


| Basic Information | |
|---|---|
| Family ID | F043607 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 156 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MEEKYIKFYKTFHKKFKNDENLILCSKLLCDGGVVSFAEL |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 156 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 19.67 % |
| % of genes near scaffold ends (potentially truncated) | 42.31 % |
| % of genes from short scaffolds (< 2000 bps) | 58.97 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.564 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (36.538 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.667 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (94.872 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.59% β-sheet: 0.00% Coil/Unstructured: 54.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 156 Family Scaffolds |
|---|---|---|
| PF13302 | Acetyltransf_3 | 8.97 |
| PF14240 | YHYH | 5.77 |
| PF01381 | HTH_3 | 5.77 |
| PF13474 | SnoaL_3 | 4.49 |
| PF07681 | DoxX | 3.85 |
| PF01124 | MAPEG | 3.21 |
| PF13522 | GATase_6 | 2.56 |
| PF01380 | SIS | 2.56 |
| PF01522 | Polysacc_deac_1 | 1.92 |
| PF04832 | SOUL | 1.28 |
| PF10067 | DUF2306 | 1.28 |
| PF13391 | HNH_2 | 1.28 |
| PF13469 | Sulfotransfer_3 | 1.28 |
| PF00551 | Formyl_trans_N | 1.28 |
| PF05154 | TM2 | 1.28 |
| PF02222 | ATP-grasp | 0.64 |
| PF06941 | NT5C | 0.64 |
| PF04471 | Mrr_cat | 0.64 |
| PF00903 | Glyoxalase | 0.64 |
| PF02333 | Phytase | 0.64 |
| PF04191 | PEMT | 0.64 |
| PF00271 | Helicase_C | 0.64 |
| PF00266 | Aminotran_5 | 0.64 |
| PF04264 | YceI | 0.64 |
| PF05656 | DUF805 | 0.64 |
| PF03992 | ABM | 0.64 |
| PF01300 | Sua5_yciO_yrdC | 0.64 |
| PF03235 | DUF262 | 0.64 |
| PF00144 | Beta-lactamase | 0.64 |
| PF01638 | HxlR | 0.64 |
| PF12643 | MazG-like | 0.64 |
| PF03160 | Calx-beta | 0.64 |
| PF04298 | Zn_peptidase_2 | 0.64 |
| PF13395 | HNH_4 | 0.64 |
| PF00004 | AAA | 0.64 |
| PF04828 | GFA | 0.64 |
| PF00753 | Lactamase_B | 0.64 |
| PF12766 | Pyridox_oxase_2 | 0.64 |
| PF14248 | DUF4345 | 0.64 |
| PF12893 | Lumazine_bd_2 | 0.64 |
| PF03466 | LysR_substrate | 0.64 |
| PF07823 | CPDase | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 156 Family Scaffolds |
|---|---|---|---|
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 3.85 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 3.85 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG2314 | Uncharacterized membrane protein YozV, TM2 domain, contains pTyr | General function prediction only [R] | 1.28 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.64 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.64 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.64 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.64 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.64 |
| COG2738 | Zn-dependent membrane protease YugP | Posttranslational modification, protein turnover, chaperones [O] | 0.64 |
| COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 0.64 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.64 |
| COG4247 | 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) | Lipid transport and metabolism [I] | 0.64 |
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.49 % |
| Unclassified | root | N/A | 45.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559017|JCVI_READ_927170 | Not Available | 943 | Open in IMG/M |
| 3300000168|LPjun09P1210mDRAFT_c1003180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1555 | Open in IMG/M |
| 3300000929|NpDRAFT_10097341 | All Organisms → Viruses → Predicted Viral | 1463 | Open in IMG/M |
| 3300000947|BBAY92_10042179 | All Organisms → Viruses → Predicted Viral | 1245 | Open in IMG/M |
| 3300001348|JGI20154J14316_10098084 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300001352|JGI20157J14317_10159068 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300001778|ACM18_1101025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300001819|ACM37_107603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED236 | 788 | Open in IMG/M |
| 3300001833|ACM24_1015619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED236 | 879 | Open in IMG/M |
| 3300001846|ACM22_1018199 | Not Available | 671 | Open in IMG/M |
| 3300001960|GOS2230_1052151 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300003474|NAP4_1050597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 819 | Open in IMG/M |
| 3300003617|JGI26082J51739_10026042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → environmental samples → uncultured marine proteobacterium ANT8C10 | 2301 | Open in IMG/M |
