


| Basic Information | |
|---|---|
| Family ID | F043514 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 156 |
| Average Sequence Length | 49 residues |
| Representative Sequence | PDRKGLEFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIDKVKG |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 156 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.67 % |
| % of genes near scaffold ends (potentially truncated) | 83.33 % |
| % of genes from short scaffolds (< 2000 bps) | 87.18 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (8.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.256 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (35.256 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.74% β-sheet: 0.00% Coil/Unstructured: 60.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 156 Family Scaffolds |
|---|---|---|
| PF04909 | Amidohydro_2 | 10.26 |
| PF09084 | NMT1 | 8.97 |
| PF13379 | NMT1_2 | 5.13 |
| PF00903 | Glyoxalase | 4.49 |
| PF12728 | HTH_17 | 4.49 |
| PF01042 | Ribonuc_L-PSP | 3.85 |
| PF00437 | T2SSE | 2.56 |
| PF00561 | Abhydrolase_1 | 2.56 |
| PF02423 | OCD_Mu_crystall | 1.28 |
| PF01717 | Meth_synt_2 | 1.28 |
| PF12146 | Hydrolase_4 | 1.28 |
| PF12681 | Glyoxalase_2 | 1.28 |
| PF06676 | DUF1178 | 1.28 |
| PF02604 | PhdYeFM_antitox | 0.64 |
| PF00078 | RVT_1 | 0.64 |
| PF02538 | Hydantoinase_B | 0.64 |
| PF05977 | MFS_3 | 0.64 |
| PF01522 | Polysacc_deac_1 | 0.64 |
| PF01981 | PTH2 | 0.64 |
| PF13751 | DDE_Tnp_1_6 | 0.64 |
| PF02518 | HATPase_c | 0.64 |
| PF07690 | MFS_1 | 0.64 |
| PF01663 | Phosphodiest | 0.64 |
| PF13433 | Peripla_BP_5 | 0.64 |
| PF00710 | Asparaginase | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 156 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 8.97 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 8.97 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 3.85 |
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.28 |
| COG0252 | L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D | Translation, ribosomal structure and biogenesis [J] | 1.28 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 1.28 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 1.28 |
| COG5319 | Uncharacterized conserved protein, DUF1178 domain | Function unknown [S] | 1.28 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
| COG1990 | Peptidyl-tRNA hydrolase | Translation, ribosomal structure and biogenesis [J] | 0.64 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.64 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.64 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.33 % |
| Unclassified | root | N/A | 16.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN02I9K8R | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 528 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101811771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 971 | Open in IMG/M |
| 3300000789|JGI1027J11758_11960637 | Not Available | 568 | Open in IMG/M |
| 3300001139|JGI10220J13317_10368667 | Not Available | 559 | Open in IMG/M |
| 3300001199|J055_10033754 | All Organisms → cellular organisms → Bacteria | 2349 | Open in IMG/M |
| 3300003324|soilH2_10079838 | All Organisms → cellular organisms → Bacteria | 3278 | Open in IMG/M |
| 3300003998|Ga0055472_10298184 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300004157|Ga0062590_100037329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2547 | Open in IMG/M |
| 3300004463|Ga0063356_100543598 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300004463|Ga0063356_102760859 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300004463|Ga0063356_105638279 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300004479|Ga0062595_101543349 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300004782|Ga0062382_10291349 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300005294|Ga0065705_11021098 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005295|Ga0065707_10830263 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005334|Ga0068869_100242332 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300005338|Ga0068868_101530162 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
| 3300005353|Ga0070669_101416855 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005356|Ga0070674_100824796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 803 | Open in IMG/M |
| 3300005366|Ga0070659_101122415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 693 | Open in IMG/M |
