


| Basic Information | |
|---|---|
| Family ID | F043731 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 155 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKTMFLTLAAVLGLALGTASLIPAAHASNVYLYPPSTSAG |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 154 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.45 % |
| % of genes near scaffold ends (potentially truncated) | 9.68 % |
| % of genes from short scaffolds (< 2000 bps) | 90.32 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.613 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.806 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.548 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (69.032 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 38.24% β-sheet: 0.00% Coil/Unstructured: 61.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 154 Family Scaffolds |
|---|---|---|
| PF00848 | Ring_hydroxyl_A | 9.09 |
| PF07021 | MetW | 8.44 |
| PF03466 | LysR_substrate | 5.19 |
| PF00126 | HTH_1 | 3.90 |
| PF00903 | Glyoxalase | 3.25 |
| PF13593 | SBF_like | 3.25 |
| PF07690 | MFS_1 | 2.60 |
| PF05685 | Uma2 | 1.95 |
| PF06230 | LpxI_C | 1.95 |
| PF00072 | Response_reg | 1.30 |
| PF05977 | MFS_3 | 1.30 |
| PF13609 | Porin_4 | 0.65 |
| PF01794 | Ferric_reduct | 0.65 |
| PF13180 | PDZ_2 | 0.65 |
| PF00486 | Trans_reg_C | 0.65 |
| PF00211 | Guanylate_cyc | 0.65 |
| PF00005 | ABC_tran | 0.65 |
| PF09413 | DUF2007 | 0.65 |
| PF01053 | Cys_Met_Meta_PP | 0.65 |
| PF13533 | Biotin_lipoyl_2 | 0.65 |
| PF00529 | CusB_dom_1 | 0.65 |
| PF00999 | Na_H_Exchanger | 0.65 |
| PF02781 | G6PD_C | 0.65 |
| PF12833 | HTH_18 | 0.65 |
| COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
|---|---|---|---|
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 18.18 |
| COG3494 | Uncharacterized conserved protein, DUF1009 family | Function unknown [S] | 1.95 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 1.95 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.30 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.65 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.65 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.65 |
| COG0364 | Glucose-6-phosphate 1-dehydrogenase | Carbohydrate transport and metabolism [G] | 0.65 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.65 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.65 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.65 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.65 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.65 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.65 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.65 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.65 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.65 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.65 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.65 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.65 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.65 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.61 % |
| Unclassified | root | N/A | 48.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003505|JGIcombinedJ51221_10288784 | Not Available | 667 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10305557 | Not Available | 647 | Open in IMG/M |
| 3300004080|Ga0062385_10284581 | Not Available | 939 | Open in IMG/M |
| 3300004080|Ga0062385_10924526 | Not Available | 580 | Open in IMG/M |
| 3300004080|Ga0062385_11070410 | Not Available | 545 | Open in IMG/M |
| 3300004091|Ga0062387_101524196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. 21-62-4 | 537 | Open in IMG/M |
| 3300004092|Ga0062389_102625452 | Not Available | 670 | Open in IMG/M |
| 3300004092|Ga0062389_104501738 | Not Available | 524 | Open in IMG/M |
| 3300004121|Ga0058882_1823613 | Not Available | 578 | Open in IMG/M |
| 3300004152|Ga0062386_100181650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1650 | Open in IMG/M |
| 3300004152|Ga0062386_101631667 | Not Available | 538 | Open in IMG/M |
| 3300004635|Ga0062388_100021376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3771 | Open in IMG/M |