| 3300004097|Ga0055584_101871841 | Not Available | 617 | Open in IMG/M |
| 3300005432|Ga0066845_10169815 | Not Available | 838 | Open in IMG/M |
| 3300005523|Ga0066865_10087204 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300005608|Ga0066840_10139155 | Not Available | 512 | Open in IMG/M |
| 3300005837|Ga0078893_10270117 | Not Available | 622 | Open in IMG/M |
| 3300005934|Ga0066377_10121398 | Not Available | 787 | Open in IMG/M |
| 3300005934|Ga0066377_10288356 | Not Available | 509 | Open in IMG/M |
| 3300006025|Ga0075474_10131990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED236 | 791 | Open in IMG/M |
| 3300006166|Ga0066836_10571227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 684 | Open in IMG/M |
| 3300006337|Ga0068495_1492693 | Not Available | 699 | Open in IMG/M |
| 3300006345|Ga0099693_1027943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1845 | Open in IMG/M |
| 3300006351|Ga0099953_1551362 | Not Available | 534 | Open in IMG/M |
| 3300006400|Ga0075503_1009987 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300006402|Ga0075511_1011774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1533 | Open in IMG/M |
| 3300006622|Ga0101442_102915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5600 | Open in IMG/M |
| 3300007514|Ga0105020_1034544 | Not Available | 4547 | Open in IMG/M |
| 3300008224|Ga0105350_10055782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1720 | Open in IMG/M |
| 3300008627|Ga0115656_1030373 | All Organisms → cellular organisms → Bacteria | 3440 | Open in IMG/M |
| 3300009076|Ga0115550_1020745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3128 | Open in IMG/M |
| 3300009104|Ga0117902_1040542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5803 | Open in IMG/M |
| 3300009104|Ga0117902_1084522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3568 | Open in IMG/M |
| 3300009172|Ga0114995_10462247 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300009526|Ga0115004_10043941 | All Organisms → Viruses → Predicted Viral | 2895 | Open in IMG/M |
| 3300010297|Ga0129345_1097153 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300010936|Ga0137784_1190147 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300012284|Ga0116696_1000931 | Not Available | 3283 | Open in IMG/M |
| 3300012525|Ga0129353_1354131 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012928|Ga0163110_10023294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3668 | Open in IMG/M |
| 3300013116|Ga0171646_1042674 | All Organisms → cellular organisms → Bacteria | 2141 | Open in IMG/M |
| 3300013252|Ga0116817_1037032 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300014030|Ga0116816_1032239 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300017697|Ga0180120_10398819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium TMED236 | 540 | Open in IMG/M |
| 3300017818|Ga0181565_10394581 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300017950|Ga0181607_10590100 | Not Available | 585 | Open in IMG/M |
| 3300017951|Ga0181577_10370892 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300017957|Ga0181571_10605556 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300017962|Ga0181581_10119310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1801 | Open in IMG/M |
| 3300017969|Ga0181585_10111967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Nioella → Nioella ostreopsis | 2036 | Open in IMG/M |
| 3300017969|Ga0181585_10553923 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300017986|Ga0181569_11100303 | Not Available | 508 | Open in IMG/M |
| 3300018036|Ga0181600_10037566 | All Organisms → cellular organisms → Bacteria | 3221 | Open in IMG/M |
| 3300018049|Ga0181572_10409704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 846 | Open in IMG/M |
| 3300018420|Ga0181563_10049490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2978 | Open in IMG/M |
| 3300018420|Ga0181563_10356935 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 842 | Open in IMG/M |
| 3300018420|Ga0181563_10563504 | Not Available | 636 | Open in IMG/M |
| 3300018420|Ga0181563_10716760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300018426|Ga0181566_10225279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1378 | Open in IMG/M |
| 3300018426|Ga0181566_11010442 | Not Available | 560 | Open in IMG/M |
| 3300018428|Ga0181568_11311321 | Not Available | 540 | Open in IMG/M |
