


| Basic Information | |
|---|---|
| Family ID | F043025 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 157 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GDAATRKKIMARLNELLNRRSYIRNLVTNVQKELL |
| Number of Associated Samples | 123 |
| Number of Associated Scaffolds | 157 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.29 % |
| % of genes near scaffold ends (potentially truncated) | 97.45 % |
| % of genes from short scaffolds (< 2000 bps) | 94.90 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.994 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.389 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.115 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.949 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.79% β-sheet: 0.00% Coil/Unstructured: 49.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 157 Family Scaffolds |
|---|---|---|
| PF00012 | HSP70 | 91.72 |
| PF05635 | 23S_rRNA_IVP | 3.18 |
| PF04384 | Fe-S_assembly | 1.27 |
| PF02885 | Glycos_trans_3N | 0.64 |
| PF07743 | HSCB_C | 0.64 |
| PF03703 | bPH_2 | 0.64 |
| PF00111 | Fer2 | 0.64 |
| PF08545 | ACP_syn_III | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 157 Family Scaffolds |
|---|---|---|---|
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 91.72 |
| COG2975 | Fe-S-cluster formation regulator IscX/YfhJ | Posttranslational modification, protein turnover, chaperones [O] | 1.27 |
| COG1076 | DnaJ domain-containing protein | Posttranslational modification, protein turnover, chaperones [O] | 0.64 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.64 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.99 % |
| Unclassified | root | N/A | 7.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001082|JGI12664J13189_1006712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 767 | Open in IMG/M |
| 3300002917|JGI25616J43925_10253218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 661 | Open in IMG/M |
| 3300005175|Ga0066673_10119882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1434 | Open in IMG/M |
| 3300005179|Ga0066684_10076991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1989 | Open in IMG/M |
| 3300005332|Ga0066388_106426223 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005440|Ga0070705_100817398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 743 | Open in IMG/M |
| 3300005454|Ga0066687_10681198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 611 | Open in IMG/M |
| 3300005552|Ga0066701_10977662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 500 | Open in IMG/M |
| 3300005561|Ga0066699_10150300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1588 | Open in IMG/M |
| 3300005568|Ga0066703_10821479 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005591|Ga0070761_10914093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 555 | Open in IMG/M |
| 3300005993|Ga0080027_10067449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1312 | Open in IMG/M |
| 3300006059|Ga0075017_101530277 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300006174|Ga0075014_100009886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3293 | Open in IMG/M |
| 3300006174|Ga0075014_100712197 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300006354|Ga0075021_10889681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 578 | Open in IMG/M |
| 3300006755|Ga0079222_11264496 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006871|Ga0075434_102288780 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006893|Ga0073928_10852476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 627 | Open in IMG/M |
| 3300007255|Ga0099791_10683842 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300009012|Ga0066710_104751429 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300009038|Ga0099829_10002280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10983 | Open in IMG/M |
| 3300009038|Ga0099829_10439294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