| 3300004635|Ga0062388_100230510 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300004635|Ga0062388_100634514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 985 | Open in IMG/M |
| 3300005541|Ga0070733_10697940 | Not Available | 681 | Open in IMG/M |
| 3300005591|Ga0070761_10207308 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1163 | Open in IMG/M |
| 3300005591|Ga0070761_10233350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1097 | Open in IMG/M |
| 3300005591|Ga0070761_10421798 | Not Available | 816 | Open in IMG/M |
| 3300005591|Ga0070761_10484113 | Not Available | 762 | Open in IMG/M |
| 3300005602|Ga0070762_10742080 | Not Available | 661 | Open in IMG/M |
| 3300005602|Ga0070762_11271017 | Not Available | 510 | Open in IMG/M |
| 3300005712|Ga0070764_10238922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. 21-62-4 | 1031 | Open in IMG/M |
| 3300005712|Ga0070764_10823673 | Not Available | 578 | Open in IMG/M |
| 3300005921|Ga0070766_10227892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1175 | Open in IMG/M |
| 3300005921|Ga0070766_10884739 | Not Available | 611 | Open in IMG/M |
| 3300009698|Ga0116216_10522437 | Not Available | 717 | Open in IMG/M |
| 3300009698|Ga0116216_10560230 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300010339|Ga0074046_10306334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 70-18 | 975 | Open in IMG/M |
| 3300010343|Ga0074044_10728614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 647 | Open in IMG/M |
| 3300010379|Ga0136449_100293505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas | 2972 | Open in IMG/M |
| 3300010379|Ga0136449_100363784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2590 | Open in IMG/M |
| 3300010379|Ga0136449_103175046 | Not Available | 636 | Open in IMG/M |
| 3300010379|Ga0136449_103512237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium | 597 | Open in IMG/M |
| 3300010379|Ga0136449_104656663 | Not Available | 502 | Open in IMG/M |
| 3300010859|Ga0126352_1090084 | Not Available | 546 | Open in IMG/M |
| 3300010859|Ga0126352_1209837 | Not Available | 592 | Open in IMG/M |
| 3300011120|Ga0150983_14682647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300014169|Ga0181531_10079715 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1938 | Open in IMG/M |
| 3300014200|Ga0181526_10282842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1057 | Open in IMG/M |
| 3300014489|Ga0182018_10501850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 642 | Open in IMG/M |
| 3300014492|Ga0182013_10264114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium | 987 | Open in IMG/M |
| 3300014493|Ga0182016_10238675 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300014501|Ga0182024_10797136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1152 | Open in IMG/M |
| 3300014501|Ga0182024_11607832 | Not Available | 736 | Open in IMG/M |
| 3300014501|Ga0182024_11666615 | Not Available | 720 | Open in IMG/M |
| 3300014501|Ga0182024_12158371 | Not Available | 611 | Open in IMG/M |
| 3300014657|Ga0181522_10412931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. 21-62-4 | 808 | Open in IMG/M |
| 3300014838|Ga0182030_10160104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2825 | Open in IMG/M |
| 3300015206|Ga0167644_1003175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9981 | Open in IMG/M |
| 3300015206|Ga0167644_1025897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2459 | Open in IMG/M |
| 3300015206|Ga0167644_1032578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2075 | Open in IMG/M |
| 3300017948|Ga0187847_10163290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium | 1216 | Open in IMG/M |
| 3300017948|Ga0187847_10181058 | Not Available | 1150 | Open in IMG/M |
| 3300018034|Ga0187863_10142376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1339 | Open in IMG/M |
| 3300018038|Ga0187855_10645623 | Not Available | 616 | Open in IMG/M |
| 3300018042|Ga0187871_10685908 | Not Available | 570 | Open in IMG/M |
| 3300018043|Ga0187887_10174029 | Not Available | 1285 | Open in IMG/M |