| 3300005444|Ga0070694_101766295 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300005547|Ga0070693_101595829 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005836|Ga0074470_10472720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1208 | Open in IMG/M |
| 3300005844|Ga0068862_102010359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 589 | Open in IMG/M |
| 3300006175|Ga0070712_101717695 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300006755|Ga0079222_11209155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 678 | Open in IMG/M |
| 3300006844|Ga0075428_100043999 | All Organisms → cellular organisms → Bacteria | 4908 | Open in IMG/M |
| 3300006844|Ga0075428_100552122 | Not Available | 1231 | Open in IMG/M |
| 3300006845|Ga0075421_100292409 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
| 3300006845|Ga0075421_102115055 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300006852|Ga0075433_11347760 | Not Available | 618 | Open in IMG/M |
| 3300006854|Ga0075425_102269848 | Not Available | 604 | Open in IMG/M |
| 3300006914|Ga0075436_100402326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 992 | Open in IMG/M |
| 3300006930|Ga0079303_10238511 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300007004|Ga0079218_11449363 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300007076|Ga0075435_100054007 | All Organisms → cellular organisms → Bacteria | 3242 | Open in IMG/M |
| 3300009012|Ga0066710_101131201 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300009053|Ga0105095_10155201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1250 | Open in IMG/M |
| 3300009094|Ga0111539_12841227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300009147|Ga0114129_10410023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1784 | Open in IMG/M |
| 3300009147|Ga0114129_12529412 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300009156|Ga0111538_11345293 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300009156|Ga0111538_11541785 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300009167|Ga0113563_13011146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300009296|Ga0103681_1076330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1650 | Open in IMG/M |
| 3300009553|Ga0105249_12257196 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300009777|Ga0105164_10574730 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300009789|Ga0126307_11562203 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
| 3300009792|Ga0126374_10359003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1002 | Open in IMG/M |
| 3300010043|Ga0126380_11586050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300010166|Ga0126306_11528094 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300010358|Ga0126370_10670286 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300010359|Ga0126376_11311124 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300010375|Ga0105239_10092365 | All Organisms → cellular organisms → Bacteria | 3341 | Open in IMG/M |
| 3300010376|Ga0126381_104486703 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300010400|Ga0134122_10622341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1001 | Open in IMG/M |
| 3300010401|Ga0134121_12185554 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300011400|Ga0137312_1103872 | Not Available | 504 | Open in IMG/M |
| 3300011415|Ga0137325_1069116 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300011437|Ga0137429_1076126 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300012159|Ga0137344_1096948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 545 | Open in IMG/M |
| 3300012207|Ga0137381_10856262 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300012209|Ga0137379_10937706 | Not Available | 770 | Open in IMG/M |
| 3300012353|Ga0137367_10012477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6761 | Open in IMG/M |
| 3300012354|Ga0137366_10662436 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300012360|Ga0137375_10793133 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300012685|Ga0137397_11138865 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300012931|Ga0153915_11472479 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300012931|Ga0153915_11823593 | Not Available | 712 | Open in IMG/M |