| 3300009038|Ga0099829_11082585 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300009089|Ga0099828_10741745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300009089|Ga0099828_11759213 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300009090|Ga0099827_11162204 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300009162|Ga0075423_10911820 | Not Available | 932 | Open in IMG/M |
| 3300009522|Ga0116218_1102485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1303 | Open in IMG/M |
| 3300009624|Ga0116105_1046057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
| 3300009764|Ga0116134_1257182 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010159|Ga0099796_10203338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300010337|Ga0134062_10462119 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300010359|Ga0126376_11753061 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300010376|Ga0126381_100870589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1296 | Open in IMG/M |
| 3300011120|Ga0150983_16674682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300011271|Ga0137393_10327813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1306 | Open in IMG/M |
| 3300012169|Ga0153990_1097955 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300012200|Ga0137382_10177530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1456 | Open in IMG/M |
| 3300012200|Ga0137382_11059757 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300012201|Ga0137365_10469891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300012201|Ga0137365_10838285 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300012205|Ga0137362_10458300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| 3300012209|Ga0137379_11032903 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300012359|Ga0137385_11241505 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012362|Ga0137361_10907257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300012362|Ga0137361_11024353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300012362|Ga0137361_11591189 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300012363|Ga0137390_10650610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300012582|Ga0137358_10210414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1327 | Open in IMG/M |
| 3300012582|Ga0137358_10938048 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300012685|Ga0137397_10248758 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300012685|Ga0137397_10498004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300012917|Ga0137395_11186708 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012918|Ga0137396_10209407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1434 | Open in IMG/M |
| 3300012918|Ga0137396_10242713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1328 | Open in IMG/M |
| 3300012918|Ga0137396_10538431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300012927|Ga0137416_11171113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300012927|Ga0137416_11751394 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012929|Ga0137404_10691795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300012944|Ga0137410_10272808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1332 | Open in IMG/M |
| 3300012944|Ga0137410_11944321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 522 | Open in IMG/M |
| 3300012960|Ga0164301_11003255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300012977|Ga0134087_10570958 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300012984|Ga0164309_10547462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300012988|Ga0164306_11479246 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300013832|Ga0120132_1093061 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300014152|Ga0181533_1180525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300014157|Ga0134078_10270323 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300014165|Ga0181523_10357562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300015052|Ga0137411_1179286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300016422|Ga0182039_11899040 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300018030|Ga0187869_10020824 | All Organisms → cellular organisms → Bacteria | 3747 | Open in IMG/M |