| 3300018043|Ga0187887_10615036 | Not Available | 641 | Open in IMG/M |
| 3300018047|Ga0187859_10593063 | Not Available | 624 | Open in IMG/M |
| 3300019260|Ga0181506_1304210 | Not Available | 541 | Open in IMG/M |
| 3300019284|Ga0187797_1893133 | Not Available | 548 | Open in IMG/M |
| 3300020582|Ga0210395_10119517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1956 | Open in IMG/M |
| 3300020582|Ga0210395_10148651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 1748 | Open in IMG/M |
| 3300020582|Ga0210395_10255769 | Not Available | 1317 | Open in IMG/M |
| 3300020582|Ga0210395_10262209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 20-64-7 | 1299 | Open in IMG/M |
| 3300020582|Ga0210395_10305700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1196 | Open in IMG/M |
| 3300020582|Ga0210395_10873950 | Not Available | 669 | Open in IMG/M |
| 3300021180|Ga0210396_10322331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 1366 | Open in IMG/M |
| 3300021401|Ga0210393_10133635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1989 | Open in IMG/M |
| 3300021401|Ga0210393_10357570 | Not Available | 1189 | Open in IMG/M |
| 3300021401|Ga0210393_11634268 | Not Available | 510 | Open in IMG/M |
| 3300021402|Ga0210385_11227410 | Not Available | 575 | Open in IMG/M |
| 3300021403|Ga0210397_10854217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 20-64-7 | 704 | Open in IMG/M |
| 3300021405|Ga0210387_11622968 | Not Available | 550 | Open in IMG/M |
| 3300021420|Ga0210394_10721367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 873 | Open in IMG/M |
| 3300021433|Ga0210391_10104545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2231 | Open in IMG/M |
| 3300021433|Ga0210391_10155045 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1803 | Open in IMG/M |
| 3300021433|Ga0210391_10201317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium | 1566 | Open in IMG/M |
| 3300021433|Ga0210391_10303694 | Not Available | 1252 | Open in IMG/M |
| 3300021433|Ga0210391_11151698 | Not Available | 601 | Open in IMG/M |
| 3300021475|Ga0210392_11366234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 530 | Open in IMG/M |
| 3300021477|Ga0210398_10154138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1870 | Open in IMG/M |
| 3300021477|Ga0210398_10178197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1732 | Open in IMG/M |
| 3300021477|Ga0210398_10249123 | Not Available | 1448 | Open in IMG/M |
| 3300021477|Ga0210398_10664170 | Not Available | 844 | Open in IMG/M |
| 3300021477|Ga0210398_10917769 | Not Available | 701 | Open in IMG/M |
| 3300021479|Ga0210410_10755534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 856 | Open in IMG/M |
| 3300022509|Ga0242649_1011680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium | 944 | Open in IMG/M |
| 3300022509|Ga0242649_1031352 | Not Available | 683 | Open in IMG/M |
| 3300022712|Ga0242653_1065974 | Not Available | 614 | Open in IMG/M |
| 3300022716|Ga0242673_1070919 | Not Available | 625 | Open in IMG/M |
| 3300022721|Ga0242666_1036619 | Not Available | 992 | Open in IMG/M |
| 3300022721|Ga0242666_1164889 | Not Available | 550 | Open in IMG/M |
| 3300022726|Ga0242654_10186484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 714 | Open in IMG/M |
| 3300027110|Ga0208488_1009906 | Not Available | 1925 | Open in IMG/M |
| 3300027110|Ga0208488_1016316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1462 | Open in IMG/M |
| 3300027394|Ga0209904_1017672 | Not Available | 549 | Open in IMG/M |
| 3300027853|Ga0209274_10072685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1664 | Open in IMG/M |
| 3300027853|Ga0209274_10126976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1273 | Open in IMG/M |
| 3300027853|Ga0209274_10164034 | Not Available | 1123 | Open in IMG/M |
| 3300027879|Ga0209169_10027001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3062 | Open in IMG/M |
| 3300027905|Ga0209415_10117664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2822 | Open in IMG/M |
| 3300027905|Ga0209415_10340627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 20-64-7 | 1257 | Open in IMG/M |