| 3300019277|Ga0182081_1340579 | Not Available | 687 | Open in IMG/M |
| 3300019277|Ga0182081_1506984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300020177|Ga0181596_10355333 | Not Available | 569 | Open in IMG/M |
| 3300020182|Ga0206129_10217925 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300020191|Ga0181604_10205037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 954 | Open in IMG/M |
| 3300020194|Ga0181597_10186726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1019 | Open in IMG/M |
| 3300020281|Ga0211483_10062757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1217 | Open in IMG/M |
| 3300020349|Ga0211511_1082062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Catenovulum → Catenovulum agarivorans | 764 | Open in IMG/M |
| 3300020358|Ga0211689_1071071 | Not Available | 1001 | Open in IMG/M |
| 3300020365|Ga0211506_1080055 | Not Available | 924 | Open in IMG/M |
| 3300020386|Ga0211582_10397064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300020391|Ga0211675_10258504 | Not Available | 745 | Open in IMG/M |
| 3300020408|Ga0211651_10122153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1058 | Open in IMG/M |
| 3300020422|Ga0211702_10018688 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1875 | Open in IMG/M |
| 3300020424|Ga0211620_10006033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5453 | Open in IMG/M |
| 3300020431|Ga0211554_10304126 | Not Available | 749 | Open in IMG/M |
| 3300020432|Ga0211556_10409876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 602 | Open in IMG/M |
| 3300020439|Ga0211558_10471153 | Not Available | 576 | Open in IMG/M |
| 3300020441|Ga0211695_10300728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300020448|Ga0211638_10000447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A | 18139 | Open in IMG/M |
| 3300020450|Ga0211641_10239054 | Not Available | 896 | Open in IMG/M |
| 3300020451|Ga0211473_10098040 | Not Available | 1496 | Open in IMG/M |
| 3300020456|Ga0211551_10188909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 977 | Open in IMG/M |
| 3300020465|Ga0211640_10480521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 678 | Open in IMG/M |
| 3300020469|Ga0211577_10727019 | Not Available | 580 | Open in IMG/M |
| 3300020473|Ga0211625_10517312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Novispirillum → Novispirillum itersonii | 588 | Open in IMG/M |
| 3300020601|Ga0181557_1261842 | Not Available | 593 | Open in IMG/M |
| 3300021087|Ga0206683_10033199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2996 | Open in IMG/M |
| 3300021368|Ga0213860_10155790 | Not Available | 1006 | Open in IMG/M |
| 3300021960|Ga0222715_10026309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4253 | Open in IMG/M |
| 3300021960|Ga0222715_10304071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 905 | Open in IMG/M |
| 3300022907|Ga0255775_1025449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3361 | Open in IMG/M |
| 3300022914|Ga0255767_1026386 | All Organisms → cellular organisms → Bacteria | 3634 | Open in IMG/M |
| 3300022914|Ga0255767_1194392 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300022923|Ga0255783_10044066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2785 | Open in IMG/M |
| 3300022925|Ga0255773_10032371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3353 | Open in IMG/M |
| 3300022928|Ga0255758_10320695 | Not Available | 649 | Open in IMG/M |
| 3300022929|Ga0255752_10043050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2908 | Open in IMG/M |
| 3300022929|Ga0255752_10286707 | Not Available | 706 | Open in IMG/M |
| 3300023110|Ga0255743_10060023 | All Organisms → cellular organisms → Bacteria | 2373 | Open in IMG/M |
| 3300023170|Ga0255761_10018862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5319 | Open in IMG/M |
| 3300023172|Ga0255766_10012128 | Not Available | 6579 | Open in IMG/M |
| 3300023178|Ga0255759_10192180 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300023178|Ga0255759_10290885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae | 1032 | Open in IMG/M |
| 3300024297|Ga0228658_1023977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1579 | Open in IMG/M |
| 3300025636|Ga0209136_1016857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3026 | Open in IMG/M |
| 3300025637|Ga0209197_1143847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86B | 651 | Open in IMG/M |
| 3300025771|Ga0208427_1179425 | Not Available | 684 | Open in IMG/M |