| 3300018088|Ga0187771_10929844 | Not Available | 738 | Open in IMG/M |
| 3300020170|Ga0179594_10376724 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300020579|Ga0210407_10023389 | All Organisms → cellular organisms → Bacteria | 4593 | Open in IMG/M |
| 3300020579|Ga0210407_10756190 | Not Available | 751 | Open in IMG/M |
| 3300020583|Ga0210401_10523772 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300020583|Ga0210401_10573708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
| 3300020583|Ga0210401_11185396 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300021086|Ga0179596_10455862 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300021086|Ga0179596_10643339 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300021088|Ga0210404_10131992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1293 | Open in IMG/M |
| 3300021170|Ga0210400_10656968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300021170|Ga0210400_11158743 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300021178|Ga0210408_10817124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300021178|Ga0210408_11165668 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300021180|Ga0210396_11141326 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300021401|Ga0210393_10605444 | Not Available | 895 | Open in IMG/M |
| 3300021405|Ga0210387_10912505 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300021406|Ga0210386_10324055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1323 | Open in IMG/M |
| 3300021420|Ga0210394_11243514 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300021420|Ga0210394_11374125 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300021478|Ga0210402_10361303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1348 | Open in IMG/M |
| 3300021478|Ga0210402_10728239 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300022724|Ga0242665_10192782 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300022726|Ga0242654_10129373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300024288|Ga0179589_10013501 | All Organisms → cellular organisms → Bacteria | 2516 | Open in IMG/M |
| 3300024288|Ga0179589_10383082 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300025325|Ga0209341_10359345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Achromobacter → Achromobacter insuavis → Achromobacter insuavis AXX-A | 1188 | Open in IMG/M |
| 3300025612|Ga0208691_1158247 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300026294|Ga0209839_10247320 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300026296|Ga0209235_1063568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1713 | Open in IMG/M |
| 3300026310|Ga0209239_1157923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300026317|Ga0209154_1104464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1206 | Open in IMG/M |
| 3300026330|Ga0209473_1046300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1912 | Open in IMG/M |
| 3300026334|Ga0209377_1130104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
| 3300026356|Ga0257150_1023919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300026542|Ga0209805_1199305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300026548|Ga0209161_10427690 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300026555|Ga0179593_1085257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1744 | Open in IMG/M |
| 3300026990|Ga0207824_1028965 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300027000|Ga0207803_1023852 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300027565|Ga0209219_1080640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300027591|Ga0209733_1077231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300027671|Ga0209588_1087790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