| 3300027905|Ga0209415_10970666 | Not Available | 569 | Open in IMG/M |
| 3300028906|Ga0308309_11708153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300029951|Ga0311371_12280089 | Not Available | 561 | Open in IMG/M |
| 3300030503|Ga0311370_11127269 | Not Available | 859 | Open in IMG/M |
| 3300030520|Ga0311372_11082309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1045 | Open in IMG/M |
| 3300030520|Ga0311372_11082309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1045 | Open in IMG/M |
| 3300030520|Ga0311372_11252019 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 944 | Open in IMG/M |
| 3300030520|Ga0311372_11719835 | Not Available | 755 | Open in IMG/M |
| 3300030520|Ga0311372_12131809 | Not Available | 649 | Open in IMG/M |
| 3300030535|Ga0210285_1552811 | Not Available | 519 | Open in IMG/M |
| 3300030730|Ga0307482_1086396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 835 | Open in IMG/M |
| 3300030730|Ga0307482_1122518 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300030730|Ga0307482_1166672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300030738|Ga0265462_10575705 | Not Available | 846 | Open in IMG/M |
| 3300030740|Ga0265460_10733598 | Not Available | 848 | Open in IMG/M |
| 3300030743|Ga0265461_12058969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 654 | Open in IMG/M |
| 3300030803|Ga0074037_1715165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. 21-62-4 | 578 | Open in IMG/M |
| 3300030863|Ga0265766_1018886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 556 | Open in IMG/M |
| 3300030863|Ga0265766_1021004 | Not Available | 538 | Open in IMG/M |
| 3300030906|Ga0302314_11270574 | Not Available | 684 | Open in IMG/M |
| 3300030923|Ga0138296_1777535 | Not Available | 558 | Open in IMG/M |
| 3300031015|Ga0138298_1622862 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300031234|Ga0302325_10798094 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300031234|Ga0302325_11042605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1111 | Open in IMG/M |
| 3300031234|Ga0302325_11334248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 940 | Open in IMG/M |
| 3300031234|Ga0302325_11816936 | Not Available | 763 | Open in IMG/M |
| 3300031236|Ga0302324_100432216 | Not Available | 1950 | Open in IMG/M |
| 3300031236|Ga0302324_100483150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1816 | Open in IMG/M |
| 3300031236|Ga0302324_100514392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1744 | Open in IMG/M |
| 3300031236|Ga0302324_101972834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 734 | Open in IMG/M |
| 3300031524|Ga0302320_11972100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium | 549 | Open in IMG/M |
| 3300031524|Ga0302320_12235773 | Not Available | 504 | Open in IMG/M |
| 3300031667|Ga0310111_132111 | Not Available | 605 | Open in IMG/M |
| 3300031708|Ga0310686_100947652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium | 1558 | Open in IMG/M |
| 3300031708|Ga0310686_102113442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2211 | Open in IMG/M |
| 3300031708|Ga0310686_102291832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 5361 | Open in IMG/M |
| 3300031708|Ga0310686_108026512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 4982 | Open in IMG/M |
| 3300031708|Ga0310686_112997667 | Not Available | 972 | Open in IMG/M |
| 3300031708|Ga0310686_113077876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 20761 | Open in IMG/M |
| 3300031708|Ga0310686_113301046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4187 | Open in IMG/M |
| 3300031708|Ga0310686_114653980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. 21-62-4 | 568 | Open in IMG/M |
| 3300031708|Ga0310686_117536141 | Not Available | 1902 | Open in IMG/M |
| 3300031708|Ga0310686_117721874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 20-64-7 | 907 | Open in IMG/M |
| 3300031708|Ga0310686_119771374 | Not Available | 539 | Open in IMG/M |