| 3300012957|Ga0164303_10848403 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300014265|Ga0075314_1064574 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300014865|Ga0180078_1089194 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300014868|Ga0180088_1009325 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300014870|Ga0180080_1018189 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300014877|Ga0180074_1068852 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300015241|Ga0137418_10208021 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300015245|Ga0137409_11325843 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300015359|Ga0134085_10501671 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300015371|Ga0132258_11304248 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
| 3300015374|Ga0132255_104333506 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300016371|Ga0182034_10232316 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
| 3300016371|Ga0182034_11219412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 655 | Open in IMG/M |
| 3300016387|Ga0182040_11464273 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300016422|Ga0182039_10412452 | Not Available | 1149 | Open in IMG/M |
| 3300016445|Ga0182038_10729917 | Not Available | 864 | Open in IMG/M |
| 3300017939|Ga0187775_10019515 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300018053|Ga0184626_10149297 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300018056|Ga0184623_10010010 | All Organisms → cellular organisms → Bacteria | 4079 | Open in IMG/M |
| 3300018056|Ga0184623_10257399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
| 3300018061|Ga0184619_10077207 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300018063|Ga0184637_10176624 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300018076|Ga0184609_10085722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1398 | Open in IMG/M |
| 3300018079|Ga0184627_10249591 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300018081|Ga0184625_10018186 | All Organisms → cellular organisms → Bacteria | 3329 | Open in IMG/M |
| 3300018083|Ga0184628_10048876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2132 | Open in IMG/M |
| 3300018429|Ga0190272_10060446 | All Organisms → cellular organisms → Bacteria | 2245 | Open in IMG/M |
| 3300018429|Ga0190272_10976037 | Not Available | 805 | Open in IMG/M |
| 3300018469|Ga0190270_13195500 | Not Available | 519 | Open in IMG/M |
| 3300020018|Ga0193721_1050229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1097 | Open in IMG/M |
| 3300020061|Ga0193716_1243060 | Not Available | 653 | Open in IMG/M |
| 3300020084|Ga0194110_10369829 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300020197|Ga0194128_10290394 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300021090|Ga0210377_10025852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4245 | Open in IMG/M |
| 3300025160|Ga0209109_10159766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1130 | Open in IMG/M |
| 3300025313|Ga0209431_10288797 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300025319|Ga0209520_10654258 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300025324|Ga0209640_10316997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1300 | Open in IMG/M |
| 3300025903|Ga0207680_10929973 | Not Available | 623 | Open in IMG/M |
| 3300025905|Ga0207685_10868855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300025913|Ga0207695_10412042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1236 | Open in IMG/M |
| 3300025915|Ga0207693_11248413 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300025922|Ga0207646_10780842 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 851 | Open in IMG/M |
| 3300025925|Ga0207650_10097147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2261 | Open in IMG/M |
| 3300025931|Ga0207644_11547136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 556 | Open in IMG/M |
| 3300025937|Ga0207669_10155013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1610 | Open in IMG/M |
| 3300025938|Ga0207704_11517958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 575 | Open in IMG/M |
| 3300025960|Ga0207651_10274771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1389 | Open in IMG/M |
| 3300026529|Ga0209806_1154866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 868 | Open in IMG/M |
| 3300027462|Ga0210000_1052386 | Not Available | 656 | Open in IMG/M |