| 3300025810|Ga0208543_1020985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1657 | Open in IMG/M |
| 3300026085|Ga0208880_1015269 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300026189|Ga0208405_1069285 | Not Available | 516 | Open in IMG/M |
| 3300026258|Ga0208130_1154479 | Not Available | 612 | Open in IMG/M |
| 3300027048|Ga0208962_1004299 | All Organisms → cellular organisms → Bacteria | 2486 | Open in IMG/M |
| 3300027687|Ga0209710_1024248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3105 | Open in IMG/M |
| 3300028115|Ga0233450_10300409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300028128|Ga0228645_1152419 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300028194|Ga0257106_1023296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2468 | Open in IMG/M |
| 3300031757|Ga0315328_10546661 | Not Available | 664 | Open in IMG/M |
| 3300031785|Ga0310343_10783680 | Not Available | 715 | Open in IMG/M |
| 3300031851|Ga0315320_10239366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1319 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 36.54% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 14.10% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 8.97% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 5.13% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.49% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 3.85% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.21% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 2.56% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.56% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.56% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.92% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.28% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.28% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 1.28% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.28% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.28% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.28% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.28% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.64% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.64% |
| Environmental And Host-Associated | Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated | 0.64% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.64% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.64% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 0.64% |
| Beach Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Beach Sand | 0.64% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559017 | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean5 (GOS 4441573) | Environmental | Open in IMG/M |
| 3300000168 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 10m | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001778 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM18, ROCA_DNA027_0.2um_3g | Environmental | Open in IMG/M |
| 3300001819 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM37, ROCA_DNA077_2.0um_10k | Environmental | Open in IMG/M |
| 3300001833 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM24, ROCA_DNA012_0.2um_2l | Environmental | Open in IMG/M |
| 3300001846 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25b | Environmental | Open in IMG/M |
| 3300001960 | Marine microbial communities from South of Charleston, South Carolina, USA - GS014 | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300003474 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4 | Environmental | Open in IMG/M |
| 3300003617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005432 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 | Environmental | Open in IMG/M |
| 3300005464 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0025m | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005608 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006337 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0025m | Environmental | Open in IMG/M |
| 3300006345 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075m | Environmental | Open in IMG/M |
| 3300006351 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0045m | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006622 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ08 time point | Environmental | Open in IMG/M |
| 3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300008224 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1E Hudson Canyon | Environmental | Open in IMG/M |
