


| Basic Information | |
|---|---|
| Family ID | F043434 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 156 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFLRG |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 156 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 67.95 % |
| % of genes near scaffold ends (potentially truncated) | 58.97 % |
| % of genes from short scaffolds (< 2000 bps) | 60.26 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.769 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (37.179 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.564 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.308 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 55.56% Coil/Unstructured: 44.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 156 Family Scaffolds |
|---|---|---|
| PF12705 | PDDEXK_1 | 3.85 |
| PF01844 | HNH | 3.85 |
| PF07486 | Hydrolase_2 | 2.56 |
| PF11953 | DUF3470 | 2.56 |
| PF02348 | CTP_transf_3 | 1.92 |
| PF00959 | Phage_lysozyme | 1.92 |
| PF00487 | FA_desaturase | 1.92 |
| PF10544 | T5orf172 | 1.28 |
| PF04055 | Radical_SAM | 1.28 |
| PF00383 | dCMP_cyt_deam_1 | 1.28 |
| PF03332 | PMM | 1.28 |
| PF00574 | CLP_protease | 1.28 |
| PF05996 | Fe_bilin_red | 1.28 |
| PF08291 | Peptidase_M15_3 | 1.28 |
| PF08241 | Methyltransf_11 | 1.28 |
| PF11753 | DUF3310 | 1.28 |
| PF00881 | Nitroreductase | 1.28 |
| PF05433 | Rick_17kDa_Anti | 1.28 |
| PF13609 | Porin_4 | 0.64 |
| PF00478 | IMPDH | 0.64 |
| PF14572 | Pribosyl_synth | 0.64 |
| PF06841 | Phage_T4_gp19 | 0.64 |
| PF01050 | MannoseP_isomer | 0.64 |
| PF14220 | DUF4329 | 0.64 |
| PF05050 | Methyltransf_21 | 0.64 |
| PF00984 | UDPG_MGDP_dh | 0.64 |
| PF03417 | AAT | 0.64 |
| PF06808 | DctM | 0.64 |
| PF01471 | PG_binding_1 | 0.64 |
| PF01467 | CTP_transf_like | 0.64 |
| PF01521 | Fe-S_biosyn | 0.64 |
| PF16075 | DUF4815 | 0.64 |
| PF00268 | Ribonuc_red_sm | 0.64 |
| PF02622 | DUF179 | 0.64 |
| PF13550 | Phage-tail_3 | 0.64 |
| PF01503 | PRA-PH | 0.64 |
| PF00753 | Lactamase_B | 0.64 |
| PF01370 | Epimerase | 0.64 |
| PF08443 | RimK | 0.64 |
| PF00565 | SNase | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 156 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 2.56 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 2.56 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 2.56 |
| COG1083 | CMP-N-acetylneuraminic acid synthetase, NeuA/PseF family | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG1212 | CMP-2-keto-3-deoxyoctulosonic acid synthetase | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 1.92 |
| COG1861 | Spore coat polysaccharide biosynthesis protein SpsF, cytidylyltransferase family | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 1.92 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 1.28 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.28 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.64 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.64 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
| COG1678 | Putative transcriptional regulator, AlgH/UPF0301 family | Transcription [K] | 0.64 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.64 |
| COG4927 | Predicted choloylglycine hydrolase | General function prediction only [R] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.77 % |
| All Organisms | root | All Organisms | 44.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10059303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 1619 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10125298 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10083917 | All Organisms → Viruses → Predicted Viral | 1229 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10125680 | Not Available | 887 | Open in IMG/M |
| 3300001344|JGI20152J14361_10013843 | All Organisms → Viruses → Predicted Viral | 3294 | Open in IMG/M |
| 3300001589|JGI24005J15628_10222706 | Not Available | 514 | Open in IMG/M |
| 3300003264|JGI26119J46589_1002020 | All Organisms → cellular organisms → Bacteria | 2904 | Open in IMG/M |
| 3300003516|Antartic2_1252432 | Not Available | 588 | Open in IMG/M |
| 3300004097|Ga0055584_101376525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 734 | Open in IMG/M |
| 3300004461|Ga0066223_1014125 | Not Available | 5166 | Open in IMG/M |
| 3300005731|Ga0076919_1004602 | All Organisms → Viruses → Predicted Viral | 1587 | Open in IMG/M |
| 3300005941|Ga0070743_10010685 | Not Available | 3237 | Open in IMG/M |
| 3300005942|Ga0070742_10025666 | Not Available | 1572 | Open in IMG/M |