| 3300027577|Ga0209874_1129617 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300027637|Ga0209818_1210439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300027722|Ga0209819_10028413 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1881 | Open in IMG/M |
| 3300027815|Ga0209726_10518199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300027831|Ga0209797_10140063 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300027979|Ga0209705_10375428 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10118246 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| (restricted) 3300031237|Ga0255334_1036336 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031538|Ga0310888_10262559 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300031716|Ga0310813_10298327 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300031716|Ga0310813_10443888 | Not Available | 1124 | Open in IMG/M |
| 3300031720|Ga0307469_10305974 | Not Available | 1312 | Open in IMG/M |
| 3300031854|Ga0310904_10617079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 742 | Open in IMG/M |
| 3300031854|Ga0310904_10838825 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300031901|Ga0307406_10099203 | All Organisms → cellular organisms → Bacteria | 1980 | Open in IMG/M |
| 3300031901|Ga0307406_12049025 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031962|Ga0307479_11432886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300032126|Ga0307415_100214846 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300032157|Ga0315912_11311386 | Not Available | 572 | Open in IMG/M |
| 3300032211|Ga0310896_10700205 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300032261|Ga0306920_100580431 | Not Available | 1660 | Open in IMG/M |
| 3300032421|Ga0310812_10460818 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300033289|Ga0310914_10362262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1311 | Open in IMG/M |
| 3300033289|Ga0310914_10443741 | Not Available | 1175 | Open in IMG/M |
| 3300033408|Ga0316605_11765588 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300033485|Ga0316626_11191840 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300033814|Ga0364930_0237753 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300034115|Ga0364945_0011074 | All Organisms → cellular organisms → Bacteria | 2317 | Open in IMG/M |
| 3300034354|Ga0364943_0144103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 856 | Open in IMG/M |
| 3300034354|Ga0364943_0417106 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300034417|Ga0364941_043820 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.05% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.77% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.13% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.21% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 3.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.56% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.92% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.92% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.28% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.28% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.28% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.28% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.28% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.28% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.28% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.28% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.28% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.28% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.64% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.64% |
| Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 0.64% |
| Groundwater | Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater | 0.64% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.64% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.64% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.64% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.64% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.64% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.64% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.64% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.64% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300001199 | Lotic microbial communities from nuclear landfill site in Hanford, Washington, USA - IFRC combined assembly | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009296 | Microbial communities from groundwater in Rifle, Colorado, USA-3A_0.2um | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