| 3300008627 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300008629 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010936 | Marine microbial communities from surface seawater of North Pacific Subtropical Gyre ? Stn. ALOHA, 15m | Environmental | Open in IMG/M |
| 3300012284 | Beach sand microbial communities from Municipal Pensacola Beach, Florida - OS-S2 | Environmental | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300013116 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300013252 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 11m_Station6_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300014030 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 11m_Station1_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300016742 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016748 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016749 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016754 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019277 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020177 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020281 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) | Environmental | Open in IMG/M |
| 3300020349 | Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289006-ERR315859) | Environmental | Open in IMG/M |
| 3300020358 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009) | Environmental | Open in IMG/M |
| 3300020365 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143) | Environmental | Open in IMG/M |
| 3300020386 | Marine microbial communities from Tara Oceans - TARA_B100000609 (ERX555990-ERR599038) | Environmental | Open in IMG/M |
| 3300020391 | Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967) | Environmental | Open in IMG/M |
| 3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020422 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126) | Environmental | Open in IMG/M |
| 3300020424 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138) | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300020432 | Marine microbial communities from Tara Oceans - TARA_B100002052 (ERX556103-ERR599100) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020473 | Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948) | Environmental | Open in IMG/M |
| 3300020477 | Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156) | Environmental | Open in IMG/M |
| 3300020601 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011506CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
| 3300022914 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG | Environmental | Open in IMG/M |
| 3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300024297 | Seawater microbial communities from Monterey Bay, California, United States - 71D | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025637 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026085 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026189 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A (SPAdes) | Environmental | Open in IMG/M |
| 3300026258 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 (SPAdes) | Environmental | Open in IMG/M |
| 3300027048 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C43A7_80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
| 3300028128 | Seawater microbial communities from Monterey Bay, California, United States - 57D | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ocean5-_00309640 | 2166559017 | Environmental And Host-Associated | MEEKYIKFYKTCHKNFKNDENLILRSKTLSTVDFP |
| LPjun09P1210mDRAFT_10031801 | 3300000168 | Marine | MEEKYIKFYKTFHKKFKNNENLIHCFETLSDGGIGQ |
| NpDRAFT_100973412 | 3300000929 | Freshwater And Marine | MEKKYIKFYKTFHKKFKNDENLILYSKTLCYGGISQSR |
| BBAY92_100421791 | 3300000947 | Macroalgal Surface | MEKKYIKFYKTFHKKFKNDENLILCSKTLSDGGVDLKSLS* |
| JGI20154J14316_100980843 | 3300001348 | Pelagic Marine | MEEKYIKFYKTFHKKFKNDENLILCSNLISHGRVEQNGE* |
| JGI20157J14317_101590681 | 3300001352 | Pelagic Marine | MDKKYIKFYKTFHKKFKNDENLILCSKLLCDGKVKRN |
| ACM18_11010251 | 3300001778 | Marine Plankton | MEEKYIKFYKTFHKKFKNDKNLIHCFELLSDCGVVQNSELKERISRSEF* |
| ACM37_1076033 | 3300001819 | Marine Plankton | MEEKYIKFYKNFHKKFKNDKDLIHCSKTLNDR*VVSSDE*DN* |
| ACM24_10156194 | 3300001833 | Marine Plankton | MEEKYIKFYKTFHKKFKNDENLIHCLHLLSDGRVVFTVNKG*LL |
| ACM22_10181992 | 3300001846 | Marine Plankton | MEEKYIKFYKTFHKKFKNDKNLIHCSNLVSDCRVDKGV |
| GOS2230_10521512 | 3300001960 | Marine | MEEKYIKFYKTFHKKFKNDQDLIHCLYLLSDRGVIQNSE* |