| 3300006025|Ga0075474_10009720 | All Organisms → cellular organisms → Bacteria | 3699 | Open in IMG/M |
| 3300006025|Ga0075474_10063720 | All Organisms → Viruses → Predicted Viral | 1227 | Open in IMG/M |
| 3300006025|Ga0075474_10082173 | All Organisms → Viruses → Predicted Viral | 1055 | Open in IMG/M |
| 3300006025|Ga0075474_10247583 | Not Available | 537 | Open in IMG/M |
| 3300006027|Ga0075462_10001878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6842 | Open in IMG/M |
| 3300006357|Ga0075502_1551887 | Not Available | 1114 | Open in IMG/M |
| 3300006400|Ga0075503_1554692 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium TMED149 | 840 | Open in IMG/M |
| 3300006637|Ga0075461_10188570 | Not Available | 620 | Open in IMG/M |
| 3300006802|Ga0070749_10029109 | Not Available | 3459 | Open in IMG/M |
| 3300006802|Ga0070749_10056662 | All Organisms → cellular organisms → Bacteria | 2372 | Open in IMG/M |
| 3300006802|Ga0070749_10067497 | Not Available | 2149 | Open in IMG/M |
| 3300006802|Ga0070749_10142867 | All Organisms → Viruses → Predicted Viral | 1395 | Open in IMG/M |
| 3300006802|Ga0070749_10195948 | Not Available | 1159 | Open in IMG/M |
| 3300006802|Ga0070749_10219946 | Not Available | 1083 | Open in IMG/M |
| 3300006802|Ga0070749_10464070 | Not Available | 693 | Open in IMG/M |
| 3300006810|Ga0070754_10171288 | Not Available | 1026 | Open in IMG/M |
| 3300006867|Ga0075476_10154969 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 853 | Open in IMG/M |
| 3300006868|Ga0075481_10038704 | All Organisms → Viruses → Predicted Viral | 1847 | Open in IMG/M |
| 3300006868|Ga0075481_10326300 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300006874|Ga0075475_10069447 | Not Available | 1630 | Open in IMG/M |
| 3300006874|Ga0075475_10151940 | Not Available | 1015 | Open in IMG/M |
| 3300006916|Ga0070750_10175168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 961 | Open in IMG/M |
| 3300006916|Ga0070750_10336966 | Not Available | 639 | Open in IMG/M |
| 3300006916|Ga0070750_10348035 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300006916|Ga0070750_10417526 | Not Available | 558 | Open in IMG/M |
| 3300006919|Ga0070746_10087015 | All Organisms → Viruses → Predicted Viral | 1573 | Open in IMG/M |
| 3300006919|Ga0070746_10102818 | Not Available | 1423 | Open in IMG/M |
| 3300007234|Ga0075460_10079240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 1199 | Open in IMG/M |
| 3300007344|Ga0070745_1042679 | Not Available | 1898 | Open in IMG/M |
| 3300007344|Ga0070745_1165856 | Not Available | 830 | Open in IMG/M |
| 3300007346|Ga0070753_1018210 | Not Available | 3156 | Open in IMG/M |
| 3300007346|Ga0070753_1108716 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 1076 | Open in IMG/M |
| 3300007346|Ga0070753_1305271 | Not Available | 568 | Open in IMG/M |
| 3300007514|Ga0105020_1007261 | Not Available | 12063 | Open in IMG/M |
| 3300007539|Ga0099849_1131265 | Not Available | 980 | Open in IMG/M |
| 3300007541|Ga0099848_1008377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4619 | Open in IMG/M |
| 3300007542|Ga0099846_1024734 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
| 3300007640|Ga0070751_1054949 | Not Available | 1734 | Open in IMG/M |
| 3300007778|Ga0102954_1196876 | Not Available | 590 | Open in IMG/M |
| 3300007960|Ga0099850_1126404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1041 | Open in IMG/M |
| 3300008012|Ga0075480_10173855 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300008963|Ga0102930_1000946 | Not Available | 9654 | Open in IMG/M |
| 3300009000|Ga0102960_1196316 | Not Available | 720 | Open in IMG/M |
| 3300009001|Ga0102963_1209609 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 776 | Open in IMG/M |
| 3300009054|Ga0102826_1099496 | Not Available | 693 | Open in IMG/M |
| 3300009059|Ga0102830_1243711 | Not Available | 525 | Open in IMG/M |
| 3300009071|Ga0115566_10008233 | Not Available | 8059 | Open in IMG/M |
| 3300009071|Ga0115566_10015516 | Not Available | 5670 | Open in IMG/M |
| 3300009071|Ga0115566_10050131 | Not Available | 2840 | Open in IMG/M |
| 3300009080|Ga0102815_10045033 | Not Available | 2419 | Open in IMG/M |
| 3300009497|Ga0115569_10458166 | Not Available | 544 | Open in IMG/M |
| 3300009498|Ga0115568_10001436 | Not Available | 17122 | Open in IMG/M |
| 3300009507|Ga0115572_10660046 | Not Available | 573 | Open in IMG/M |
| 3300009619|Ga0105236_1011140 | Not Available | 962 | Open in IMG/M |