| 3300032160|Ga0311301_10586357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1614 | Open in IMG/M |
| 3300032160|Ga0311301_12404459 | Not Available | 594 | Open in IMG/M |
| 3300032515|Ga0348332_11134969 | Not Available | 579 | Open in IMG/M |
| 3300032515|Ga0348332_11337428 | Not Available | 541 | Open in IMG/M |
| 3300032515|Ga0348332_11906715 | Not Available | 947 | Open in IMG/M |
| 3300032515|Ga0348332_12411214 | Not Available | 702 | Open in IMG/M |
| 3300033887|Ga0334790_149701 | Not Available | 703 | Open in IMG/M |
| 3300034163|Ga0370515_0310239 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 10.32% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 9.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.03% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.74% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 7.10% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.87% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.58% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.58% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.94% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.94% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.94% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.29% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.29% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.29% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.65% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.65% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.65% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.65% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.65% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.65% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
| 3300027394 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030535 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO749-VDE026SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030803 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral C3 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300030923 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031015 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ51221_102887842 | 3300003505 | Forest Soil | MKTMFLTLAAVLGIALGTVSLTPSAHASNVQLYPPSSVGGNG* |
| JGIcombinedJ51221_103055572 | 3300003505 | Forest Soil | MKTVFLTLAAVLGLAIGAASVIPAAHASNVQLYQPSNSVG* |
| Ga0062385_102845812 | 3300004080 | Bog Forest Soil | MKTMFLTLAAVLGLALGTASLLPAAHASQVYLYPPAENGQG* |
| Ga0062385_109245261 | 3300004080 | Bog Forest Soil | MKTMFLTLAAVLGLALGTASLTSAAQASQVYLYPPSQSAG* |
| Ga0062385_110704101 | 3300004080 | Bog Forest Soil | MKTMFLTLAAVVGLALGTASLMPAAHASQVYLYPPTDHGMN* |
| Ga0062387_1015241962 | 3300004091 | Bog Forest Soil | MKTMFLTLAAVLGLALGTASLIPAAHASNVQLYPPSEAPG* |
| Ga0062389_1026254522 | 3300004092 | Bog Forest Soil | MKTMFLTLAAVLGLALGTASLIPVAHASTVYLYPPSNAAG* |
| Ga0062389_1045017381 | 3300004092 | Bog Forest Soil | MKTMFLTLAAVLGIALGTVSLTQSAHASNVQLYPPSQATDGRG* |
| Ga0058882_18236131 | 3300004121 | Forest Soil | RRRTTMKTMFLTLAAVLGIALGTVSLTPSAHASNVQLYPPSSVGGNG* |
| Ga0062386_1001816503 | 3300004152 | Bog Forest Soil | MKTVFLTLAAVVGLALGTAATIPAAHASNVQVYPPSNSVG* |
| Ga0062386_1016316671 | 3300004152 | Bog Forest Soil | MKTMFLTLAAVLGIALGTVSLTPAAYASNVQLYPPSNAVG* |
| Ga0062388_1000213766 | 3300004635 | Bog Forest Soil | MKTMFLTLAAVLGVALGTASLIPAAHASQVYLYPPAQNGQG* |
| Ga0062388_1002305101 | 3300004635 | Bog Forest Soil | MKTKLLVLLARLGIAIGSASMIPAAHASQVYLHPPAGNLANG* |
| Ga0062388_1006345142 | 3300004635 | Bog Forest Soil | MKTMFLALAAVLGFAIGTASLIPAAHASRVYLYQPTDTGNG* |
| Ga0070733_106979402 | 3300005541 | Surface Soil | MFLTLAAVLGLALGTASLIPAAHASQVYLYPPAQNGQG* |
| Ga0070761_102073083 | 3300005591 | Soil | MKSMFLTLAAVLGIALGTVSLTHSAYASNVQLYPPSQATDGRG* |
| Ga0070761_102333502 | 3300005591 | Soil | MKSMFLTLAAVLGIALGTVSLTPAAHASNVQLYPPSNAADGRG* |
| Ga0070761_104217982 | 3300005591 | Soil | MKTVFLTLAAVLGLALGTASVIPAAHASNVQVYPPSNSVG* |
| Ga0070761_104841131 | 3300005591 | Soil | MKTMLLTLAAVLGLALGTASLIPAAHASNVQLYPPSSVGGNG* |
| Ga0070762_107420801 | 3300005602 | Soil | MKTMFLTLAAVLGIALGTVSLTPSAHASNVQLYPPSSVGGNN* |
