLYTPAAAGGYVEELLKNPAGPSNDDERKKLRERYRWEVVGPNPL* |
| Ga0105164_100420201 | 3300009777 | Wastewater | LFLYTPAAAGGYVEELLKRPAGPISDDERNKLGERYRWEVVGPNPL* |
| Ga0105081_10267122 | 3300009806 | Groundwater Sand | GYVEELLNRPGPMNDDQRKELRERYRWEIVGPNPL* |
| Ga0105061_10167402 | 3300009807 | Groundwater Sand | GSETGRVLFFYTPAAAGGYVEELLHRSGPMTDNERKELRERYRWEIVGPNPL* |
| Ga0105070_11075332 | 3300009815 | Groundwater Sand | LFLYTPAAAGGYVEEFLKRPAGPINDDERNKLRERYRWEVVGPNPL* |
| Ga0105076_10290771 | 3300009816 | Groundwater Sand | QETSRVVFFYTPAAAGGYVEELLNRPGPMNDDQRKELRERYRWEIVGPNPL* |
| Ga0105085_11109401 | 3300009820 | Groundwater Sand | AGGYVEELLKRPAGPINDDERNKLRERYRWEVVGPNPL* |
| Ga0105058_10967891 | 3300009837 | Groundwater Sand | HAWKSTGRETGRVLFMYTPAAAGGYVEELLNHRPINDDERNQLRDRYHWEVVGPNPL* |
| Ga0126382_101773632 | 3300010047 | Tropical Forest Soil | VLFYTPAAAGGYVEEMLHRPRPMTDAERKELRDRYHWEIVGPNPL* |
| Ga0126382_125400502 | 3300010047 | Tropical Forest Soil | VLFLYTPAAAGGYVEELLHRPRPMSADESKELRERYRWELVGPNPL* |
| Ga0126373_107095021 | 3300010048 | Tropical Forest Soil | AGGYVEELLHRNGPMNDAERKELRERYHWELVGPNPL* |
| Ga0134082_101177222 | 3300010303 | Grasslands Soil | VLFMYTPAAAGGYVEELLNHRPIDDDERKQLRDRYQWEVIGPNPL* |
| Ga0126376_106071644 | 3300010359 | Tropical Forest Soil | GYIEELLNRPGPMSDYERKTLCERYRWEIVGPNPL* |
| Ga0126376_115343842 | 3300010359 | Tropical Forest Soil | WKNSGSDTGRVVFFYTPARAGGYVEEMLHRAAPMTAADRKELRERYHWEIVGPNPL* |
| Ga0126378_121687022 | 3300010361 | Tropical Forest Soil | FLYTPAAAGGYVEELVRRPRPMSADDSKELRERYHWELVGPNPL* |
| Ga0126379_133481461 | 3300010366 | Tropical Forest Soil | LYTPAAAGGYVEELLHRPRPMSADESKELRERYRWELVGPNPL* |
| Ga0136847_108765081 | 3300010391 | Freshwater Sediment | PAAAGGYVEELLHRPGPINDDERNKLRERYRWEVVGPNPL* |
| Ga0136847_119360172 | 3300010391 | Freshwater Sediment | PAAAGGYVEELLHRPGPINDDERNKLRERYRWGVVGPNPL* |
| Ga0134124_118642871 | 3300010397 | Terrestrial Soil | LFMYTPAAAGGYVEELLNHRPINDDERNQLRDRYHWEVVGPNPL* |
| Ga0126383_103690773 | 3300010398 | Tropical Forest Soil | FLYTPAAAGGYVEEFLTRRPTNDEERKELRERYHWEIVGPNPL* |
| Ga0126383_133601351 | 3300010398 | Tropical Forest Soil | TPAAAGGYVEELLNRPGPMNDDERKQLRERYRWEIVGPNPL* |
| Ga0134123_112768031 | 3300010403 | Terrestrial Soil | GRVLFIYTPAAAGGYVEEFANHRATNGDARKQLRDRYQWEVVGPNPL* |