| 3300016732|Ga0182057_1357158 | Not Available | 603 | Open in IMG/M |
| 3300016732|Ga0182057_1535959 | Not Available | 763 | Open in IMG/M |
| 3300017818|Ga0181565_10037969 | All Organisms → Viruses → Predicted Viral | 3523 | Open in IMG/M |
| 3300017818|Ga0181565_10047796 | Not Available | 3099 | Open in IMG/M |
| 3300017818|Ga0181565_10060087 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2731 | Open in IMG/M |
| 3300017818|Ga0181565_10258850 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1179 | Open in IMG/M |
| 3300017949|Ga0181584_10003883 | Not Available | 11361 | Open in IMG/M |
| 3300017949|Ga0181584_10004673 | Not Available | 10362 | Open in IMG/M |
| 3300017950|Ga0181607_10007693 | All Organisms → cellular organisms → Bacteria | 8930 | Open in IMG/M |
| 3300017950|Ga0181607_10339616 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300017951|Ga0181577_10213399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Tenericutes → Mollicutes → Acholeplasmatales → Acholeplasmataceae → unclassified Acholeplasmataceae → Acholeplasmataceae bacterium | 1284 | Open in IMG/M |
| 3300017952|Ga0181583_10452142 | Not Available | 792 | Open in IMG/M |
| 3300017956|Ga0181580_10914547 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 547 | Open in IMG/M |
| 3300017957|Ga0181571_10058039 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 2679 | Open in IMG/M |
| 3300017957|Ga0181571_10870856 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300017958|Ga0181582_10074221 | Not Available | 2508 | Open in IMG/M |
| 3300017967|Ga0181590_10120186 | Not Available | 2035 | Open in IMG/M |
| 3300017985|Ga0181576_10016490 | All Organisms → cellular organisms → Bacteria | 5150 | Open in IMG/M |
| 3300017986|Ga0181569_10386496 | Not Available | 959 | Open in IMG/M |
| 3300018041|Ga0181601_10682240 | Not Available | 519 | Open in IMG/M |
| 3300018049|Ga0181572_10312896 | Not Available | 996 | Open in IMG/M |
| 3300018416|Ga0181553_10028528 | All Organisms → Viruses → Predicted Viral | 3990 | Open in IMG/M |
| 3300018421|Ga0181592_10374798 | Not Available | 1011 | Open in IMG/M |
| 3300018423|Ga0181593_10804389 | Not Available | 658 | Open in IMG/M |
| 3300018424|Ga0181591_10028382 | Not Available | 4780 | Open in IMG/M |
| 3300019272|Ga0182059_1573513 | Not Available | 775 | Open in IMG/M |
| 3300019272|Ga0182059_1749004 | Not Available | 767 | Open in IMG/M |
| 3300019756|Ga0194023_1007330 | All Organisms → Viruses → Predicted Viral | 2212 | Open in IMG/M |
| 3300020053|Ga0181595_10131832 | Not Available | 1174 | Open in IMG/M |
| 3300020055|Ga0181575_10001758 | Not Available | 15545 | Open in IMG/M |
| 3300020056|Ga0181574_10003910 | Not Available | 13054 | Open in IMG/M |
| 3300020177|Ga0181596_10241814 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300020207|Ga0181570_10051882 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 2430 | Open in IMG/M |
| 3300020463|Ga0211676_10035768 | Not Available | 3693 | Open in IMG/M |
| 3300020469|Ga0211577_10457846 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 779 | Open in IMG/M |
| 3300021085|Ga0206677_10000058 | Not Available | 89633 | Open in IMG/M |
| 3300021335|Ga0213867_1003092 | All Organisms → cellular organisms → Bacteria | 7256 | Open in IMG/M |
| 3300021335|Ga0213867_1003764 | Not Available | 6569 | Open in IMG/M |
| 3300021356|Ga0213858_10000002 | All Organisms → cellular organisms → Bacteria | 125539 | Open in IMG/M |
| 3300021364|Ga0213859_10245137 | Not Available | 821 | Open in IMG/M |
| 3300021957|Ga0222717_10014401 | All Organisms → cellular organisms → Bacteria | 5401 | Open in IMG/M |
| 3300021958|Ga0222718_10000663 | Not Available | 35241 | Open in IMG/M |
| 3300021958|Ga0222718_10028884 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 3734 | Open in IMG/M |
| 3300021958|Ga0222718_10493774 | Not Available | 593 | Open in IMG/M |
| 3300021959|Ga0222716_10167934 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 | 1417 | Open in IMG/M |
| 3300021960|Ga0222715_10374278 | Not Available | 786 | Open in IMG/M |
| 3300021961|Ga0222714_10024643 | Not Available | 4604 | Open in IMG/M |
| 3300022183|Ga0196891_1023434 | All Organisms → Viruses → Predicted Viral | 1174 | Open in IMG/M |
| 3300022909|Ga0255755_1030059 | All Organisms → Viruses → Predicted Viral | 2937 | Open in IMG/M |
| 3300022921|Ga0255765_1118200 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300022939|Ga0255754_10125137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → unclassified Legionellales → Legionellales bacterium | 1372 | Open in IMG/M |