| 3300014865 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D | Environmental | Open in IMG/M |
| 3300014868 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10D | Environmental | Open in IMG/M |
| 3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031237 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_35cm_T3_129 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034417 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_05598430 | 2170459013 | Grass Soil | RKGLEFVIAQTAKSNPKAKGQTPESLHLLEPNVLEEIRRSGFIDKVKK |
| INPhiseqgaiiFebDRAFT_1018117711 | 3300000364 | Soil | VIEQVARENPKAKGQTPESLGLLEPSILDEIKKSGFIEKLKH* |
| JGI1027J11758_119606372 | 3300000789 | Soil | LELVIEQVAKENTKAKGQTPESLKLMEPSVLEEIKRSGFLEKFKS* |
| JGI10220J13317_103686671 | 3300001139 | Soil | ELVIEQVALENPKAKGQSPESLGLLESSILDEIKRSGFLEKLKR* |
| J055_100337542 | 3300001199 | Lotic | MWGERSRHAEVARTNPKARGQTPESLKLLEPSILEEIKKSGFVEKVK* |
| soilH2_100798384 | 3300003324 | Sugarcane Root And Bulk Soil | AVIQQLARSVPNARNQTPETLRVFEPSLLDELKRSGFTDSARK* |
| Ga0055472_102981841 | 3300003998 | Natural And Restored Wetlands | GILSLPDRRGLELVIEQVARENSKAKGQTPESLGLLEPSILDEIKRSGFIEQLKR* |
| Ga0062590_1000373291 | 3300004157 | Soil | RKGLEFIISQVAATNAKAKGQTPESLRLLDGSVLEEIKKSGFIEKFKK* |
| Ga0063356_1005435983 | 3300004463 | Arabidopsis Thaliana Rhizosphere | KGLEFILSQLVATHPKAKGQTPESLRLLDSSVLDEIKKSGFIDKFKKS* |
| Ga0063356_1027608592 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VTVMPDRKGLEFILSQLVPTNPKAKGQTPESLRLLDSSVLDEIKKSGFIEKFKR* |
| Ga0063356_1056382792 | 3300004463 | Arabidopsis Thaliana Rhizosphere | GEGVLTLPDRRGLEFVIADTAKTNPKAKGQTPESLRVLDGSVLEEIKKSGFVEKVKG* |
| Ga0062595_1015433492 | 3300004479 | Soil | FILAQLVSTTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKLKR* |
| Ga0062382_102913491 | 3300004782 | Wetland Sediment | PDRKGLEFILAQVAKENPKAKGQTPESLRLLDSSVLDEIRKSGFIDKFKK* |
| Ga0062381_102439952 | 3300004808 | Wetland Sediment | HAEGLVAMPDRKGVELVIAQMAKINPKAKGQSVESLRVLDSSILDELKKSGFIDKLRR* |
| Ga0065705_110210982 | 3300005294 | Switchgrass Rhizosphere | VIRQLAKTNPKVKGQTPETLRVFEPSILEEIKKSGFIDKVRK* |
| Ga0065707_108302632 | 3300005295 | Switchgrass Rhizosphere | TLPDRKGIEFVIADTTKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIEKVKG* |
| Ga0068869_1002423322 | 3300005334 | Miscanthus Rhizosphere | MVMPDRKGLEFILSQVAATTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKFKR* |
| Ga0068868_1015301622 | 3300005338 | Miscanthus Rhizosphere | LVIEQVALENPKAKGQSPESLGLLESSILDEIKRSGFLEKLKR* |
| Ga0070669_1014168552 | 3300005353 | Switchgrass Rhizosphere | VMVLPDRKGLEFIISQVATTNPKAKGQTPESLRLLDGSVLEEIKKGGFIDKFKK* |
| Ga0070674_1008247962 | 3300005356 | Miscanthus Rhizosphere | IGQLAKTNPKAKGQTPETLRVFEPNILEEIKKSGFIDKVRK* |
| Ga0070659_1011224152 | 3300005366 | Corn Rhizosphere | DLLSMPDRRGVELVIGQLAKTNPKAKGQTPETLRVFEPNILEEIKKSGFIDKVRK* |
| Ga0070694_1017662951 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AEGLVVMPDRKGVDLVIAQMAKSNPKAKGQTIESLKVLDSSILDYLKKSGFIDKLRS* |
| Ga0070693_1015958292 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VARHGDGILSLPDRRGLELVIEQVALENPKAKGQSPESLGLLESSILDEIKRSGFLEKLKR* |
| Ga0074470_104727203 | 3300005836 | Sediment (Intertidal) | MPDRKEVDLVIAEMAKSNPKARGQTIESLRVLDSSIVDEAKKSGFIENARK* |
| Ga0068870_106855061 | 3300005840 | Miscanthus Rhizosphere | GKHAEDLLSMPDRRGVELVIRQLAKTNPKAKGQTPETLRVFEPSILEEIKKSGFIDKARK |
| Ga0068862_1020103591 | 3300005844 | Switchgrass Rhizosphere | GLLNMPDRKGVELVINQLARTNPKAKGQTPESLRVFEPSILDELRKSGFIDKARR* |
| Ga0070712_1017176952 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PERKGLEFILAQLVSTTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKLKR* |
| Ga0079222_112091553 | 3300006755 | Agricultural Soil | VEAVIQQLARSNPNARGQTPETLRVFEPSLLDDLKRSGFIDSARK* |
| Ga0075428_1000439997 | 3300006844 | Populus Rhizosphere | EFILSQVATTTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKFKR* |
| Ga0075428_1005521221 | 3300006844 | Populus Rhizosphere | EFILSQVATTTPKAKGQTPESLRLLDSSVLDEIKKSGFIEKFKR* |
| Ga0075421_1002924093 | 3300006845 | Populus Rhizosphere | KGLELVIAQTAKTNPKAKGQTPESLRLMDASILEEIKKSGFVDKLKR* |
| Ga0075421_1021150552 | 3300006845 | Populus Rhizosphere | LTRHGEGILTLPDRKGLEFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIEKVKG* |
| Ga0075433_113477602 | 3300006852 | Populus Rhizosphere | MDRMGLEFVIAQTAKSNPKAKGQTFESLHLLEPTVLEEISSGFIDKVKK* |