| Ga0126350_105678751 | 3300010880 | Boreal Forest Soil | ARALFLYTPATAGGYIEELMEHRPTNDAERAELCERYRWEILGPNPL* |
| Ga0137391_114245902 | 3300011270 | Vadose Zone Soil | LFLCTPPAAGGYLEELLERRPINGDEAKKFHQRHRLEIVGPNPL* |
| Ga0137389_111975922 | 3300012096 | Vadose Zone Soil | RYVEELVKRPAGPISDDERHKLGERYRWEVVGPNPL* |
| Ga0137399_101252201 | 3300012203 | Vadose Zone Soil | VALLWDSYLAAGGEKLLNHRPINDDERTQLRDRYHWEVVGPNPL* |
| Ga0137362_100364571 | 3300012205 | Vadose Zone Soil | STGRETGRVLFMYTPAAAGGYVEELLNHRPINDDERNQLRDRYHWEVVGPNPL* |
| Ga0137362_116733351 | 3300012205 | Vadose Zone Soil | WKSTGGETGRVLFMYTPAAAGGYVEELLNHRPINDDQRNQLRDRYHWEVVGPNPL* |
| Ga0137376_112716252 | 3300012208 | Vadose Zone Soil | GAYVEELLERPRPTDDDGYDKLRKRHRWEVVGPNPL* |
| Ga0137379_103193141 | 3300012209 | Vadose Zone Soil | AGGYVEELLNCPGPINDDERNKLRERYRWEVVGPNPL* |
| Ga0134028_11697431 | 3300012224 | Grasslands Soil | MYTPAAAGGYVEELLKRSGPINDDERNKLRERYRWEVVGPNPL* |
| Ga0137370_101465333 | 3300012285 | Vadose Zone Soil | LYTPAAAGGYVEELLNRPGPLSDDERNKLRERYRWEVVGPNPL* |
| Ga0137367_109805811 | 3300012353 | Vadose Zone Soil | LFLYTPAAAGGYVEELLKRPAGRISDDERNKLRERYRWEVVGPNPL* |
| Ga0137368_106163621 | 3300012358 | Vadose Zone Soil | LFLYTPAAAGGYVEELLKRPAGPISDDERNKLRERYRWE |
| Ga0137390_104268653 | 3300012363 | Vadose Zone Soil | ETGRVLFLYTPAAAGGYVEELLLERAAGPMSDDERDKLRQRYCWEIVCPNPL* |
| Ga0137318_10042861 | 3300012671 | Soil | RETGRVLFMYTPAAAGGYVEELLDHRPTNDDERNQLRDRYRWEVVGPNPL* |
| Ga0137396_102216983 | 3300012918 | Vadose Zone Soil | AGGYVEELLNRPTINDDERNKLRERYRWEVVGPNTL* |
| Ga0137396_108926542 | 3300012918 | Vadose Zone Soil | WKNTGSETSRVVFFYAPAAAGGYVEELLNRSGPMNDAQRTELRERYRWEIVGPNPL* |
| Ga0137394_107940681 | 3300012922 | Vadose Zone Soil | KNTGSETSRVVFFYTPAAAGGYVEELLNRPGPMNDAQRKELRERYRWDVVGPNPL* |
| Ga0137419_100095791 | 3300012925 | Vadose Zone Soil | PAAAGGYVEELLNHRPINDDERNQLRDRYHWEVVGPNPL* |
| Ga0137407_105293594 | 3300012930 | Vadose Zone Soil | LYTPAAAGGYVEELLKGPGPTNEEERNKLRERYRWEVVGPNPL* |
| Ga0126375_100789091 | 3300012948 | Tropical Forest Soil | SAGGYVEEMLHRAAPMTDAERKELRERYHWEIVGPNPL* |
| Ga0126375_115981812 | 3300012948 | Tropical Forest Soil | VFLYTPAAAGGYVEEFLTRRPTNNEERKELRERYHWEIVGPNPL* |
| Ga0164301_113630082 | 3300012960 | Soil | GGYVEELLKRPAGSMNDAERKELREHYRWEIVGANPL* |