| Ga0070762_112710171 | 3300005602 | Soil | MKTMFLTLAAVLGVALGAVSLTPAAYASNVQLYPPSSIGGNG* |
| Ga0070764_102389222 | 3300005712 | Soil | MKTMFLTLAAVVGLALGTASLIPAAHASNVQLYPPSQAPG* |
| Ga0070764_108236732 | 3300005712 | Soil | MKTVFLTLAAVLGLVLGTASVIPAAHASNVQVYPPSNSVG* |
| Ga0070766_102278922 | 3300005921 | Soil | MKTTFLTLAAVLGIALGTVSLTPSAHASNVQLYPPSSVGGNG* |
| Ga0070766_108847391 | 3300005921 | Soil | MKTMFLTLAAIVGLALGTASLIPAAHATNIQLYPPSNAPG* |
| Ga0116216_105224372 | 3300009698 | Peatlands Soil | MKTMFLTLAAVLGLALGTASLIPAARASTVYLYPSSNSVG* |
| Ga0116216_105602302 | 3300009698 | Peatlands Soil | MKTMFLTLAAVVGLALGTASLIPAAHASQVYLYPPAQNGQG* |
| Ga0074046_103063341 | 3300010339 | Bog Forest Soil | MKTMFLTLAAVLGIALGTVSLIPAAHASNVSLYPPSESAG* |
| Ga0074044_107286141 | 3300010343 | Bog Forest Soil | MKTMFLTLAAVAGLALGTASLTTAAQASQVYLYQPSQSAG* |
| Ga0136449_1002935054 | 3300010379 | Peatlands Soil | MKTLYLTLAAVLGLALGTASVIPAAHASNVQLYPPSNSVG* |
| Ga0136449_1003637843 | 3300010379 | Peatlands Soil | MKTMFLTLAAVVGLALGTASLIPAAHASQVYLYPPTQNGQG* |
| Ga0136449_1031750462 | 3300010379 | Peatlands Soil | MKSMFLTLAAILGIALGTASLSPAARASQTYLYPPAGNPANG* |
| Ga0136449_1035122371 | 3300010379 | Peatlands Soil | RRTTMKTMFLTLAAVVGLALGTASLTTAAQASQVYLYPPSQSAG* |
| Ga0136449_1046566632 | 3300010379 | Peatlands Soil | MKTMFLTLAAVLGIALGTVSLTPAAHASQVYLYQPSQSVG* |
| Ga0126352_10900842 | 3300010859 | Boreal Forest Soil | MFLTLAAVLGFAVGTASLIPAAHASKVYLYPPSQSAG* |
| Ga0126352_12098371 | 3300010859 | Boreal Forest Soil | MKTMFLTLAAILGLALGTTSLVSCAHASKVYLYQPSDSPG* |
| Ga0150983_146826471 | 3300011120 | Forest Soil | MTMKTMFLTLAAVLGIALGTVSLTPAAHASNVQLYPPSSVGGNN* |
| Ga0181531_100797152 | 3300014169 | Bog | MTMKTMFLSLAAVLGLALGTASLIPAAHASSVYLYPPSTSAG* |
| Ga0181526_102828422 | 3300014200 | Bog | MKSMFLTLAAVLGIALGTVSLTPAAHASDVQLYSPSSVGGNG* |
| Ga0182018_105018502 | 3300014489 | Palsa | MKTMFVTLAAVLGLALGTASLIPAAHASSVYLYPPSTSAG* |
| Ga0182013_102641142 | 3300014492 | Bog | MKTMFLTLAAALGIVLGTASLIQAAHASSIHLNPPAEGSR* |
| Ga0182016_102386752 | 3300014493 | Bog | MKTMFLTLAAVLGIALGTVSMSPAANASNVHLNPPTSIGN* |
| Ga0182024_107971362 | 3300014501 | Permafrost | MKTMFLTLAAVLGLALGTASLTQAAHASQVYLYPPSQSAG* |
| Ga0182024_116078322 | 3300014501 | Permafrost | MKTMFLTLAAVLGIAIGTASLTPAAQASQTYLYPPAGNLANG* |
| Ga0182024_116666151 | 3300014501 | Permafrost | MKIMFLTMAAILGIALGTASVIPAAHASSVYLFPPSQSAG* |
| Ga0182024_121583712 | 3300014501 | Permafrost | MMKTMFLTLAAVLGVALGTASLIPAAHASQVYLYPPAQNGQG* |
| Ga0181522_104129313 | 3300014657 | Bog | MKTMFLTLAAVLGLALGTASLIPAAHATSVQLYPPSNAPG* |
| Ga0182030_101601042 | 3300014838 | Bog | MKTMFLTLAAALGIVAGAASMAPAAHASNVHLFPPTSIGNG* |
| Ga0167644_10031756 | 3300015206 | Glacier Forefield Soil | MKSMFLTLAAVLGIAIGTASLGQAQASQVYLYPPAGNLANG* |
| Ga0167644_10258973 | 3300015206 | Glacier Forefield Soil | MKTMFLTLAAVLGLALGTASLTPAAHASQTYLYPPAGDLSNG* |
| Ga0167644_10325782 | 3300015206 | Glacier Forefield Soil | MKTMFLTLAAVVGLALGTASLMPAAHASQVYLYQPTDHGQG* |
| Ga0187847_101632902 | 3300017948 | Peatland | MKSMFLTLAAVLGIALGTVSLTPAAHASNVQLFPPSSAADGRG |
| Ga0187847_101810582 | 3300017948 | Peatland | MKTMFLTLAAVLGIAIGIGSIPTAHASTYQFRPPCDCNG |
| Ga0187863_101423761 | 3300018034 | Peatland | MKSMFLTLAAVLGIALGTVSLTPAAFASNVQLYPPSSVGGNG |
| Ga0187855_106456232 | 3300018038 | Peatland | MKTMFLTLAAVLGLALGTASLIPAAHATSVQLYPPSNAP |
| Ga0187871_106859082 | 3300018042 | Peatland | MKTMFLTLAAVLGVAFVTASLIPAAHASNVQLYPPSSVGGNG |
| Ga0187887_101740293 | 3300018043 | Peatland | MKTMFLTLAAVLGLALGTASLIPAAHATSVQLYPPSNAPG |
| Ga0187887_106150362 | 3300018043 | Peatland | MKTMFLTLVAVLGIALGTVSLTQSAHASNVQLYPPSQATDGRG |
| Ga0187859_105930632 | 3300018047 | Peatland | MKTVFLTLAAVLGLALGTASVIPAAHASNVQLYQPSNSVG |
| Ga0181506_13042101 | 3300019260 | Peatland | MKTMFLTLAAVLGIALGSASLSPAANASNVYLNPPSNGHG |
| Ga0187797_18931331 | 3300019284 | Peatland | MKSIFLTLAAVLGIALGTASLVPAAHASNVQLYPPTQTGTD |
| Ga0210395_101195172 | 3300020582 | Soil | MKTMFLTLAAVLGIALGTVSLTPAAHASNVQLYPPSSVGGNN |
| Ga0210395_101486511 | 3300020582 | Soil | MKTMFLALAAILGVALGTVSLTQSAYASNVQLYPPSQATDGRG |
| Ga0210395_102557692 | 3300020582 | Soil | MKTMFLTLAAVLGVALGAVSLTPAAYASNVQLYPPSSVGGNG |