| Ga0075425_1022698481 | 3300006854 | Populus Rhizosphere | EQVARENPKAKGQTPESLGLLEPSILDEIKRTGFLERFKQ* |
| Ga0075436_1004023261 | 3300006914 | Populus Rhizosphere | LARTNPKAKGQTPETLRVFEPGLLDEIKKSGFIDRLRK* |
| Ga0079303_102385111 | 3300006930 | Deep Subsurface | GDGVMVMPDRKGIEFILGQVAKDNPKAKGQTPESLRLLDGSVLDEIRKSGFIDKFKK* |
| Ga0079218_114493632 | 3300007004 | Agricultural Soil | LEFIISQVATTNPKAKGQTPESLKLLDGSVLEEVKKSGFIDKFKK* |
| Ga0075435_1000540074 | 3300007076 | Populus Rhizosphere | DLLSMPDRRGVELVIRQLAKTNPKAKGQTPETLRVFEPSILEEIKKSGFIDKARK* |
| Ga0066710_1011312012 | 3300009012 | Grasslands Soil | LPDRRGLELVIEQVARENPKAKGQSPESLGLLEPSILDEIKRSGFLEKLKR |
| Ga0105095_101552013 | 3300009053 | Freshwater Sediment | HGEGVLTLPDRKGLEFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIEKVKG* |
| Ga0111539_128412271 | 3300009094 | Populus Rhizosphere | ILSLPDRRGLELVIEQVARENPKAKGQTPESLGLLEPSILDEIKRSGFLEKLKR* |
| Ga0114129_104100234 | 3300009147 | Populus Rhizosphere | LTLPDRKGIEFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIEKVKG* |
| Ga0114129_125294121 | 3300009147 | Populus Rhizosphere | YLTRHGEGILTLPDRKGLEFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIEKVKG* |
| Ga0111538_113452932 | 3300009156 | Populus Rhizosphere | DGVMVLPDRKGLEFIISQVATTNSKAKGQTPESLRLLDGSVLEEIKKGGFIDKFKK* |
| Ga0111538_115417851 | 3300009156 | Populus Rhizosphere | MVLPDRKGLEFIISQVALTNAKAKGQTPESLRLLDGSVLEEIKKSGFFDKFK* |
| Ga0113563_130111462 | 3300009167 | Freshwater Wetlands | VDLVIAQMAKSNPKAKGQTIESLKVLDSSILDYLKKSGFIDKLRS* |
| Ga0103681_10763302 | 3300009296 | Groundwater | FVISQLAQENPKARGQTPESIGLLEASILEEIKKSGFVEKLLQH* |
| Ga0105249_122571961 | 3300009553 | Switchgrass Rhizosphere | DRKGLEFILSQVAATTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKFKR* |
| Ga0105164_105747302 | 3300009777 | Wastewater | EMVIAQVAKTTPKAQGQTPESLRLLEPSILEEIKKSGFVEKVK* |
| Ga0126307_115622032 | 3300009789 | Serpentine Soil | QLAKTNAKAKGQTVESLRVMEPSILDELKKTGFIDKVRK* |
| Ga0126374_103590031 | 3300009792 | Tropical Forest Soil | GILTLPDRKGIEFVIADTAKTNPKAKGQTPESLRVLDASVLDEIKKSGFIEKVKG* |
| Ga0126380_115860502 | 3300010043 | Tropical Forest Soil | IEQVARENPRAKGQTPESLGLLEPSILDEIKKSGFIEKLKR* |
| Ga0126306_115280941 | 3300010166 | Serpentine Soil | RKGIEFILGQVAKENPKAKGQTPESLRLLDSSVLDEIRKSGFIDKFKK* |
| Ga0126370_106702861 | 3300010358 | Tropical Forest Soil | PERRGLELVIEQVARENPKAKGQTPESLGLLEPSILEEIKKSGFIEKLKR* |
| Ga0126376_113111241 | 3300010359 | Tropical Forest Soil | IVDTTKTNAKAKGQTPESLRVLDGSVLDEIKKSGFLKKVKG* |
| Ga0105239_100923654 | 3300010375 | Corn Rhizosphere | LLSMPDRRGVELVIRQLAKTNPKAKGQTPETLRVFEPNILEEIKKSGFIDKVRK* |
| Ga0126381_1044867032 | 3300010376 | Tropical Forest Soil | LELVIEQVARENPRAKGQTPESLGLLEPSILDEIKKSGFIEELKR* |
| Ga0134122_102945761 | 3300010400 | Terrestrial Soil | LLSMPDRRGVELVIGQLAKTNPKAKGQTPETLRVFEPSILEEIKKSGFIDKARKYFLPASICSAC* |
| Ga0134122_106223412 | 3300010400 | Terrestrial Soil | ELVIRQLAKTNPKAKGQTPETLRVFEPSILEEIKKSGFIDKVRK* |
| Ga0134121_121855542 | 3300010401 | Terrestrial Soil | ARHGDGILNLPARRGLELVIEQVARENPKANGQSPESLRLLEPSVLAEIRNSGFIEKLKQ |
| Ga0137312_11038721 | 3300011400 | Soil | NPKAKGQTPESLRLLDSSVLDEIRKSGFIDKFKK* |
| Ga0137325_10691163 | 3300011415 | Soil | IADTAKTNPKAKAQTPDSLRVLDGSVLDEIKKSGFIEKVKG* |
| Ga0137429_10761262 | 3300011437 | Soil | MVLPDRKGLEFIISQVASTNARAKGQTPESLRLLDGSVLDEIKKSGFLDRFK* |
| Ga0137344_10969482 | 3300012159 | Soil | QTAKSNPKAKGQTPESLHLLEPSVLEEIRKSGFIDKVKK* |
| Ga0137381_108562621 | 3300012207 | Vadose Zone Soil | GVLTLPDRKGLEFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIDRVKG* |
| Ga0137379_109377061 | 3300012209 | Vadose Zone Soil | EFVIAQTAKSNPKAKGQTPESLHLLEPSVLEEIRRSGFIDKVKK* |
| Ga0137367_100124771 | 3300012353 | Vadose Zone Soil | PDRKGLEFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIDKVKG* |
| Ga0137366_106624361 | 3300012354 | Vadose Zone Soil | DRKGLEFVIAQTARSNPKAKGQTPESLHLLEPSVLEEIRRSGFIDKVKK* |
| Ga0137375_107931332 | 3300012360 | Vadose Zone Soil | MPDRKGVELVISQLARTNPKAKGQTPETLRVFEPGILDEIKKSGFIEKARK* |
| Ga0137397_111388651 | 3300012685 | Vadose Zone Soil | YLAKYGDGVMVLPDRKGLEFIISQVALTNTKAKGQTPESLRLLDGSVLEEINKSGFFDKFK* |
| Ga0153915_114724792 | 3300012931 | Freshwater Wetlands | PDRKGVEFVIAQLATTNPKAKGQTPETLRVLEPSVLDEIRKSGFIDKLRH* |
| Ga0153915_118235932 | 3300012931 | Freshwater Wetlands | PDRRGLELVIAQSIRTNAKAKGQTPESLRLLEPSILDEIKKSGFVDRLRK* |
| Ga0164303_108484032 | 3300012957 | Soil | MVMPDRKGLEFILSQVAATTPKANGQMPESLRLLDSSVLDEIKKSGFIDKFKR* |