| GOS2246_101431962 | 3300001974 | Marine | MKQKYIKFYKTFHKKFKNDENLILCSKTLNDGGVVSFAELKFKLWAKKI* |
| NAP4_10505973 | 3300003474 | Estuarine | MEEKYIKFYKTFHKKFKNDKNLILCSKTLCDGGIEGNSDLKRRK* |
| JGI26082J51739_100260421 | 3300003617 | Marine | EKKYIKFYKTFHKKFKNDENLILCSKTLCYGGISQSRLSF* |
| Ga0055584_1003214644 | 3300004097 | Pelagic Marine | MMEDKYVKFYKIFDKRFKNNKNLILCSKSLSDGGVGSFAELIIWQSK* |
| Ga0055584_1018718411 | 3300004097 | Pelagic Marine | MTLMDKKYIKFYKTFHKKFKNDENLILCSNTLCDGGVEQNREL* |
| Ga0066845_101698152 | 3300005432 | Marine | MKQKYIKFYKTFHKKFKNDENLILCSKTLSDGGVILDSEVNTS* |
| Ga0068484_1010311 | 3300005464 | Marine | MKDNYKKFYMMFDKRLKNLILCSNLNSDGGVVSFAELIIWQSK* |
| Ga0066865_100872041 | 3300005523 | Marine | LVVEEKYIKFYKTFHKKFKNDENLILCSNLISDR* |
| Ga0066840_101391551 | 3300005608 | Marine | MDKKYIKFYKTFHKKFKNDENLILCSKLLCDGGVVLT |
| Ga0078893_102701172 | 3300005837 | Marine Surface Water | MDKKYIKFYKMFHKKFKNGENLILCSKTLSDGGVEQ |
| Ga0066377_101213982 | 3300005934 | Marine | MEEKYIKFYKTFHKKFKNDENLIHCFELLSDGGVEQNSELDRTIYV* |
| Ga0066377_102883562 | 3300005934 | Marine | MIKKMDKKYIKFYKTFHKKFKNNENLIHCFELLSDGGVSLTSLSF* |
| Ga0075474_101319901 | 3300006025 | Aqueous | MEEKYIKFYKTFHKKFKNDKNLIHCSNLVSDSGVDKGVY* |
| Ga0066836_105712271 | 3300006166 | Marine | MKEKYIKFYKDFHKAFGGKSNHCSNLISNCRVSSNRELNKQ* |
| Ga0068495_14926931 | 3300006337 | Marine | MDKKYIKFYKTFHKKFKNDENLILCSNTLCDGGMSLSAELTIR* |
| Ga0068495_16454624 | 3300006337 | Marine | YIKFYKTFHKKFKNDENLILCSNLLSDGGVVSFAELIIWQSK* |
| Ga0099693_10279433 | 3300006345 | Marine | MDKKYIKFYKTFHKKFKNDENLILCSNLIGDGGMSLSAELTIR* |
| Ga0099953_15513622 | 3300006351 | Marine | MDKKYIKFYKTFHKKFKNDENFILCSNTLCDGGMSLSAELTIR* |
| Ga0075503_10099872 | 3300006400 | Aqueous | MEEKYIKFYKTFHKKFKNDKNLIHCSNLVSDCGVVQNSELDRTIYV* |
| Ga0075511_10117742 | 3300006402 | Aqueous | MEEKYIKFYKTFHKKFKNDKNLIHCSNLVSDGGVVLNSD* |
| Ga0101442_1029156 | 3300006622 | Marine Surface Water | MDKKYIKFYKMFHKKFKNGENLILCSKTLSDGGVEQNRELGKINI* |
| Ga0105020_10101509 | 3300007514 | Marine | MMEDKYVKFYKIFDKRFKNNKNLILCSKSLSDSGVSLNRGLKKHI* |
| Ga0105020_10345445 | 3300007514 | Marine | MEEKYIKFYKTFHKKFKNDKNLILCSKTLNDCGVIQNSELKNGIGTLK* |
| Ga0105350_100557824 | 3300008224 | Methane Seep Mesocosm | MMEDKYVKFYKIFDKRFKNNKNLILCSKSLSDGGVEI* |
| Ga0115656_10303733 | 3300008627 | Marine | VEEKYIKFYKTFHKNFKNDENLILCSNLISHRGVVEIGFRK* |
| Ga0115658_11291194 | 3300008629 | Marine | IKFYKTFHKKFKNDENLILCSNLISDGGIILRAELSE* |
| Ga0115550_10207453 | 3300009076 | Pelagic Marine | MEKKYIKFYKTFHKKFKNDKNLLLCSNLNSDGGVSQRQLTF* |
| Ga0117902_10405426 | 3300009104 | Marine | MMEDKYVKFYKIFDKRFKNNKNLILCSKSLSDCGVIQNSELKNGIGTLK* |
| Ga0117902_10845227 | 3300009104 | Marine | SKMEEKYIKFYKTFHKKFKNDKNLIHCFELLSDCGVEHNS* |
| Ga0114995_104622472 | 3300009172 | Marine | MEDKYIKFYAAFHKKFKNGKNLILCSKTLSHGGAEQNSESN* |
| Ga0115004_100439417 | 3300009526 | Marine | MEEKYIKFLKNFDKRFKNNDNLILCSKTLRDGGVVWNREL* |
| Ga0129345_10971533 | 3300010297 | Freshwater To Marine Saline Gradient | MEEKDIKFYKTFHKKFKNDENLILCSKTLSDGGVISSDE* |
| Ga0137784_11901471 | 3300010936 | Marine | MDKKYIKFYKTFHKKFKNDENLILCSNTLCDGGVSLNRELRHKKCR* |
| Ga0137784_13418413 | 3300010936 | Marine | DKKYIKFYKTFHKKFKNDENLILCSNLLSDGGVVSFAELIIWQSK* |
| Ga0116696_10009314 | 3300012284 | Beach Sand | MEERYIKFYKTFHKKFKNNENLILCSKTLSDCRVDTGVRLK* |
| Ga0129353_13541312 | 3300012525 | Aqueous | VEEKYIKFYKTFHKKFKNDENLILCSNLISDGGIEGNSDLKRRK* |
| Ga0163110_100232944 | 3300012928 | Surface Seawater | MEEKYIKFYKTFHKEFKKEENLILCSKTLSNGGVEGNSD* |
| Ga0163109_101872961 | 3300012936 | Surface Seawater | VEEKYIKFYKTFDKRFKNNENLILCSNTLSNGGVVSFAEEHKQIK* |
| Ga0171646_10332863 | 3300013116 | Marine | MMEDKYVKFYKIFDKRFKNNKNLILCSKSLSDGGVVSFAELIHRT* |
| Ga0171646_10426743 | 3300013116 | Marine | MEEKYIKFYKTFHKKFKNNENLIHCFELLSDGGVEQNSELDRTIYV* |
| Ga0116817_10370322 | 3300013252 | Marine | MEEKYIKFYKTFHKKFKNDKNLIHCFELLSDGGVEQNRELKKILYEQF* |
| Ga0116816_10322391 | 3300014030 | Marine | EEKYIKFYKTFHKKFKNDKNLILCSKTLNDGGVV* |
| Ga0182052_11296702 | 3300016742 | Salt Marsh | MEEKYIKFYKTFHKKFKNDENLILCFELLSDGGVVSFAELIFR |
| Ga0182043_12077631 | 3300016748 | Salt Marsh | YIKFYKTFHKKFKNDENLILCSKLLCDGGVVSFAELIFR |
| Ga0182053_11348703 | 3300016749 | Salt Marsh | KFYKTFHKKFKNDENLILCFELLSDGGVVSFAELIFR |
| Ga0182072_11302019 | 3300016754 | Salt Marsh | KFYKTFHKKFKNNENLIHCFELLSDGGVVSFAELIHRT |
| Ga0180120_103988191 | 3300017697 | Freshwater To Marine Saline Gradient | MEEKYIKFYKTFHKKFKNDKNLIHCSSLVSDSGVDKGV |