| Ga0157375_124230391 | 3300013308 | Miscanthus Rhizosphere | MYTPAAAGGYVEEFANHRPTNDDERKQLRDRYQWEVVGPNPL* |
| Ga0134089_104483801 | 3300015358 | Grasslands Soil | RVVFLYTPAAAGGYIEELLKNPGDPINDDESNRLRERYRWEVVGPIPL* |
| Ga0134085_100683491 | 3300015359 | Grasslands Soil | YTPAAAGGYVEELLNHRPINDDERKQLRDRYHWEVVGPNPL* |
| Ga0134085_104659321 | 3300015359 | Grasslands Soil | GRVLFMYTPAAAGGYVEELLKRPAGPIDDDERDKLRERYRWEVVGPNPL* |
| Ga0132256_1018120181 | 3300015372 | Arabidopsis Rhizosphere | WKSTGRETGRVLFMYTPASAGGYVEELLNHRPTNDDERKQLRDRYQWEVVGPNPL* |
| Ga0132255_1003514711 | 3300015374 | Arabidopsis Rhizosphere | TGRVLFMYTPAAAGGYIEELLNHRPINDVERNQLRDRYHWGVVGPNPL* |
| Ga0134074_11031201 | 3300017657 | Grasslands Soil | ETGRVLFMYTPAAAGGYVEDLLKRPGPINDDERNEHRERYRWEVVGPNPL |
| Ga0134083_101550481 | 3300017659 | Grasslands Soil | PAAAGGYVEELLKRPTGSMDDAERKELRERYRWEVVGPNPL |
| Ga0184610_12915431 | 3300017997 | Groundwater Sediment | GGYVEELLNHRPINDDERNQLRDRYHWEVVGPNPL |
| Ga0187788_102790992 | 3300018032 | Tropical Peatland | YTPAGAGGYVEEMRNRPTPMSDEERKELRERYRWEIVGPNPL |
| Ga0184621_101493152 | 3300018054 | Groundwater Sediment | GRVLFMYTPAAAGGYVEELLNHRPINDDERNQLRDRYHWEVVGPNPL |
| Ga0184623_103563842 | 3300018056 | Groundwater Sediment | STGRETGRVLFMYTPAAAGGYVEELLNHRPINDDERNQLRDRYHWEVVGPNPL |
| Ga0184640_103584781 | 3300018074 | Groundwater Sediment | TPAAAGGYVEELLKRPAGPINDDERNKLRERYRWEVVGPNPL |
| Ga0184632_102386261 | 3300018075 | Groundwater Sediment | PAAAGGYVEELLNHRPINDDERNQLRDRYHWEVVGPNPL |
| Ga0184627_102181261 | 3300018079 | Groundwater Sediment | GYVEELLKRPAGPINDDERNKLRERYRWEVVGPNPL |
| Ga0184639_103940292 | 3300018082 | Groundwater Sediment | AAGGYVEELLKRPGPINDDERNKLRERYRWEVVGPNPL |
| Ga0066655_104660921 | 3300018431 | Grasslands Soil | TPAAAGGYVEELLKRSGPINDDERNKLRERYRWEVVGPNPL |
| Ga0190268_115505252 | 3300018466 | Soil | AAGGYIEELLNRPGPMSDDQRKELRERYRWEIVGPNPL |
| Ga0193747_10946482 | 3300019885 | Soil | AWKNTGRETSRVVFFYTPAAAGGYIEELLNRPGPMNDAQRKELRERYRWEVVGPNPL |
| Ga0193755_10463801 | 3300020004 | Soil | AAAGGYVEELSNHRPTNDDERKQLRDRYHWEIVGPNPL |
| Ga0210401_105786861 | 3300020583 | Soil | RETGRALFMYAPASAGGYVEELLERRPLNDEERKELRDRYRWEVVGPNPL |
| Ga0210408_110281951 | 3300021178 | Soil | FMYTPAAAGGYVEELQERRPLNDDERKELRERYRWEIVGPNPL |
| Ga0242664_10748172 | 3300022527 | Soil | LFLYTPAAAGGYLEEFLERPAGPMSDDERNQLCERYRWEILGPNPL |