| Ga0210395_102622093 | 3300020582 | Soil | MKTVFLTLAAVLGLALGTASVIPAAHASNVQLYLPSNSVG |
| Ga0210395_103057002 | 3300020582 | Soil | MKTMFLTLAAVLGLALGTASLIPAAHASNVQLYPPSQAPG |
| Ga0210395_108739501 | 3300020582 | Soil | MKTMFLTLAAVLGIALGTVSLTPSAHASNVQLYPPSTVGGNG |
| Ga0210396_103223311 | 3300021180 | Soil | MKTMFLALAAVLGLAIGTASLIPAAHASRVYLYQPTDTGNG |
| Ga0210393_101336353 | 3300021401 | Soil | MKTMFLTLAAVLGVALGAASLTPAAYASNVQLYPPSSVGGNG |
| Ga0210393_103575702 | 3300021401 | Soil | MKTLFMTLAAVLGLALGTASLSPAAHAAQVYLYPPAQNGQG |
| Ga0210393_116342681 | 3300021401 | Soil | MKTMFLTLAAILGLALGTASLTPVAHASNVQLYPPSSVGGNN |
| Ga0210385_112274101 | 3300021402 | Soil | RRRTTMKTMFLTLAAILGVALGTVSLTQSAYASNVQLYPPSQATDGRG |
| Ga0210397_108542173 | 3300021403 | Soil | WRTTMKTVFLTLAAVLGLALGTASVIPAAHASNVQLYLPSNSVG |
| Ga0210387_116229681 | 3300021405 | Soil | MKTIFLTLAAVLGIALGTVSLTPAAHASNVQLYPPSSVGGNN |
| Ga0210394_107213672 | 3300021420 | Soil | MKSMFLTLAAVLGIALGTVSLSQSANASNVQLYPPSQATDGRG |
| Ga0210391_101045452 | 3300021433 | Soil | MKTMFLTLAAIVGLALGTASLIPAAHATNIQLYPPSNAPG |
| Ga0210391_101550452 | 3300021433 | Soil | MKSMFLTLAAVLGIALGTISLTQSAYASNVQLYPPSNAADGRG |
| Ga0210391_102013171 | 3300021433 | Soil | MKTMFLTLAAVLGIALGTVSLTPSAHASNVQLYPPSSVGGNG |
| Ga0210391_103036941 | 3300021433 | Soil | MKTMFLTLAAVLGLALGTASLIPAAHASNVQLYPPSSVGGNG |
| Ga0210391_111516981 | 3300021433 | Soil | MKTMFLTLAAVLGVALGAVSLTPAAYASNVQLYPPSSIGGNG |
| Ga0210392_113662341 | 3300021475 | Soil | MKTMFLTLAAILGVALGTVSLTQSAYASNVQLYPP |
| Ga0210398_101541381 | 3300021477 | Soil | MKTTFLTLAAVLGIALGTVSLTPSAHASNVQLYPPSSVGGNG |
| Ga0210398_101781972 | 3300021477 | Soil | MKSMFLTLAAVLGIALGTVSLTHSAYASNVQLYPPSQATDGRG |
| Ga0210398_102491232 | 3300021477 | Soil | MKTTFLTLAAVLGIALGTVSVSQSAHASNVQLYPPSSVGGNG |
| Ga0210398_106641701 | 3300021477 | Soil | MKTMFLTLAAIVGVALGTVSLSQSANASNVQLYPPSQATDGRG |
| Ga0210398_109177692 | 3300021477 | Soil | MKTMFLTLAAVLGVALGSATLAPAAHASNVQVYPPSSVGGNG |
| Ga0210410_107555342 | 3300021479 | Soil | MKTMFLTLAAVLGIALGTVSLTPAAHASNVQLYPPSS |
| Ga0242649_10116801 | 3300022509 | Soil | MKTMFLTLAAVLGLALGTVSVIPAAHASHVYLYQPSQSAG |
| Ga0242649_10313522 | 3300022509 | Soil | MKAMFLTLAAVLGIALGTVSLTPAAHASNVQLYPPSSVGGNG |
| Ga0242653_10659741 | 3300022712 | Soil | MTMKTMFLTLAAVLGIALGTVSLTPAAHASNVQLYPPSSVGGNN |
| Ga0242673_10709191 | 3300022716 | Soil | FLALAAVLGIALGTVSLSQSAYASNVQLYPPSNAADGRG |
| Ga0242666_10366191 | 3300022721 | Soil | MKSMFLTLAAVLGIALGTVSLTPAAHASNVQLYPPSNAADGRG |
| Ga0242666_11648891 | 3300022721 | Soil | MKTMLLALAAVLGISLGTASLIPVAHAASVYLYPPSESAG |
| Ga0242654_101864842 | 3300022726 | Soil | MFLTLAAVLGIALGTVSLTPAAHASNVQLYPPSSVGGNN |
| Ga0208488_10099061 | 3300027110 | Forest Soil | RTTMKSMFLTLAAVLGIALGTISLTQSAYASNVQLYPPSNAADGRG |
| Ga0208488_10163164 | 3300027110 | Forest Soil | MKTVFLTLAAVLGLAIGAASVIPAAHASNVQLYQPSNSVG |
| Ga0209904_10176721 | 3300027394 | Thawing Permafrost | MKTTFLTLAAVLGIALGTASLIPAAHASTVSLRCV |
| Ga0209274_100726852 | 3300027853 | Soil | MKTMFLTLAAVVGLALGTASLIPAAHASNVQLYPPSQAPG |
| Ga0209274_101269763 | 3300027853 | Soil | MKTVFLTLAAVLGLALGTASVIPAAHASNVQVYPPSNSVG |
| Ga0209274_101640341 | 3300027853 | Soil | MKTMLLTLAAVLGLALGTASLIPAAHASNVQLYPPSSVGGNG |
| Ga0209169_100270013 | 3300027879 | Soil | MKTMFLTLAAVLGLVLGTASVIPAAHASNVQVYPPSNSVG |
| Ga0209415_101176643 | 3300027905 | Peatlands Soil | MKTLYLTLAAVLGLALGTASVIPAAHASNVQLYPPSNSVG |
| Ga0209415_103406272 | 3300027905 | Peatlands Soil | MKTMFLTLAAVLGLALGTASLIPAARASTVYLYPSSNSVG |
| Ga0209415_109706661 | 3300027905 | Peatlands Soil | MKTMFLTLAAVLGIALGTVSLTPAAHASQVYLYQPSQSVG |
| Ga0308309_117081531 | 3300028906 | Soil | MKSMFLTLAAVLGIALGTVSLTPAAHASNVQLYPPSSVGGNG |
| Ga0311371_122800892 | 3300029951 | Palsa | MKTMFLTLAAVLGLAIGTASLIPAAQASSVYLYPPSNAPG |
| Ga0311370_111272692 | 3300030503 | Palsa | MKIMFLTMAAILGIALGTASLIPTAHASNVYLFPPSQSAG |
| Ga0311372_110823091 | 3300030520 | Palsa | MKSMFLTLAAVLGLALGAASMIPAAHASNVQLYPPSSVGGNG |
| Ga0311372_110823092 | 3300030520 | Palsa | MKTMFLTLAAVLGLALGTASMIPAAHASNVQLYPPSSVGGNG |
| Ga0311372_112520191 | 3300030520 | Palsa | MKTMFLTLAAVLGLALGTASLIPAAHASNVYLYPPSTSAG |