| Ga0075314_10645742 | 3300014265 | Natural And Restored Wetlands | QVARENSKAKGQTPESLGLLEPSILDEIKRSGFIEQLKR* |
| Ga0180078_10891941 | 3300014865 | Soil | KYGEGVMVLPERKGLEFIISQVASTNARAKGQTPESLRLLDGSVLDEIKKSGFLDRFK* |
| Ga0180088_10093254 | 3300014868 | Soil | GDGILTLPDRKGIEFVIADTAKTNPKAKGQTPDSLRVLDGSVLDEIKKSGFIEKVKG* |
| Ga0180080_10181891 | 3300014870 | Soil | NPKAKGQTPESLRLLDGSVLEEIRKSGFIDKFKKS* |
| Ga0180074_10688521 | 3300014877 | Soil | KDNPKAKGQTVESLRLLDGSVLDEIRKSGFIDKFKK* |
| Ga0137418_102080211 | 3300015241 | Vadose Zone Soil | MPDRKGVELVIGQLARTNPKAKGQTPETLRVFEPGLLDEIKKSGFIDKLRK* |
| Ga0137409_113258431 | 3300015245 | Vadose Zone Soil | KGIEFIISQVTLTNAKAKGQTPESLRLLDGSVLEEIKKSGFFDKFK* |
| Ga0134085_105016711 | 3300015359 | Grasslands Soil | NPKAKGQSPESLRLMEPSVLEEIKRSGFLEKFKL* |
| Ga0132258_113042481 | 3300015371 | Arabidopsis Rhizosphere | RGLDFILGQVAKDNPKAKGQTAESLRLLDGSVLDEIRKSGFIDKFKK* |
| Ga0132255_1043335062 | 3300015374 | Arabidopsis Rhizosphere | GVMVLPDRRGLDFILGQVAKDNPKAKGQTPESLRLLDGSVLDEIRKTGFIDKLKK* |
| Ga0182034_102323163 | 3300016371 | Soil | MLTLPDRRGLEFVIADTAKTNAKAKGQTPESLRVLDRSELDEIRKNGFLEKVKG |
| Ga0182034_112194123 | 3300016371 | Soil | GDDLLSLPDRKGLEFVIAQTAKSSPKAKGQTPESLRLLEPSVLEEIKKGGFIDKVKK |
| Ga0182040_114642732 | 3300016387 | Soil | DTAKTNAKAKGQTPESLRVLDRSELDEIRKNGFLEKVKG |
| Ga0182039_104124521 | 3300016422 | Soil | GDDLLSLPDRKGLEFVIAQTAKSNPKAKGQTPESLRLLEPSVLEEIKKGGFIDKVKK |
| Ga0182038_107299173 | 3300016445 | Soil | AKSNPKAKGQTPESLRLLEPSVLEEIKKGGFIDKVKK |
| Ga0187775_100195153 | 3300017939 | Tropical Peatland | VELVIAQLAKTNAKAKGQTVESLRVMEPNILDELKRSGFVDKVRK |
| Ga0184626_101492971 | 3300018053 | Groundwater Sediment | TAKANPKAKGQTPESLRVLDSSVLDEIKKSGFIEKVKG |
| Ga0184623_100100103 | 3300018056 | Groundwater Sediment | VLILPDRKGLEFVIADTAKTNLKAKGQTPESLRILDSSVLDEIKKSGFLEKVKG |
| Ga0184623_102573991 | 3300018056 | Groundwater Sediment | EGLLSMPDRRGVELVIGQLARTNPKAKGQTPETLRVFEPSILDELKKSGFIDKARRS |
| Ga0184619_100772073 | 3300018061 | Groundwater Sediment | QTAKSNPKAKGQTFESLHLLEPTVLEEIRKSGFIDKVKK |
| Ga0184637_101766241 | 3300018063 | Groundwater Sediment | VLILPDRKGLEFVIADTAKTNLKAKGQTPESLRILDSSVLDEIKKSGVLEKVKG |
| Ga0184609_100857221 | 3300018076 | Groundwater Sediment | GVELVIRQLARTNPKAKGQTPETLRVFEPSILDELKTSGFIEKARK |
| Ga0184627_102495912 | 3300018079 | Groundwater Sediment | MWGERSRHAEVARTNPNARGQTPESLRLLEPSVLEEIKRSGFVE |
| Ga0184625_100181861 | 3300018081 | Groundwater Sediment | VAATTPKAKGQTPESLRLLDASVLDEIKKSGFIDKFKR |
| Ga0184628_100488763 | 3300018083 | Groundwater Sediment | LSMPDRKGVELVIAQLAKTNPKAKGQTVESLRVMEPSILDEIKKSWFVDKVRR |
| Ga0190272_100604461 | 3300018429 | Soil | YGDGVMVMPDRKGIEFILGQVAKDNPKAKGQTAESLRLLDGSVLDEIRKSGFIDKFKN |
| Ga0190272_109760371 | 3300018429 | Soil | RSRSLLSMPDRKGVELVIGQLARTTPKAKGQTPETLRVFEPSILEEIKKSGFIEKVRR |
| Ga0190270_131955001 | 3300018469 | Soil | KGVELVIAQLAKTNPKAKGQTVESLRVMEPSILDELKKSGFIDKARK |
| Ga0193713_11559502 | 3300019882 | Soil | LGKHAEGLLSMPDRRGVELVIGQLARTNAKAKGQTPETLRVFEPGLLDEIKKSGFIDRLR |
| Ga0193721_10502292 | 3300020018 | Soil | HAEGLLSMPDRRGVELVIGQLARTNAKAKGQTPETLRVFEPGLLDEIKKSGFIDKLRK |
| Ga0193716_12430601 | 3300020061 | Soil | LTLPDRKGLEFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIEKVKG |
| Ga0194110_103698292 | 3300020084 | Freshwater Lake | MVMPDRKGIEFILGQVAKDNPKAKGQTPESLRLLDGSVLDEIRKSGFIDKFKK |
| Ga0194128_102903941 | 3300020197 | Freshwater Lake | ILGQVAKDNPKAKGQTPESLRLLDGSVLDEIRKSGFIDKFKK |
| Ga0210377_100258525 | 3300021090 | Groundwater Sediment | MPDRRGVELVIGQLARTNPKAKGQTPETLRVFEPSILDEIRKSGFIDRARR |
| Ga0209109_101597662 | 3300025160 | Soil | MPDRRGLELVIAQSIRTNAKAKGQTPESLRLLEPSILDEIKKSGFVEKLRK |
| Ga0209431_102887972 | 3300025313 | Soil | SMPDRRGLDLVIAQSVRTNAKAKGQTPESLRLLEPSILDEIKKSGFVEKLRK |
| Ga0209520_106542581 | 3300025319 | Soil | HADGLLSMPDRRGLELVIAQSVRTNAKAKGQTPESLRLLEPSILDEIKKSGFIERLRR |
| Ga0209640_103169972 | 3300025324 | Soil | MPESKGVELVIAQLAKTNPKAQGQTVESLRVMEPSILDELKKSGFIDRVRK |
| Ga0207680_109299731 | 3300025903 | Switchgrass Rhizosphere | YFLAKHGDGLLVMPERKGLEFILAQLVSTTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKLKR |
| Ga0207685_108688551 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GDGILSLPDRRGLELVIEQVARENPKAKGQTPESLGLLEPSILDEIKKSGFIEKLKR |
| Ga0207695_104120421 | 3300025913 | Corn Rhizosphere | AEDLLSMPDRRGVELVIRQLAKTNPKAKGQTPETLRVFEPNILEEIKKSGFIDKARK |