| 3300023084|Ga0255778_10399605 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300023087|Ga0255774_10033118 | All Organisms → Viruses → Predicted Viral | 3242 | Open in IMG/M |
| 3300023087|Ga0255774_10064056 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 2195 | Open in IMG/M |
| 3300023108|Ga0255784_10013997 | Not Available | 5354 | Open in IMG/M |
| 3300023116|Ga0255751_10080339 | All Organisms → Viruses → Predicted Viral | 2098 | Open in IMG/M |
| 3300023119|Ga0255762_10013733 | Not Available | 5580 | Open in IMG/M |
| 3300023119|Ga0255762_10014944 | All Organisms → cellular organisms → Bacteria | 5309 | Open in IMG/M |
| 3300023119|Ga0255762_10110833 | Not Available | 1628 | Open in IMG/M |
| 3300024301|Ga0233451_10120000 | Not Available | 1263 | Open in IMG/M |
| 3300025151|Ga0209645_1190184 | Not Available | 612 | Open in IMG/M |
| 3300025626|Ga0209716_1021399 | All Organisms → cellular organisms → Bacteria | 2590 | Open in IMG/M |
| 3300025626|Ga0209716_1137509 | Not Available | 647 | Open in IMG/M |
| 3300025630|Ga0208004_1008836 | All Organisms → Viruses → Predicted Viral | 3434 | Open in IMG/M |
| 3300025630|Ga0208004_1082532 | Not Available | 792 | Open in IMG/M |
| 3300025653|Ga0208428_1000486 | Not Available | 18104 | Open in IMG/M |
| 3300025671|Ga0208898_1076420 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 1094 | Open in IMG/M |
| 3300025671|Ga0208898_1111061 | Not Available | 811 | Open in IMG/M |
| 3300025671|Ga0208898_1143492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 655 | Open in IMG/M |
| 3300025687|Ga0208019_1018003 | All Organisms → cellular organisms → Bacteria | 2829 | Open in IMG/M |
| 3300025771|Ga0208427_1016435 | All Organisms → Viruses → Predicted Viral | 2908 | Open in IMG/M |
| 3300025803|Ga0208425_1110766 | Not Available | 634 | Open in IMG/M |
| 3300025818|Ga0208542_1011116 | All Organisms → Viruses → Predicted Viral | 3147 | Open in IMG/M |
| 3300025853|Ga0208645_1270472 | Not Available | 552 | Open in IMG/M |
| 3300025869|Ga0209308_10000362 | Not Available | 45982 | Open in IMG/M |
| 3300025881|Ga0209309_10157881 | All Organisms → Viruses → Predicted Viral | 1141 | Open in IMG/M |
| 3300025889|Ga0208644_1008231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7373 | Open in IMG/M |
| 3300025889|Ga0208644_1008646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7155 | Open in IMG/M |
| 3300025889|Ga0208644_1162672 | Not Available | 1009 | Open in IMG/M |
| 3300026094|Ga0209937_1000792 | Not Available | 9647 | Open in IMG/M |
| 3300027757|Ga0208671_10061130 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1395 | Open in IMG/M |
| 3300028008|Ga0228674_1160913 | Not Available | 742 | Open in IMG/M |
| 3300028115|Ga0233450_10390522 | Not Available | 554 | Open in IMG/M |
| 3300031519|Ga0307488_10073060 | Not Available | 2574 | Open in IMG/M |
| 3300032136|Ga0316201_11425245 | Not Available | 575 | Open in IMG/M |
| 3300034374|Ga0348335_060877 | All Organisms → Viruses → Predicted Viral | 1384 | Open in IMG/M |
| 3300034374|Ga0348335_062158 | All Organisms → Viruses → Predicted Viral | 1361 | Open in IMG/M |
| 3300034374|Ga0348335_129650 | Not Available | 729 | Open in IMG/M |
| 3300034418|Ga0348337_049748 | Not Available | 1699 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 37.18% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 28.85% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 6.41% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.49% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.21% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.56% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.56% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.56% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.28% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.28% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.28% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.28% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.64% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 0.64% |
| Freshwater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Freshwater | 0.64% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.64% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.64% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.64% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.64% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.64% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.64% |