| Ga0311372_117198352 | 3300030520 | Palsa | MKTMFLTLAAVLGIALGTASLIPAAHASSVWLFPPSQSAG |
| Ga0311372_121318091 | 3300030520 | Palsa | MKTMFLTLAALLGFAIGTASLIPAAHAARVYLYQPTDNGQG |
| Ga0210285_15528113 | 3300030535 | Soil | MKTMFLMLAAVLGLVLGTASLTPAAHASQTYLYPPAGDLSNG |
| Ga0307482_10863961 | 3300030730 | Hardwood Forest Soil | MKTMFLTLAAILGVALGTVSLTQSAYASNVQLYPPSQATDGRG |
| Ga0307482_11225181 | 3300030730 | Hardwood Forest Soil | MKTMFLTLAAVLGIAIGTASLTPAAQASQVYLYPPAGNLANG |
| Ga0307482_11666721 | 3300030730 | Hardwood Forest Soil | MKTMFLTLAAVLGLALGTASLTQAAHASQVYLYPPSQSAG |
| Ga0265462_105757051 | 3300030738 | Soil | MKTMFLTLAAVLGIALGTVSLTHSAYASNVQLYPPSNAADGRG |
| Ga0265460_107335983 | 3300030740 | Soil | MKTVFLTLAAVLGLVLGTASVIPAAHASNVQVYPPSNSVG |
| Ga0265461_120589692 | 3300030743 | Soil | MKSMFLTLAAVLGIALGTVSLTHSAYASNVQLYPPSNAADGRG |
| Ga0074037_17151651 | 3300030803 | Soil | AMFLALAAVLGLAIGTASLIPAAHASRVYLYQPSDTTG |
| Ga0265766_10188862 | 3300030863 | Soil | MKTMFLTLAAVLGLALGTASLTPAAHASNVYLYPPSNAAG |
| Ga0265766_10210042 | 3300030863 | Soil | MKTMFLTLAAVLGLALGTASLSPAAHASSVYLHQPDSYGN |
| Ga0302314_112705741 | 3300030906 | Palsa | MKTMFLTLAAVLGIALGTAALIPAAHASQVHLYPASDTTG |
| Ga0138296_17775352 | 3300030923 | Soil | MKSMFLTLAAVLGIAIGTASLAPAQASQVYLYPPAGDLANG |
| Ga0138298_16228622 | 3300031015 | Soil | MKTMFLTLAAILGIAIGTASLAPAANASQTYLYPPAGNLANG |
| Ga0302325_107980943 | 3300031234 | Palsa | MKTMFLTLAALLGFAIGTASLIPAAHASRVYLYQPTDNGQG |
| Ga0302325_110426052 | 3300031234 | Palsa | MKTMFVTLAAVLVLALGAASLAPAAHASKVYLYPPSTSAG |
| Ga0302325_113342482 | 3300031234 | Palsa | MKTMFLTLAAVLGFAIGTASLIPAAHASRVYLYQPTDNGQG |
| Ga0302325_118169362 | 3300031234 | Palsa | MKIMFLTMAAILGIALGTASLIPAAHASNVYLFPPSQSAG |
| Ga0302324_1004322161 | 3300031236 | Palsa | MKSMFLTLAAVLGLALGTASMIPAAHASNVQLYPPSSVGGNG |
| Ga0302324_1004831504 | 3300031236 | Palsa | MKTMFLTLAAVLGLALGTASLIPAAHASAVSLYQPSNAPG |
| Ga0302324_1005143922 | 3300031236 | Palsa | MKAIFFTLAALMGLAIGTASLIPAAHASRVYLYQPTDNGQG |
| Ga0302324_1019728341 | 3300031236 | Palsa | FLSLAAVLGLALGTASLIPAAHASSVYLYPPSTSAG |
| Ga0302320_119721001 | 3300031524 | Bog | KTMFLTLAAVLGLALGSASIIPAAHASQVYLYPPSQSAG |
| Ga0302320_122357731 | 3300031524 | Bog | LSTGRTMMKTMLLTLAAVLGVALGTASLIPAAHASQVYLYPPAENGQG |
| Ga0310111_1321112 | 3300031667 | Soil | MKTMFLTLAAVLSIALGTVSLTQSAQASNVQLYPPSQATDGRG |
| Ga0310686_1009476523 | 3300031708 | Soil | MKTMFLTLAAVLGIAIGTASLAPAQASQVYLYQPAGDLANG |
| Ga0310686_1021134422 | 3300031708 | Soil | MKTVFLTLAAVLGLALGAASVIPAAHASNVQLYQPSNSVG |
| Ga0310686_1022918326 | 3300031708 | Soil | MKTMFLTLAAVLGIALGTVSLTASAHATNVQLYPPSSVGGNG |
| Ga0310686_1080265126 | 3300031708 | Soil | MKTMFLTLAAVLGLALGTGSLIPAAHASQVYLYPPAQNGQG |
| Ga0310686_1129976671 | 3300031708 | Soil | MFLTLAAVLGLALGTASLIPAAHASNVQLYPPSQAPG |
| Ga0310686_11307787618 | 3300031708 | Soil | MKTMFLALAAVLGLAIGTASLIPAAHASRVYLYQPSDTTG |
| Ga0310686_1133010462 | 3300031708 | Soil | MKTIFLTLAAIVGLALGTASLIPAAHASNIQLYPPSEAPG |
| Ga0310686_1146539802 | 3300031708 | Soil | MKTMFLTLAAVVGLALGTASLMPAAHASQVYLYQPTDHGQG |
| Ga0310686_1175361411 | 3300031708 | Soil | TWRTTMKTMFLTLAAVLGLALGTACLTPAAHASNVQVYPPSSVGGNG |
| Ga0310686_1177218741 | 3300031708 | Soil | MKTMFLTLAAVLGLAVGTTALAPAAHASQTYLYPPAGDLSNG |
| Ga0310686_1197713742 | 3300031708 | Soil | MKTMFLTLAAVLGLALGTASLTQTAHASQVYLYPPSQSAG |
| Ga0311301_105863572 | 3300032160 | Peatlands Soil | MKTMFLTLAAVVGLALGTASLIPAAHASQVYLYPPTQNGQG |
| Ga0311301_124044592 | 3300032160 | Peatlands Soil | MKTMFLTLAAVVGLALGTASLTTAAQASQVYLYPPSQSAG |
| Ga0348332_111349692 | 3300032515 | Plant Litter | MKTMFLTLAAVLGFAIGAASLSPAAHASKVYLYQPSTSAG |
| Ga0348332_113374282 | 3300032515 | Plant Litter | MKTMFLTLAAVLGIALGTVSLTPAAHASNVQLYPPSSVGGNG |
| Ga0348332_119067151 | 3300032515 | Plant Litter | MKTMFLALAAVLGFAIGTASLIPAAHASRVYLYQPTDTGNG |
| Ga0348332_124112142 | 3300032515 | Plant Litter | MKTMLLALAAVLGIALGTASLIPVAHAASVYLYPPSESAG |
| Ga0334790_149701_435_557 | 3300033887 | Soil | MKTMFLTLAAVLGIALGTASLIPAAHASTVSLYPPSQSAG |
| Ga0370515_0310239_10_135 | 3300034163 | Untreated Peat Soil | MKTMFLMLAAVLGLAPDTASLIPAAHASQVHLYPPAQNGQG |
| ⦗Top⦘ |