| Ga0181565_103945812 | 3300017818 | Salt Marsh | MEEKYIKFYKTFHKKFKNDENLILCSKLLCDGGIEGNSDLKRRK |
| Ga0181552_102413311 | 3300017824 | Salt Marsh | MEEKYIKFYKTFHKKFKNDENLIHCFELLSDGGVVSFAELIFR |
| Ga0181607_105901001 | 3300017950 | Salt Marsh | MEEKYIKFYKTFHKKFKNDENLILCSNLISDGGIEGNSDLKRRK |
| Ga0181577_103708922 | 3300017951 | Salt Marsh | MEEKYIKFYKTFHKKFKNDKNLIHCFELLSDGXMILSTELEEPNNE |
| Ga0181571_106055563 | 3300017957 | Salt Marsh | EKYIKFYKTFHKKFKNDKNLIHCSNLVSDGGVEQNREL |
| Ga0181581_101193105 | 3300017962 | Salt Marsh | EEKYIKFYKTFHKKFKNNENLIHCFELLSDGRVVLN |
| Ga0181585_101119671 | 3300017969 | Salt Marsh | MEEKYIKFYKTFHKKFKNDENLIHCFELLSDSGVDLKSLS |
| Ga0181585_105539231 | 3300017969 | Salt Marsh | IKFYKTFHKKFKNDKNLIHCSNLVSDCGVVQNSELKGEF |
| Ga0181585_110460231 | 3300017969 | Salt Marsh | MEEKYTKFCKTFHKKLKNDKNLILCSNSVGDGGVVLFAELNE |
| Ga0181569_101532651 | 3300017986 | Salt Marsh | MEEKYIKFYKTFHKKFKNDENLIHCFELLSDGGVVSFAELI |
| Ga0181569_102706291 | 3300017986 | Salt Marsh | YTKFCKTFHKKLKNDKNLILCSNSLSDGGVVLFAELNE |
| Ga0181569_107375841 | 3300017986 | Salt Marsh | KTFHKKLKNDKNLILCSNSLSDGGVVSFAELIHRI |
| Ga0181569_111003031 | 3300017986 | Salt Marsh | QKYIKFYKTFHKKFKNDENLILCSKTLSHGGIVLE |
| Ga0181600_100375661 | 3300018036 | Salt Marsh | MEEKYIKFYKTFHKKFKNDENLILCSKTLNHGGIRKC |
| Ga0181601_106165711 | 3300018041 | Salt Marsh | KTFHKKLKNDKNLILCSNSLSDGGVVSFAELIHRT |
| Ga0181572_104097041 | 3300018049 | Salt Marsh | NFYMEEKYIKFYKTFHKKFKNDKNLIHCLYLLSDGRVVYDSYX |
| Ga0181559_103576091 | 3300018415 | Salt Marsh | MEEKYIKFYKTFHKKFKNDENLIHCFELLSDGGVVSFAELIHRI |
| Ga0181553_101934521 | 3300018416 | Salt Marsh | KMEEKYTKFCKTFHKKLKNDKNLILCSNSLSDGGVV |
| Ga0181563_100494906 | 3300018420 | Salt Marsh | TFISMEEKYIKFYKTFHKKFKNDENLILCSNLISDGGIEENSDLKRRK |
| Ga0181563_103569351 | 3300018420 | Salt Marsh | MEEKYIKFYKTFHKKFKNDENLIHCFELLSDGGVVSFAEL |
| Ga0181563_105635041 | 3300018420 | Salt Marsh | MEEKYIKFYKTFHKKFKNDENLILCSKLLCDCRVEQNRELESITL |
| Ga0181563_107167601 | 3300018420 | Salt Marsh | MEEKYIKFYKTFHKKFKNDKNLIHCSNLVSDCRVEQNRELESITLE |
| Ga0181566_102252791 | 3300018426 | Salt Marsh | YIKFYKTFHKKFKNDKNLIHCSNLVSDGGVSSNSELKERILSSEF |
| Ga0181566_110104422 | 3300018426 | Salt Marsh | ISMEEKYIKFYKTFHKKFKNDENLILCSNLISDGGIEENSDLKRRK |
| Ga0181568_113113211 | 3300018428 | Salt Marsh | NFYMEEKYIKFYKTFHKKFKNNENLIHCFELLSDGGVV |
| Ga0182081_13405791 | 3300019277 | Salt Marsh | MEEKYIKFYKTFHKKFKNDENLIHCFELLSDGGMSLSAGIFK |
| Ga0182081_15069842 | 3300019277 | Salt Marsh | MEEKYIKFYKTFHKKFKNDKNLIHCSNLVSDCRVSSNRELDRGITIE |
| Ga0181595_100168481 | 3300020053 | Salt Marsh | KMEEKYTKFCKTFHKKLKNDKNLILCSNSLSDGGVVSFAELIFR |
| Ga0206125_100185565 | 3300020165 | Seawater | MMEDKYVKFYKIFDKRFKNNKNLILCSKSLSDGGVGSFAELIIWQSK |
| Ga0181603_100463881 | 3300020174 | Salt Marsh | MEEKYIKFYKTFHKKFKNDENLILCSKLLCDGGVVSFAELIFR |
| Ga0181596_101480001 | 3300020177 | Salt Marsh | MEEKYTKFCKTFHKKLKNDKNLILCSNSLSDGGVVSFAEL |
| Ga0181596_101713871 | 3300020177 | Salt Marsh | KMEEKYTKFCKTFHKKLKNDKNLILCSNSLSDGGVVSFAELIHRT |
| Ga0181596_103553332 | 3300020177 | Salt Marsh | MEEKYIKFYKTFHKKFKNDKNLIHCSNLVSDRGVS |
| Ga0181599_10672665 | 3300020178 | Salt Marsh | MEEKYIKFYKTFHKKFKNDENLILCSKLLCDGGVVSFAEL |
| Ga0206129_102179252 | 3300020182 | Seawater | MEKKYIKFYKTFHKKFKNDENLILCSNTLCDGGVEQNREL |
| Ga0181604_102050371 | 3300020191 | Salt Marsh | MEEKYIKFYKTFHKKFKNDKNLIHCSNLVSDGGVSLNRELP |
| Ga0181597_101867261 | 3300020194 | Salt Marsh | MEEKYIKFYKTFHKKFKNDKNLIHCSNLVSDRGVSSYRE |
| Ga0211483_100627573 | 3300020281 | Marine | VEEKYIKFYKTFHKNFKNDENLILCSNLISHGGVGLNSDFVNIRRKI |
| Ga0211511_10820621 | 3300020349 | Marine | ILQMDKKYIEFYKTFHKKYKNNENLILCSKSLSDGALGS |
| Ga0211689_10710712 | 3300020358 | Marine | MEEKYIKFLKNFDKRFENNDNLILCSKTLSDGGVVWKRELKGEKLCIL |
| Ga0211506_10800552 | 3300020365 | Marine | MEEKYIKFYRTFDKRFKNNENLILCSNTLCDCGVVLNSDFHA |
| Ga0211582_103970641 | 3300020386 | Marine | VEEKYIKFYKRFHKKFKNNENLILCSKTLSDGGVVWN |
| Ga0211675_102585043 | 3300020391 | Marine | LEDKYIKFYRTFHKKFKNDENLILCSKLLNDGGIGSTEGL |
| Ga0211651_101221532 | 3300020408 | Marine | MEEKYIKFYKTFHKKFKNNENLILCSKTLNDGGVELVVPVLI |
| Ga0211580_100038781 | 3300020420 | Marine | MKDKYKKFYMMFDKRFKNLILCSNLNSDGGVVSFAELKFKLWAKKI |
| Ga0211702_100186882 | 3300020422 | Marine | MDKKYIKFYKTFHKKFKNDENLILCSNTLCDGGIILSAELNE |
| Ga0211620_100060331 | 3300020424 | Marine | MEEKYIKFYRTFHKKFKNNENLILCSNLNSESGVSLEEEA |
| Ga0211554_103041262 | 3300020431 | Marine | MEKKYIKFYKTFHKKFKNDKNLILCSNLNSDSGVNLNDNYPHQ |