| M | Environmental → Aquatic → Marine → Unclassified → Unclassified → M | 0.64% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300003264 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 | Environmental | Open in IMG/M |
| 3300003516 | Marine microbial communities from Antarctic ocean - Station_363 -- 0.8 um | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005731 | Seawater microbial communities from Vineyard Sound, MA, USA - succinate ammended T14 | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008963 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009054 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009619 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 | Environmental | Open in IMG/M |
| 3300016732 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018423 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019272 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020056 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020177 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022909 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG | Environmental | Open in IMG/M |
| 3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
| 3300022939 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG | Environmental | Open in IMG/M |
| 3300023084 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG | Environmental | Open in IMG/M |
| 3300023087 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG | Environmental | Open in IMG/M |
| 3300023108 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
| 3300024301 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504CT (spades assembly) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026094 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R1_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100593033 | 3300000116 | Marine | MTWDWHWIGSFKGTPFIWGDFRYNSGDPYKSYRFGPLLIRVFMR* |
| DelMOSpr2010_101252982 | 3300000116 | Marine | MNWDWHWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMMGAN* |
| DelMOWin2010_100839171 | 3300000117 | Marine | EDIMNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFLRG* |
| DelMOWin2010_101256803 | 3300000117 | Marine | MTWDWHWIGSFKGTPFIWGDFRYNSGDPYKSYRFGPLLIRVFMTGVN* |
| JGI20152J14361_100138438 | 3300001344 | Pelagic Marine | MDFHWISWTKGEPFQWGDFRYNNGNPYKNYRIGPLLIRVFLRGLK* |
| JGI24005J15628_102227061 | 3300001589 | Marine | MDFHWISWTKGEPFQWGDFRYNSGNPYKNYRIGPLLIRVFLM |
| JGI26119J46589_10020204 | 3300003264 | Marine | MDFHWISWTKGEPFQWGDFRYNSGNPYKNYRIGPLLIRVFLMGLK* |
| Antartic2_12524321 | 3300003516 | Freshwater | MDFHWISWTKGEPFQWGDFRYNNGNPYKNYRIGPLLIRVFLMGLK* |
| Ga0055584_1013765251 | 3300004097 | Pelagic Marine | MNWDWYWISWFKGTPFQWGDFKLNSGNPYKSYRFGPLLIRVFLRGAN* |
| Ga0066223_10141256 | 3300004461 | Marine | MNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFLRGAK* |
| Ga0076919_10046025 | 3300005731 | M | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLRSTTND* |
| Ga0070743_100106851 | 3300005941 | Estuarine | MNWDWHWINWFKGTTIQWGEFRFNSGNPYKSYRFGPLLIRVFISNQT* |
| Ga0070742_100256662 | 3300005942 | Estuarine | MMNWDWHWISWFKGTPFIWDDFKYNNGDPYKCYRFGPLLIRVFMIRGKK* |
| Ga0075474_100097207 | 3300006025 | Aqueous | MNWDWHWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMMGVK* |
| Ga0075474_100637201 | 3300006025 | Aqueous | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLRGAN* |
| Ga0075474_100821732 | 3300006025 | Aqueous | MTWDWHWIGSFKGTPFIWGDFRYNSGDPYKSYRFGPLLIRVFMRGVN* |
| Ga0075474_102475831 | 3300006025 | Aqueous | MTKIKYWDWYWISWFKGRPFQWGEFRFNSGNPYKSYRFGP |
| Ga0075462_1000187813 | 3300006027 | Aqueous | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLKELSK* |
| Ga0075502_15518871 | 3300006357 | Aqueous | WFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMMGVK* |
| Ga0075503_15546921 | 3300006400 | Aqueous | HWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMRGAN* |
| Ga0075461_101885703 | 3300006637 | Aqueous | MNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFLREYN* |
| Ga0070749_100291091 | 3300006802 | Aqueous | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLL |
| Ga0070749_100566628 | 3300006802 | Aqueous | MIDKKMNWDWHWISWFKGTPFQWSEFRLNSGNPYKSYRFGPLLIRVFLREYN* |
| Ga0070749_100674972 | 3300006802 | Aqueous | MNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFMKGSK* |
| Ga0070749_101428671 | 3300006802 | Aqueous | MTWDWHWIGSFKGTPFIWGDFRYNSGDPYKSYRFGPLLIR |
| Ga0070749_101959484 | 3300006802 | Aqueous | SWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLRGAN* |