| Ga0212128_105647861 | 3300022563 | Thermal Springs | PAAAGGYVEELLKRPAGPISDDERNKLHERYRWEVVGPNPL |
| Ga0222622_111405202 | 3300022756 | Groundwater Sediment | ARVLFLYTPAAAGGYVEALLQRRGPMNDDERRELRERYRWEIVGPNPL |
| Ga0207685_105560982 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | TSRVVFFYTPAAAGGYVEELLNRSGPMNDAQRKELRERYRWEVVGPNPL |
| Ga0207684_100634581 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SSGRETGRVLFMYTPASAGGYVEELLERRPLNDDERKELRERYRWEVVGPNPL |
| Ga0207684_103462742 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GYVEELMHRAGAPMNDDERRELRERYRWEIVGPNPL |
| Ga0207707_107583792 | 3300025912 | Corn Rhizosphere | AAAGGYVEELLNRPGPMNDDQRKELRERYRWEIVGPNPL |
| Ga0207646_100545331 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TGRVLFMYTPAAAGGYVEELLNHRPINDDERNQLRDRYHWEVVGPNPL |
| Ga0207646_111575952 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | YVEELLKRPAGPISDDERHKLRERYRWEVVGPNPL |
| Ga0207646_114390642 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AAGGYVEELLNRSGPMNDAQRKELRERYRWEVVGPNPL |
| Ga0207701_104157501 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | GRETARVLFLYTPAAAGGYVEALLQRRGPMNDDERREPRERYRWEIVGPNPL |
| Ga0207686_110867131 | 3300025934 | Miscanthus Rhizosphere | RETGRVLFMYTPAAAGGYVEELLNHRPINHDERNQLRDRYHWEIVGPNPL |
| Ga0207639_114589411 | 3300026041 | Corn Rhizosphere | GYVEALLQRRGPMNDDERREPRERYRWEIVGPNPL |
| Ga0209468_11708022 | 3300026306 | Soil | YTPAAAGGYVEELLKRSGPINDDERNKLRERYRWEVVGPNPL |
| Ga0209377_10488311 | 3300026334 | Soil | TPAAAGGYVEELLKGPGPTNDEERNKLRERYRWEVVGPNPL |
| Ga0209377_11833341 | 3300026334 | Soil | STGSETGRVLFMYTPAAAGGYVEELLNHRPINDDERKQLRDRYHWEVVGPNPL |
| Ga0257166_10305123 | 3300026358 | Soil | QETSRVVFFYTPAAAGGYVEELLNRPGPMNDAQRKELRERYRWEVVGPNPL |
| Ga0209378_11609411 | 3300026528 | Soil | TGRETGRVLFMYTPAAAGGYVEELLNHRPINDDERNQLRDRYHWEVVGPNPL |
| Ga0179587_106262681 | 3300026557 | Vadose Zone Soil | MEGEELLKRPGPINDDERNELRERYRREVVGPKPL |
| Ga0209528_11277162 | 3300027610 | Forest Soil | GRETGRVLFMYTPAAAGGYVEELLERRPLNDDERKELRERYRWEIVGPNPL |
| Ga0209588_11522781 | 3300027671 | Vadose Zone Soil | FFYTPAAAGGYVEELLNRPGPMNDSQRKELRERYRWEIVGPNPL |
| Ga0209465_102114041 | 3300027874 | Tropical Forest Soil | GYVEELLHRNGPMNDAERKELRERYHWEIVGPNPL |