| 3300027671|Ga0209588_1121217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300027671|Ga0209588_1184299 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300027768|Ga0209772_10149146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300027842|Ga0209580_10563159 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300027884|Ga0209275_10117388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1380 | Open in IMG/M |
| 3300028759|Ga0302224_10166324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300029636|Ga0222749_10712980 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300029910|Ga0311369_11401253 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300030707|Ga0310038_10266180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300031057|Ga0170834_109046604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300031057|Ga0170834_113767648 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300031128|Ga0170823_13288342 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300031231|Ga0170824_105548710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1289 | Open in IMG/M |
| 3300031240|Ga0265320_10184951 | Not Available | 933 | Open in IMG/M |
| 3300031474|Ga0170818_115096637 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031682|Ga0318560_10736395 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031718|Ga0307474_11134398 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300031718|Ga0307474_11605033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 511 | Open in IMG/M |
| 3300031720|Ga0307469_11927853 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300031753|Ga0307477_11074311 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031754|Ga0307475_10001623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13398 | Open in IMG/M |
| 3300031823|Ga0307478_10341409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1233 | Open in IMG/M |
| 3300031890|Ga0306925_10709148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
| 3300031941|Ga0310912_10704069 | Not Available | 783 | Open in IMG/M |
| 3300031941|Ga0310912_11275966 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300031962|Ga0307479_10818942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
| 3300031962|Ga0307479_10966540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300031962|Ga0307479_11003328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300031962|Ga0307479_11054308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300031962|Ga0307479_11204075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300032089|Ga0318525_10357043 | Not Available | 750 | Open in IMG/M |
| 3300032180|Ga0307471_100513136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1348 | Open in IMG/M |
| 3300032180|Ga0307471_102022290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300032261|Ga0306920_102510607 | Not Available | 709 | Open in IMG/M |
| 3300032893|Ga0335069_11799940 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300032954|Ga0335083_10834228 | Not Available | 737 | Open in IMG/M |
| 3300033289|Ga0310914_10461123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
| 3300034091|Ga0326724_0647450 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300034125|Ga0370484_0106933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.18% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.55% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.91% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.27% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.27% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.27% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.27% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.64% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.64% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.64% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.64% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.64% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.64% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.64% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.64% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.64% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.64% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001082 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026990 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes) | Environmental | Open in IMG/M |