| Ga0070749_102199462 | 3300006802 | Aqueous | SFKGTPFIWGDFRYNSGDPYKSYRFGPLLIRVFMR* |
| Ga0070749_104640701 | 3300006802 | Aqueous | MIDKKMNWAWHWISWFKGTPFQWSEFRLHSGNPYKSYRFGPLLIRVFLREYN* |
| Ga0070754_101712882 | 3300006810 | Aqueous | WDWHWIGSFKGTPFIWGDFRYNSGDPYKSYRFGPLLIRVFMR* |
| Ga0075476_101549691 | 3300006867 | Aqueous | MNWDWHWISWFKGTPFQWGEFRFNSGNPYKSYRFGPL |
| Ga0075481_100387043 | 3300006868 | Aqueous | MNWDWHWISWFKGTPFQWGDFKLNSGNPYKSYRFGPLLIRVFLRGAN* |
| Ga0075481_103263002 | 3300006868 | Aqueous | MTWDWHWIGSFKGTPFIWGDFRYNSGDPYKSYRFGPLLI |
| Ga0075475_100694477 | 3300006874 | Aqueous | MIDKKMNWDWHWISWFKGTPFQWSEFRLNSGNPYKSYRFGPLLIRVFLR |
| Ga0075475_101519403 | 3300006874 | Aqueous | WISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMMGAN* |
| Ga0070750_101751681 | 3300006916 | Aqueous | MNCDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFL |
| Ga0070750_103369661 | 3300006916 | Aqueous | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLR |
| Ga0070750_103480353 | 3300006916 | Aqueous | MTWDWHWIGSFKGTPFIWGDFRYNSGDPYKSYRFGPLL |
| Ga0070750_104175261 | 3300006916 | Aqueous | WHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLREYN* |
| Ga0070746_100870151 | 3300006919 | Aqueous | MNWDWHWISWLKGTPFQWGEFRLNSGNPYKSYRFGPLL |
| Ga0070746_101028183 | 3300006919 | Aqueous | THEGRMTWDLHWIGSFKGTPFIWGDFRYNSGDPYKSYRFGPLLIRVFMR* |
| Ga0075460_100792401 | 3300007234 | Aqueous | EDIMNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLRGAN* |
| Ga0070745_10426793 | 3300007344 | Aqueous | GSFKGTPFIWGDFRYNSGDPYKSYRFGPLLIRVFMR* |
| Ga0070745_11658563 | 3300007344 | Aqueous | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLRGRT |
| Ga0070753_10182101 | 3300007346 | Aqueous | HWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMMGVK* |
| Ga0070753_11087161 | 3300007346 | Aqueous | MNWDWHWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMMG |
| Ga0070753_13052711 | 3300007346 | Aqueous | HWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMMGAN* |
| Ga0105020_100726126 | 3300007514 | Marine | MSWDWHWISWFKGTPFQWGEFRFNSGNPYKSYRCGPLLIRVFMVEANG* |
| Ga0099849_11312652 | 3300007539 | Aqueous | KGTPFIWGDFRYNSGDPYKSYRFGPLLIRVFMRGVN* |
| Ga0099848_10083773 | 3300007541 | Aqueous | MNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFMMGSK* |
| Ga0099846_10247346 | 3300007542 | Aqueous | EDIMNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFMMGSK* |
| Ga0070751_10549491 | 3300007640 | Aqueous | WFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMMGAN* |
| Ga0102954_11968762 | 3300007778 | Water | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRMFLREYN* |
| Ga0099850_11264043 | 3300007960 | Aqueous | WDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLKDRWIKIR* |
| Ga0075480_101738551 | 3300008012 | Aqueous | MTWDWHWIGSFKGTPFIWGDFRYNSGDPYKSYRFGP |
| Ga0102930_10009469 | 3300008963 | Pond Water | MNWDYRWVSWTKGTLLQWGEYKFNSGNPYKSYRIGPLLVRVFMMGQK* |
| Ga0102960_11963162 | 3300009000 | Pond Water | MIYKKMNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRMFLREYN* |
| Ga0102963_12096093 | 3300009001 | Pond Water | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFMRGAN* |
| Ga0102826_10994962 | 3300009054 | Estuarine | ISWTKGEPFQWGDFRYNSGNPYKNYRIGPLLIRVFLMGLK* |
| Ga0102830_12437111 | 3300009059 | Estuarine | SWTKGEPFQWGDFRYNSGNPYKNYRIGPLLIRVFLMGLK* |
| Ga0115566_1000823310 | 3300009071 | Pelagic Marine | MNWDCHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFLRGAK* |
| Ga0115566_100155166 | 3300009071 | Pelagic Marine | MDFHWISWTKGEPFQWGDFRYNNGNPYKNYRIGPLLIRVFIRKLKTK* |
| Ga0115566_100501315 | 3300009071 | Pelagic Marine | MNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFLRGAN* |
| Ga0102815_100450333 | 3300009080 | Estuarine | MNWDWHWISWFKGTPFIWDDFKYNNGDPYKCYRFGPLLIRVFMIRGKK* |
| Ga0115569_104581663 | 3300009497 | Pelagic Marine | MDFHWISWTKGEPFQWGDFRYNNGNPYKNYRIGPLLIRVFLRGL |
| Ga0115568_1000143615 | 3300009498 | Pelagic Marine | MNWDCHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFLRGAN* |
| Ga0115572_106600461 | 3300009507 | Pelagic Marine | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIR |
| Ga0105236_10111403 | 3300009619 | Marine Oceanic | VSWDWHWISWFKGTPFQWGEFRFNSGNPYKSYRCGPLLIRVFMVEANG* |
| Ga0182057_13571583 | 3300016732 | Salt Marsh | MSWDWHWTSWFKGTPFQWGDFRLNSGKPYKSYRLGPLLI |
| Ga0182057_15359592 | 3300016732 | Salt Marsh | MNWDWHWTSWFKGTPFQWGDFRLNSGKPYKSYRLGPLLIRVFI |
| Ga0181565_100379696 | 3300017818 | Salt Marsh | MTWDWHWISWFKGQPFQWGDFRYNSGDPYKSYRFGPLLIRVFMRG |