| Ga0247819_109993901 | 3300028608 | Soil | FLYTPAAAGGYVEALLQRRGPMNDDERRELRERYRWEIVGPNPL |
| Ga0307293_100430393 | 3300028711 | Soil | GGYVEELLNRSGPMNDAQRKELRERYRWEVVGPNPL |
| Ga0247825_104989473 | 3300028812 | Soil | FLYTPAAAGGYVEALLERPEPTGDDERTRLRERYHWEVVGPNPL |
| Ga0307278_103184792 | 3300028878 | Soil | TPAAAGGYVEELLNRPGPINGDERNELRQRYRWEVVGPNPL |
| Ga0307497_101712072 | 3300031226 | Soil | ARVLFLYTPAAAGGYVEALLQRHGPMNDDERRELRERYRWEIVGPNPL |
| Ga0299913_107875103 | 3300031229 | Soil | LFLYTPARTGGYVEQLLTRPAGSMNDAERKELRERYRWEIVGPNPL |
| Ga0307505_101037961 | 3300031455 | Soil | KNTAQETSRAVFFYTPASAGGYVEELLNRPGPMNDAQRKELRERYRWEVVGPNPL |
| Ga0318572_107520631 | 3300031681 | Soil | LYTPAAAGGYVEEMRNRPGPMTDEERKELRERYRWEIVGPNPL |
| Ga0307469_108158903 | 3300031720 | Hardwood Forest Soil | AAGGYVEELLSRPRPMNDDQRKELRERYQWEIVGPNPL |
| Ga0307469_118475212 | 3300031720 | Hardwood Forest Soil | AGGYVEELLKRPAGPINDDERNKLRERYRWEVVGPNPL |
| Ga0307468_1008772531 | 3300031740 | Hardwood Forest Soil | VLFLYTPAAAGGYVEALLQRHGPMNDDERRELRERYHWEIVGPNPL |
| Ga0307473_110973272 | 3300031820 | Hardwood Forest Soil | GYVEELLHRPGPMNDDERKQLRERYRWEIVGPNPL |
| Ga0307473_113717462 | 3300031820 | Hardwood Forest Soil | QTGRVLFLYTPASAGGYIEELMHRRERAAPPMNDDECKELRERYQWEIVGANPL |
| Ga0307470_115857262 | 3300032174 | Hardwood Forest Soil | GYVEELSKRQAGSMDSGEYKTLRERYRWEVVGPNPL |
| Ga0307470_116034301 | 3300032174 | Hardwood Forest Soil | GKDTGRVLCLYTPAAGGGYVEELLNRPTPITDDDRNTLRERYRWEVVGPNPL |
| Ga0307471_1003381041 | 3300032180 | Hardwood Forest Soil | RETGRVLFMYTPAAAGGYVEELLNHRPINDDERNQLRHRYHWEVVGPNPL |
| Ga0307471_1027359823 | 3300032180 | Hardwood Forest Soil | FYTPAAAGGYVEELLNRPGPMNDAQRKELRERYRWEVVGPNPL |
| Ga0307471_1028548451 | 3300032180 | Hardwood Forest Soil | TPASAGGYVEEMLHRAAPMTDAARKELRERYHWEIVGPNPL |
| Ga0307471_1036346542 | 3300032180 | Hardwood Forest Soil | KSTGSETGRVLFMYTPAAAGGYVEELLNHRPSNDDERNQLRDRYRWEVVGPNPL |
| Ga0307472_1000861901 | 3300032205 | Hardwood Forest Soil | YVEELMHRAGAPMNDDERRELRERYRWEIVGPNPL |
| Ga0307472_1006606031 | 3300032205 | Hardwood Forest Soil | RVVFLYTPARAGGYVEELLHRTGPMNDAERTELRERYRWEIVGPNPL |
| Ga0326730_10702891 | 3300033500 | Peat Soil | MYTPAAAGGYVEELLTHRPTDDDERKQLRDRYQWDI |
| Ga0364926_114097_15_143 | 3300033812 | Sediment | MYTPAAAGGYVEELLNHRPINDDERNQLRDRYHWEVVGPNPL |
| ⦗Top⦘ |