| 3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12664J13189_10067121 | 3300001082 | Forest Soil | DAAIDADAADSDRDAIKVRLNELLNRRSYIRNLVNGVAKELA* |
| JGI25616J43925_102532181 | 3300002917 | Grasslands Soil | WDAALQGEAATRKQVMAKLNDLLNRRSYIRNLVVNVQKELL* |
| Ga0066673_101198821 | 3300005175 | Soil | AARKWDTALQGNAAMRKKIMAKLNDLLNRRSYIRNLVTNVQKELV* |
| Ga0066684_100769911 | 3300005179 | Soil | QLQAASREWDAALEADSITRKKVMAKLNDLLNRRSYIRNLLASVQKELV* |
| Ga0066388_1064262231 | 3300005332 | Tropical Forest Soil | SGGDDATRKKIMARLNEHLNRRSYVRNLVMNVARELEEA* |
| Ga0070705_1008173982 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | SAAHDWDAALTGDSATRKKIMARLNELLNRRNYIRNLVTNVQKELSVTSL* |
| Ga0066687_106811981 | 3300005454 | Soil | VTAREWDATLQGDPATRKKIMAQLNELLNRRSYIRNLVTNVQKELL* |
| Ga0066701_109776622 | 3300005552 | Soil | GADDAARKKLMTRMNELLNRRSYIRNLAANVQKELAEA* |
| Ga0066699_101503001 | 3300005561 | Soil | DAALSGDAATRKKIMAQLNGLLNRRSYIRNLVTNVQKELL* |
| Ga0066703_108214791 | 3300005568 | Soil | EADSITRKKVMAKLNDLLNRRSYIRNLLASVQKELV* |
| Ga0070761_109140932 | 3300005591 | Soil | DAAVDANGDEAARKKIMARLNERLNRRSYIRNLVMSVAKELGEA* |
| Ga0080027_100674491 | 3300005993 | Prmafrost Soil | AALDADASDPDREAILQRLNELLNRRSYIRNLVAGVENELTGAAS* |
| Ga0075017_1015302771 | 3300006059 | Watersheds | ADSATRKIVMAKLNELLNRRSYIRNLVINVQKELL* |
| Ga0075014_1000098861 | 3300006174 | Watersheds | ALRADAATRKVIMAKLNELLNRRSYIRNLVTNVQKELL* |
| Ga0075014_1007121971 | 3300006174 | Watersheds | LQADSATRKIVMAKLNELLNRRSYIRNLVINVQKELL* |
| Ga0075021_108896811 | 3300006354 | Watersheds | LQAAAREWDAALQGDGATRKPIKERLNELLNRRSYIRNLVTNVQKELS* |
| Ga0079222_112644961 | 3300006755 | Agricultural Soil | WDAALEADSATRKKVMAKLNDLLNRRSYIRNLLASVQKELV* |
| Ga0075434_1022887802 | 3300006871 | Populus Rhizosphere | AAVDATADTAVRKGIFARMNELLNRRSYIRNLVTGVEKELAA* |
| Ga0073928_108524761 | 3300006893 | Iron-Sulfur Acid Spring | QTAQAWDVASESDTAKRKEVMTRLNELLNRRSYIRNLVTNVQKELQ* |
| Ga0099791_106838422 | 3300007255 | Vadose Zone Soil | DAASRKESMAQLNELLNRRSYIRNLVTNVQKELL* |
| Ga0066710_1047514292 | 3300009012 | Grasslands Soil | QSDAATRKKIMTRLNELLNRRSYIRNLVTNVQKELL |
| Ga0099829_1000228012 | 3300009038 | Vadose Zone Soil | ETGRKQIFARMNELLNRRSYIRNLVANVAKELEA* |
| Ga0099829_104392941 | 3300009038 | Vadose Zone Soil | LQADAATRKKIMAQLNELLNRRSYIRNLVTNVQKELL* |
| Ga0099829_110825852 | 3300009038 | Vadose Zone Soil | EWDAAPDGDAAARKQIMGRLNDLLNRRSYIRNLVTNVQKELATA* |
| Ga0099828_107417451 | 3300009089 | Vadose Zone Soil | WDAALQGEAATRKQIMAKLNDLLNRRSYIRNLVTNVQKELL* |
| Ga0099828_117592131 | 3300009089 | Vadose Zone Soil | SSSDTDRKAIMVRLNELLNRRSYIRNLVTNVQKELL* |
| Ga0099827_111622042 | 3300009090 | Vadose Zone Soil | AAREWDAALQGDAATRKKIMARLNDLLNRRSYIRNLVTNVQKELV* |
| Ga0075423_109118202 | 3300009162 | Populus Rhizosphere | FEANGTSEARKMLMARMNELLNRRSYIRNLVANVAKELAEA* |
| Ga0116218_11024851 | 3300009522 | Peatlands Soil | AGVPDRGKLMAQLNELLNRRSYIRNLVVNVQKELL* |
| Ga0116105_10460571 | 3300009624 | Peatland | AIEANAGDSDRAAIKVRLNELLNRRSYIRNLVNNVAKELTES* |
| Ga0116134_12571821 | 3300009764 | Peatland | QVIDSAADETARRKAMSKLNELLNRRSYIRNLVVNVQKELL* |
| Ga0099796_102033381 | 3300010159 | Vadose Zone Soil | DANASDTDRKGIMVRLNELLNRRSYIRNLVTNVQKELQ* |
| Ga0134062_104621192 | 3300010337 | Grasslands Soil | LQGNAAMRKKIMAKLNDLLNRRSYIRNLVTNVQKELV* |
| Ga0126376_117530611 | 3300010359 | Tropical Forest Soil | NGDAASRKALMARMNDLLNRRSYIRNLVNGVAKELGEI* |
| Ga0126381_1008705892 | 3300010376 | Tropical Forest Soil | AALEGDRATRKKIMGRLNELLNRRSYIRNLVTNVAKELAEV* |
| Ga0150983_166746821 | 3300011120 | Forest Soil | QRIAQEWDAAIDANAAAPARKTLMAQMNECLNRRSYIRNLVAGVAKELGEI* |
| Ga0137393_103278131 | 3300011271 | Vadose Zone Soil | AHEWDAALTGDSATRNKIMARLNELLNRRSYIRNLVTNVQKELL* |