| Ga0181565_100477966 | 3300017818 | Salt Marsh | MNWDWHWISWFKGTPFQWGDFKLNSGNPYKSYRFGPLLIRVFMRGAK |
| Ga0181565_100600871 | 3300017818 | Salt Marsh | MNWDWHWISWFKGTPFQWGDFRFNSGKPYKSYRLGPLLIRVFI |
| Ga0181565_102588503 | 3300017818 | Salt Marsh | MNWDWHWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMMGAK |
| Ga0181584_1000388322 | 3300017949 | Salt Marsh | MIDKKMNWDWHWINWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLREYN |
| Ga0181584_1000467315 | 3300017949 | Salt Marsh | MNWDWHWISWFKGTPFQWGDFRFNSGKPYKSYRLGPLLIRVFM |
| Ga0181607_100076938 | 3300017950 | Salt Marsh | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLRGAN |
| Ga0181607_103396163 | 3300017950 | Salt Marsh | MNWDWHWISWFGGTPFQWGEFKLNSGNPYKSYRFGP |
| Ga0181577_102133994 | 3300017951 | Salt Marsh | WFKGAPLQLGEFRLNSGNPYKSYRFGPLLIRVFSIR |
| Ga0181583_104521422 | 3300017952 | Salt Marsh | MNWDWHWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMM |
| Ga0181580_109145471 | 3300017956 | Salt Marsh | MNWDWHWISWFKGVPFQWGEFRLNNGNPYKSYRFGPLLIRVF |
| Ga0181571_100580393 | 3300017957 | Salt Marsh | TWDWHWIGSFKGTPFIWGDFRYNSGDPYKSYRFGPLLIRVFMRGVN |
| Ga0181571_108708561 | 3300017957 | Salt Marsh | MTWDWHWIGSFKGTPFIWGDFRYNSGDPYKSYRFGPLLIRV |
| Ga0181582_100742211 | 3300017958 | Salt Marsh | WHWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLVRVFMMGSK |
| Ga0181590_101201861 | 3300017967 | Salt Marsh | SNMNWDWHWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLVRVFMMGSK |
| Ga0181576_100164908 | 3300017985 | Salt Marsh | HWIGSFKGTPFIWGDFRYNSGDPYKSYRFGPLLIRVFMRGVN |
| Ga0181569_103864963 | 3300017986 | Salt Marsh | MNWDCHWISWFKGTPLQWGEFRLNSGNPYKSYRFGPLLIRVFM |
| Ga0181601_106822401 | 3300018041 | Salt Marsh | HEDIMSWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFMSG |
| Ga0181572_103128961 | 3300018049 | Salt Marsh | MSWDWHWTSWFKGTPFQWGDFRLNSGKPYKSYRLGPLLIRVF |
| Ga0181553_100285288 | 3300018416 | Salt Marsh | MNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFMKGSK |
| Ga0181592_103747983 | 3300018421 | Salt Marsh | WFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMMGSK |
| Ga0181593_108043891 | 3300018423 | Salt Marsh | FKGTPFQWGEFRFNSGNPYKSYRFGPLLVRVFMMGSK |
| Ga0181591_1002838210 | 3300018424 | Salt Marsh | MNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFLRG |
| Ga0182059_15735132 | 3300019272 | Salt Marsh | WDWHWTSWFKGTPFQWGDFRLNSGKPYKSYRLGPLLIRVFI |
| Ga0182059_17490042 | 3300019272 | Salt Marsh | HEDIMNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFMMGSK |
| Ga0194023_10073304 | 3300019756 | Freshwater | MTWDWHWIGSFKGTPFIWGDFRYNSGDPYKSYRFGPLLIRVFTTGVN |
| Ga0181595_101318321 | 3300020053 | Salt Marsh | ISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFMKGSK |
| Ga0181575_100017584 | 3300020055 | Salt Marsh | MNWDWHWISWFKGVPFQWGEFRLNNGNPYKSYRFGPLLIRVFMKGLK |
| Ga0181574_1000391015 | 3300020056 | Salt Marsh | WHWISWFKGVPFQWGEFRLNNGNPYKSYRFGPLLIRVFMKGLK |
| Ga0181596_102418142 | 3300020177 | Salt Marsh | MNWDWHWISWFGGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLRRPEAT |
| Ga0181570_100518821 | 3300020207 | Salt Marsh | EGRMTWDWHWIGSFKGTPFIWGDFRYNSGDPYKSYRFGPLLIRVFMRGVN |
| Ga0211676_100357684 | 3300020463 | Marine | MDFHWISWTKGEPFQWGDFRYNSGDPYKNYRIGPLLIRVFIRRLKTE |
| Ga0211577_104578461 | 3300020469 | Marine | MDFHWISWTKGELFQWGDFRYNNGNPYKNYRIGPLL |
| Ga0206677_1000005824 | 3300021085 | Seawater | MDFHWISWTKGEPFQWGDFRYNSGNPYKNYRIGPLLIRVFLMGLK |
| Ga0213867_10030925 | 3300021335 | Seawater | MTWDWHWISWFKGQPFQWGDFRYNSGDPYKSYRFGPLLIRVFMR |
| Ga0213867_10037649 | 3300021335 | Seawater | MNWDWHWISWFKGTPFQWGEFRFNGGNPYKSYRCGPLLIRVFMMGVN |
| Ga0213858_1000000252 | 3300021356 | Seawater | MNWDWHWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMMGAN |
| Ga0213859_102451371 | 3300021364 | Seawater | MNWDWHWISWFKGTPFQWGDFKLNSGNPYKSYRFGPLLIRVFMMGSK |
| Ga0222717_100144017 | 3300021957 | Estuarine Water | MIYKKMNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRMFLREYN |
| Ga0222718_1000066345 | 3300021958 | Estuarine Water | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLRG |
| Ga0222718_100288845 | 3300021958 | Estuarine Water | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFMRGAN |
| Ga0222718_104937741 | 3300021958 | Estuarine Water | MNWDWHWISWFKGVPFQWGEFKLNSGNPYKSYRFGPLLIRMFLREYK |
| Ga0222716_101679346 | 3300021959 | Estuarine Water | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFMRGAKIR |
| Ga0222715_103742781 | 3300021960 | Estuarine Water | MNWDWHWISWFKGTPFQWGDFKLNSGNPYKSYRFG |