| Ga0211556_104098761 | 3300020432 | Marine | MEEKYIKFYKTFHKKFKNNENLILCSKTLNDGGVDKGVYIE |
| Ga0211558_104711532 | 3300020439 | Marine | MEEKYIKFYKTFHKKFKNDKNLIHCFELLSDCGVEN |
| Ga0211695_103007281 | 3300020441 | Marine | MIFEEKYIRFYKTFHKKFKNDENLILCSKTLSYGGVV |
| Ga0211638_1000044720 | 3300020448 | Marine | VEDKYIKFYKTFDKRFKNNKKLILCSKTLSDGGVEKNSDLR |
| Ga0211641_102390542 | 3300020450 | Marine | MEEKYIKFYKTFDRRFKNNDNLILCSKTLSDRGVGLG |
| Ga0211473_100980401 | 3300020451 | Marine | MEEKYIKFYKTFHKKFKNDENLILCSKTLCDGGVILNSDLEVENYAN |
| Ga0211551_101889093 | 3300020456 | Marine | MEEKYIKFYKTFHKKFKNDENLILCSKTLSDGGVDKGVYII |
| Ga0211640_104805211 | 3300020465 | Marine | VEDKYIKFYKTFHKKFKNNENLILCSKTLSHSGVS |
| Ga0211577_107270192 | 3300020469 | Marine | VEEKYIKFYKTFHKKFKNNENLILCSKTLSDCRVEQNRELERAIYE |
| Ga0211625_105173121 | 3300020473 | Marine | MKEKYIKFYKTFHKKFKNKKNLILCSKTLSHGGVISS |
| Ga0211585_104165552 | 3300020477 | Marine | MKEKYKKFYMMFDKRFKNLILCSNLNCDGGVVSFAELNFR |
| Ga0181557_12618422 | 3300020601 | Salt Marsh | MEEKYIKFYKTFHKKFKNDKNLIHCSNLVSDCGVVQNSELDRTIY |
| Ga0206683_100331993 | 3300021087 | Seawater | MEEKYIKFYKTFHKKFKNDKNLIHCLYQFSDGGVEQNRELKRAIYE |
| Ga0213858_100498476 | 3300021356 | Seawater | FHKKFKNDKNDKNLIHCSNLVSDGGVVSFAELIIWQSK |
| Ga0213860_101557901 | 3300021368 | Seawater | MEEKYIKFYKTFHKKFKNNENLIHCFELLSDRGVIQN |
| Ga0222715_100263094 | 3300021960 | Estuarine Water | MEEKYIKFYKTFHKKFKNDENLIHCSNLVSDGGVVLNSD |
| Ga0222715_103040711 | 3300021960 | Estuarine Water | MEKKYIKFYKTFHKKFKNDENLILCSKTLSDCGVDRITHFTQD |
| Ga0255775_10254491 | 3300022907 | Salt Marsh | EEKYIKFYKTFHKKFKNDENLILCSKLLCDGGIEGNSDLKRRK |
| Ga0255775_12888881 | 3300022907 | Salt Marsh | EEKYTKFCKTFHKKLKNDKNLILCSNSLSDGGVVSFAELIHRI |
| Ga0255767_10263865 | 3300022914 | Salt Marsh | MEEKYIKFYKTFHKKFKNDKNLIHCLYLLSDGGMSLSAGIFK |
| Ga0255767_11943921 | 3300022914 | Salt Marsh | ISMEEKYIKFYKTFHKKFKNDENLILCSKTLNHGGIRKC |
| Ga0255783_100440666 | 3300022923 | Salt Marsh | KTFHKKFKNDENLILCSKLLCDGGIEGNSDLKRRK |
| Ga0255773_100323711 | 3300022925 | Salt Marsh | KYIKFYKTFHKKFKNDENLILCSKLLCDGGIEGNSDLKRRK |
| Ga0255758_103206951 | 3300022928 | Salt Marsh | MEEKYIKFYKTFHKKFKNDKNLIHCSNLVSDGRVEQNREL |
| Ga0255752_100430501 | 3300022929 | Salt Marsh | EKYIKFYKTFHKKFKNDENLILCSKLLCDGGIEGNSDLKRRK |
| Ga0255752_102867071 | 3300022929 | Salt Marsh | IVMEEKYIKFYKTFHKKFKNDENLILCSKLLCDCRVEQNRELESITL |
| Ga0255743_100600236 | 3300023110 | Salt Marsh | MEEKYIKFYKTFHKKFKNDENLIHCFELLSDGGVV |
| Ga0255761_100188629 | 3300023170 | Salt Marsh | MEEKYIKFYKTFHKKFKNNENLIHCFELLSDGRVVLN |
| Ga0255761_104134701 | 3300023170 | Salt Marsh | MEEKYTKFCKTFHKKLKNDKNLILCSNSLSDGGVV |
| Ga0255766_1001212811 | 3300023172 | Salt Marsh | MEEKYIKFYKTFHKKFKNDENLIHCLHLLSDGRVALY |
| Ga0255759_101921803 | 3300023178 | Salt Marsh | MEEKYIKFYKTFHKKFKNDENLIHCFELLSDGGVVSF |
| Ga0255759_102908851 | 3300023178 | Salt Marsh | FFCYNFYMEEKYIKFYKTFHKKFKNDKNLIHCSNLVSDGGVEQNREL |
| Ga0228658_10239771 | 3300024297 | Seawater | YIKFYKTFHKKFKNDENLILCSKTLSDGGVVPNSKLKERL |
| Ga0233451_102707072 | 3300024301 | Salt Marsh | MKDKHKKFYMLFDKRFKNLILCSNLNSHGGVVSFAELIH |
| Ga0209136_10168572 | 3300025636 | Marine | MEKKYIKFYKTFHKKFKNDENLILYSKTLCYGGISQSRLSF |
| Ga0209197_11438471 | 3300025637 | Pelagic Marine | MDKKYIKFYKTFHKKFKNDENLILCSKLLCDCRVEQNRELK |
| Ga0208427_11794252 | 3300025771 | Aqueous | MEEKYIKFYKTFHKKFKNDKNLIHCSNLVSDRRVVLNSEL |
| Ga0208543_10209851 | 3300025810 | Aqueous | KYIKFYKTFHKKFKNDKNLIHCSNLVSDSGVDKGVY |
| Ga0208644_10953421 | 3300025889 | Aqueous | MEEKYTKFCKTFHKKLKNDKNLILCSNSLSDYGVIL |
| Ga0208880_10152693 | 3300026085 | Marine | MEEKYIKFYKTFHKKFKNDENLIHCFELLSDGGVEQNSELDRTIYV |
| Ga0208405_10692851 | 3300026189 | Marine | MDKKYIKFYKTFHKKFKNDENLILCSKLLCDGGVVLTH |
| Ga0208130_11544792 | 3300026258 | Marine | MKQKYIKFYKTFHKKFKNDENLILCSKTLSDGGVILDSEVNTS |
| Ga0208962_10042991 | 3300027048 | Marine | MMEDKYIKFYKTFDKRFKSNNNLILCSKTLSDGGVEHNSELVY |
| Ga0209710_10242482 | 3300027687 | Marine | MEDKYIKFYAAFHKKFKNGKNLILCSKTLSHGGAEQNSESN |
| Ga0233450_103004091 | 3300028115 | Salt Marsh | MEEKYIKFYKTFHKKFKNDKNLIHCSNLVSDRGVSSYR |
| Ga0228645_11524191 | 3300028128 | Seawater | KTFHKKFKNDENLILCSKTLSDGGVVPNSKLKERL |
| Ga0257106_10232961 | 3300028194 | Marine | MEEKYIKFYKTFHKKFKNNENLIHCFETLSDGGVV |
| Ga0315328_105466611 | 3300031757 | Seawater | MMEDKYIKFYKTFDKRFKSNNNLILCSKTLSDGGV |
| Ga0310343_107836801 | 3300031785 | Seawater | MDKKYIKFYKTFHKKFKNDENLILCSNTLCDGGVSLNREL |
| Ga0315320_102393661 | 3300031851 | Seawater | MMEDKYIKFYKTFDKRFKSNNNLILCSKTLSDGRV |
| ⦗Top⦘ |