| Ga0207693_112484132 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | PERKGLEFILAQLVSTTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKLKR |
| Ga0207646_107808423 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TAKTNPKAKGQTPESLRVLDASVLDEIKKSGFIEKVKG |
| Ga0207650_100971471 | 3300025925 | Switchgrass Rhizosphere | DRRGVELVIRQLAKTNPKAKGQSLETLRVFEPSILEEIKNSGFIDKVRK |
| Ga0207644_115471361 | 3300025931 | Switchgrass Rhizosphere | QLAKTNPKAKGQTPETLRVFEPSILEEIKKSGFIDKARK |
| Ga0207669_101550131 | 3300025937 | Miscanthus Rhizosphere | PDRRGVELVIRQLAKTNPKAKGQTPETLRVFEPNILEEIKKSGFIDKVRK |
| Ga0207704_115179581 | 3300025938 | Miscanthus Rhizosphere | KTNPKAKGQTPETLRVFEPSILEEIKKSGFIDKVRK |
| Ga0207651_102747711 | 3300025960 | Switchgrass Rhizosphere | EDLLSMPDRRGVELVIRQLAKTNPKAKGQTPETLRVFEPNILEEIKKSGFIDKARK |
| Ga0207677_111597021 | 3300026023 | Miscanthus Rhizosphere | HAEGLLSMPDRRGVELVIRQLAKTNPKAKGQSLETLRVFEPSILEEIKKSGFIDKARK |
| Ga0209806_11548662 | 3300026529 | Soil | GVELVIGQLARTNAKAKGQTPETLRVFEPGLLDEIKKSGFIDRLRK |
| Ga0210000_10523862 | 3300027462 | Arabidopsis Thaliana Rhizosphere | DRRGLEFILSQLVPTNPKAKGQTVESLRLLDASVLDEIQKSGFIDKFER |
| Ga0209874_11296172 | 3300027577 | Groundwater Sand | RHGDGILTLPDRKGIDFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIEKVKG |
| Ga0209818_12104392 | 3300027637 | Agricultural Soil | LELVIAQTAKTNPKAKGQTPESLRLMDASVLEEIKKSGFVDKLKR |
| Ga0209819_100284131 | 3300027722 | Freshwater Sediment | DRKGLEFIISQVPNTNPKAKGQTPESLRLLDSSVLDEIKKSGFLDKFKN |
| Ga0209726_105181992 | 3300027815 | Groundwater | KGVEQVIAQLAKTNPKAKGQTVESLRVMEPSILDELKKSGFIDRVRK |
| Ga0209797_101400632 | 3300027831 | Wetland Sediment | VMVMPDRKGIEFILSQVAKDNPKAKGQTPESLRLLDSSVLDEIRKSGFIDKFKK |
| Ga0209705_103754281 | 3300027979 | Freshwater Sediment | VLTLPDRKGLEFVITDTAKTNPKAKGQTPESLRVLDSSVLDEIKKSGVV |
| (restricted) Ga0255310_101182462 | 3300031197 | Sandy Soil | EGVLTLPDRRGLEFVISDTAKTNPKAKGQTPDSLRVLDGSVLDEIKKSGFIEKVKG |
| (restricted) Ga0255334_10363361 | 3300031237 | Sandy Soil | HGEGVLTLPDRRGLEFVISDTAKTNPKAKGQTPDSLRVLDGSVLDEIKKSGFIEKVKG |
| Ga0310888_102625591 | 3300031538 | Soil | RKGLEFIISQVATTNPKAKGQTPESLRLLDGSVLEEIKKGGFIDKFKK |
| Ga0310813_102983271 | 3300031716 | Soil | KGLEFILAQLVSTTPKAKGQTSESLRLLDSSVLDEIKKSGFIDKLKP |
| Ga0310813_104438882 | 3300031716 | Soil | DMLVMPDRKGIEFILSQVVATNAKAKGQTPESLRLLDSSVLDEIKKSGFIDKFKR |
| Ga0307469_103059742 | 3300031720 | Hardwood Forest Soil | IEQVARENPKAKGQTPESLGLLEPSILDEIKKSGFIEKLKR |
| Ga0310904_106170792 | 3300031854 | Soil | VIGQLARTNPKAKGQTPETLRVFEPSILDELKKSGFIDKARRS |
| Ga0310904_108388252 | 3300031854 | Soil | EFILSQVAATTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKFKR |
| Ga0307406_100992031 | 3300031901 | Rhizosphere | VMPDRRGIEFILAQVAKENPKAKGQTPESLRLLDSSVLDEIRKSGFIDKFKK |
| Ga0307406_120490252 | 3300031901 | Rhizosphere | ATNAKAKGQTPESLRLLDGSVLEEIKKSGFIDKFKK |
| Ga0307479_114328861 | 3300031962 | Hardwood Forest Soil | VIEQVARENPKAKGQTPESLGLLEPSILDEIKKSGFIEKLKR |
| Ga0310902_106330302 | 3300032012 | Soil | HAEGLLSMPDRKGVELVIAQLAKTNAKAKGQTLESLRVMEPSILDELKKSGFIDKARK |
| Ga0307415_1002148462 | 3300032126 | Rhizosphere | RKGIEFILTQIAKENPKAKGQTAESLRLLDGSVLDEIRRSGFIDKFKK |
| Ga0315912_113113862 | 3300032157 | Soil | SMPDRKGVELVIGQLARTNPKAKGQTPEMLRVFEPSILDEIRKSGFIDKIRR |
| Ga0310896_107002052 | 3300032211 | Soil | EFILSQLVPTNPKAKGQTPESLRLLDGSVLDEIRKSGFIDKFKK |
| Ga0306920_1005804314 | 3300032261 | Soil | GLEFVIAQTAKSNPKAKGQTPESLRLLEPSVLEEIKKGGFIDKVKK |
| Ga0310812_104608182 | 3300032421 | Soil | MPERKGLEFILAQLVSTTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKLKR |
| Ga0310914_103622624 | 3300033289 | Soil | KTNAKAKGQTPESLRVLDRSELDEIRKNGFLEKVKG |
| Ga0310914_104437411 | 3300033289 | Soil | DLLSLPDRKGLEFVIAQTAKSNPKAKGQTPESLRLLEPSVLEEIKKGGFIDKVKK |
| Ga0316605_117655881 | 3300033408 | Soil | ILGQVAKENPKAKGQTPESLRLLDSSVLDEIRKSGFIDKFKK |
| Ga0316626_111918401 | 3300033485 | Soil | VSTNPKAKGQTPESLRLLDASVLDEIKKSGFIDKFQK |
| Ga0364930_0237753_2_136 | 3300033814 | Sediment | EFVIADTAKTNPKAKGQTPESLRVLDGSVLEEIKKSGFIEKVKG |
| Ga0364945_0011074_9_194 | 3300034115 | Sediment | LAKYGDDLLSLPDRKGLEFVIAQTAKSNPKAKGQTPESLHLLEPSVLEEIRKSGFIDKVK |
| Ga0364943_0144103_3_155 | 3300034354 | Sediment | PDRKGVELVIAQLAKTNPKAKGQTVESLRVMEPSILDEIKKIGFVDKVRR |
| Ga0364943_0417106_337_492 | 3300034354 | Sediment | MPDRKGVELVINQVAKTNPKAKGQTPESLRVFEPSILDELKKSGFIDKARR |
| Ga0364941_043820_1_144 | 3300034417 | Sediment | KGLEFIISQVAFTNAKAKGQTPESLRLLDGSVLDEIKKSGFLDKFKK |
| ⦗Top⦘ |