| Ga0222714_100246431 | 3300021961 | Estuarine Water | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLKELSK |
| Ga0196891_10234341 | 3300022183 | Aqueous | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPL |
| Ga0255755_10300591 | 3300022909 | Salt Marsh | WDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFMKGSK |
| Ga0255765_11182001 | 3300022921 | Salt Marsh | MNWDWHWISWFGGTPFQWGEFKLNSGNPYKSYRFGPLL |
| Ga0255754_101251371 | 3300022939 | Salt Marsh | THEDIMNWDWHWISWFKGTPFQWGDFKLNSGNPYKSYRFGPLLIRVFLRGAN |
| Ga0255778_103996053 | 3300023084 | Salt Marsh | MTWDWHWIGSFKGTPFIWGDFRYNNGDPYKSYRFGPLLIRVFMRGVN |
| Ga0255774_100331181 | 3300023087 | Salt Marsh | MTWDWHWISWFKGQPFQWGDFRYNSGDPYKSYRFGPLLIRVFM |
| Ga0255774_100640561 | 3300023087 | Salt Marsh | HWISWFKGQPFQWGDFRYNSGDPYKSYRFGPLLIRVFMRGVN |
| Ga0255784_100139979 | 3300023108 | Salt Marsh | MNWDWHWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRV |
| Ga0255751_100803398 | 3300023116 | Salt Marsh | MNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLL |
| Ga0255762_100137331 | 3300023119 | Salt Marsh | MNWDWHWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVF |
| Ga0255762_100149441 | 3300023119 | Salt Marsh | IMNWDWHWISWFKGTPFQWGDFKLNSGNPYKSYRFGPLLIRVFMRGAK |
| Ga0255762_101108331 | 3300023119 | Salt Marsh | MNWDWHWISWFRGVPFQWGEFRLNNGNPYKSYRFGPLLIRVFMKGLK |
| Ga0233451_101200001 | 3300024301 | Salt Marsh | AHEDIMNWDWHWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMMGSK |
| Ga0209645_11901842 | 3300025151 | Marine | MMNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFMMGLK |
| Ga0209716_10213993 | 3300025626 | Pelagic Marine | MDFHWISWTKGEPFQWGDFRYNNGNPYKNYRIGPLLIRVFLRGLK |
| Ga0209716_11375091 | 3300025626 | Pelagic Marine | MDFHWISWTKGEPFQWGDFRYNNGNPYKNYRIGPLLIRVFIRKLKTK |
| Ga0208004_10088361 | 3300025630 | Aqueous | WISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLRGAN |
| Ga0208004_10825321 | 3300025630 | Aqueous | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLI |
| Ga0208428_10004867 | 3300025653 | Aqueous | MNWDWHWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMMGVK |
| Ga0208898_10764202 | 3300025671 | Aqueous | MNWDWHWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLIR |
| Ga0208898_11110613 | 3300025671 | Aqueous | MNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRV |
| Ga0208898_11434922 | 3300025671 | Aqueous | MNCDWHWISWLKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFLRGSNVVEAT |
| Ga0208019_10180033 | 3300025687 | Aqueous | MNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFMMGSK |
| Ga0208427_10164357 | 3300025771 | Aqueous | MKYWDWHWISWYKGRPFQWGEHRFNSGNPYKNYRIGPIMVRVFY |
| Ga0208425_11107661 | 3300025803 | Aqueous | DIMNWDWHWISWFKGTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMMGAN |
| Ga0208542_10111162 | 3300025818 | Aqueous | MIDKKMNWDWHWISWFKGTPFQWSEFRLNSGNPYKSYRFGPLLIRVFLREYN |
| Ga0208645_12704723 | 3300025853 | Aqueous | MTWDWHWIGSFKGTPFIWGDFRYNSGDPYKSYRFG |
| Ga0209308_1000036215 | 3300025869 | Pelagic Marine | MNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFLRGAN |
| Ga0209309_101578813 | 3300025881 | Pelagic Marine | MNWDCHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFLRGAN |
| Ga0208644_100823112 | 3300025889 | Aqueous | RMTWDWHWIGSFKGTPFIWGDFRYNSGDPYKSYRFGPLLIRVFMTGVN |
| Ga0208644_100864614 | 3300025889 | Aqueous | KGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLKELSK |
| Ga0208644_11626721 | 3300025889 | Aqueous | SFKGTPFIWGDFRYNSGDPYKSYRFGPLLIRVFMR |
| Ga0209937_10007929 | 3300026094 | Pond Water | MNWDYRWVSWTKGTLLQWGEYKFNSGNPYKSYRIGPLLVRVFMMGQK |
| Ga0208671_100611301 | 3300027757 | Estuarine | MNWDWHWISWFKGTPFIWDDFKYNNGDPYKCYRFGPLLIRV |
| Ga0228674_11609131 | 3300028008 | Seawater | SWTKGEPFQWGDFRYNSGNPYKNYRIGPLLIRVFLMGLK |
| Ga0233450_103905221 | 3300028115 | Salt Marsh | MNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPL |
| Ga0307488_100730602 | 3300031519 | Sackhole Brine | MNWDWHWISWFKGTPFQWGEFRLNSGNPYKSYRFGPLLIRVFLRGAT |
| Ga0316201_114252452 | 3300032136 | Worm Burrow | GTPFQWGEFRFNSGNPYKSYRFGPLLIRVFMMGAN |
| Ga0348335_060877_3_140 | 3300034374 | Aqueous | MNWDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIRVFLRRA |
| Ga0348335_062158_3_122 | 3300034374 | Aqueous | MNCDWHWISWFKGTPFQWGEFKLNSGNPYKSYRFGPLLIR |
| Ga0348335_129650_1_126 | 3300034374 | Aqueous | MTWDWHWIGSFKGTPFIWGDFRYNSGDPYKSYRFGPLLIRVF |
| Ga0348337_049748_1_114 | 3300034418 | Aqueous | FKGTPFIWGDFRYNSGDPYKSYRFGPLLIRVFMRGVN |
| ⦗Top⦘ |