| Ga0153990_10979551 | 3300012169 | Attine Ant Fungus Gardens | IDANVGDNDRKAIMVRLNELLNRRSYIRNLVTNVQKELV* |
| Ga0137382_101775301 | 3300012200 | Vadose Zone Soil | NAAMRKKIIAKLNDLLNRRSYIRNLVTNVQKELV* |
| Ga0137382_110597572 | 3300012200 | Vadose Zone Soil | DSAVDANAGVAARKKLFAGMNELLNRRSYIRNLVTNVAKELAEV* |
| Ga0137365_104698911 | 3300012201 | Vadose Zone Soil | ALQGEATKRKKIMTQLNDLLNRRSYIRNLVTNVQKELL* |
| Ga0137365_108382851 | 3300012201 | Vadose Zone Soil | ALQGEATKRKKIMTQLNDLLNRRSYIRNLVTSVQKELL* |
| Ga0137362_104583002 | 3300012205 | Vadose Zone Soil | VDTSADDSTRKKIMARLNEHLNRRSYIRNLVVSVAKELAEA* |
| Ga0137379_110329031 | 3300012209 | Vadose Zone Soil | TARKRIMSRMNELLNRRSYIRNLVANVQKELTAP* |
| Ga0137385_112415051 | 3300012359 | Vadose Zone Soil | QAAAREWDTALQGNAAMRKKIIAKLNDLLNRRSYIRNLVTNVQKELV* |
| Ga0137361_109072571 | 3300012362 | Vadose Zone Soil | DAALAGDSATRKKIMARLNELLNRRSYVRNLVTNVKKELV* |
| Ga0137361_110243532 | 3300012362 | Vadose Zone Soil | EWDAALQGEAATRKKVMAKLNDLLNRRSYIRNLVTNVQKELL* |
| Ga0137361_115911892 | 3300012362 | Vadose Zone Soil | TADSAARKKIMARLNELLNRRSYIRNLVTNVQKELL* |
| Ga0137390_106506101 | 3300012363 | Vadose Zone Soil | DAALQADAATRKKVMAKLNDLLNRRSYIRNLVTNVQKELL* |
| Ga0137358_102104142 | 3300012582 | Vadose Zone Soil | AAREWDAALQADTATRKKIMARLNELLNRRSYIRNLVTTVQKELL* |
| Ga0137358_109380481 | 3300012582 | Vadose Zone Soil | ANKAGRKSVMAKLNELLNRRSYIRNLVVNVQKELL* |
| Ga0137397_102487582 | 3300012685 | Vadose Zone Soil | DAATRKKIMARLNELLNRRSYIRNLVTNVQKELL* |
| Ga0137397_104980042 | 3300012685 | Vadose Zone Soil | LQTAAREWDAALQGEAATRKQVMAKLNDLLNRRSYIRNLVVNVQKELL* |
| Ga0137395_111867081 | 3300012917 | Vadose Zone Soil | DSAARKKLFARMNELLNRRSYIRNLVANVQKELQE* |
| Ga0137396_102094071 | 3300012918 | Vadose Zone Soil | LQTAAREWDASLQSDAATRRKIIVRLNDLLNRRSYIRNLVINVQKELL* |
| Ga0137396_102427132 | 3300012918 | Vadose Zone Soil | DAATRKKIMARLNELLNRRSYIRNLVTSVQKELL* |
| Ga0137396_105384312 | 3300012918 | Vadose Zone Soil | DAALQGEAATRKQVMAKLNDLLNRRSYIRNLVVNVQKELL* |
| Ga0137416_111711131 | 3300012927 | Vadose Zone Soil | LQGEAATRKQVMAKLNDLLNRRSYIRNLVVNVQKELL* |
| Ga0137416_117513941 | 3300012927 | Vadose Zone Soil | DAVDANADETARKQIFARMNELLNRRSYIRNLVANVRKELEA* |
| Ga0137404_106917952 | 3300012929 | Vadose Zone Soil | VDANADEAKRKSVMTKLNELLNRRSYIRNLVVNVQKELT* |
| Ga0137410_102728081 | 3300012944 | Vadose Zone Soil | GDAATRKKIMARLNELLNRRSYIRNLVTNVQKELL* |
| Ga0137410_119443211 | 3300012944 | Vadose Zone Soil | QQWDAAIDANASDTDRKGILVGLNELLNRRSYIRNLVTNVEKELQ* |
| Ga0164301_110032552 | 3300012960 | Soil | TADDAARKKIMARLNELLNRRNYIRNLVTNVQKELSVTSL* |
| Ga0134087_105709581 | 3300012977 | Grasslands Soil | REWDAALSGDAATRKKIMAQLNGLLNRRSYIRNLVTNVQKELL* |
| Ga0164309_105474622 | 3300012984 | Soil | DTAVDSNAGAEARMEIFARINELLNRRSYIRNLVANVAKELEA* |
| Ga0164306_114792461 | 3300012988 | Soil | DDAARKKIMARLNELLNRRSYIRNLVVNVAKELGEA* |
| Ga0120132_10930612 | 3300013832 | Permafrost | LDANASDSDREAVLQRLNELLNRRSYIRNLVAGVEKELAGAAS* |
| Ga0181533_11805252 | 3300014152 | Bog | DSAADDAARRQAMSKLNELLNRRSYIKNLVVNVQKELL* |
| Ga0134078_102703231 | 3300014157 | Grasslands Soil | GDAATRKKIMTQLNGLLNRRSYIRNLVTNVQKELL* |
| Ga0181523_103575622 | 3300014165 | Bog | IDESADPTRRKALMSKLNELLNRRSYIRNLVVNVQKELL* |
| Ga0137411_11792861 | 3300015052 | Vadose Zone Soil | SALTADSAARKKIMARLNELLNRRSYIRNLVTNVQKELL* |
| Ga0182039_118990402 | 3300016422 | Soil | IQDNAGKTQRDAVKSKLNDLLNRRSYIRNLVVNVQKELV |
| Ga0187869_100208246 | 3300018030 | Peatland | GAIDAGAGEPDRGKIMAQLNELLNRRSYIRNLVVNVQKELL |
| Ga0187771_109298441 | 3300018088 | Tropical Peatland | EWDKLIDEKADESQRNAAKVKLNELLNRRSYIRNLVVNVQKELL |
| Ga0179594_103767242 | 3300020170 | Vadose Zone Soil | AVEANADAAARKKLFARMNDLLNRRSYIRNLVASVEKELAA |
| Ga0210407_100233897 | 3300020579 | Soil | AMDANAGDADRKGIMARLNELLNRRSYIRNLVTNVQKELL |
| Ga0210407_107561902 | 3300020579 | Soil | TARQWDAAIDADASDTDRKGIMARLNELLNRRSYIRNLVTDVQKEVL |
| Ga0210401_105237721 | 3300020583 | Soil | ESADPSQREAAKGKLNELLNRRSYIRNLVINVQKELAGT |
| Ga0210401_105737082 | 3300020583 | Soil | DATSDQAAHKRIMGRLNELLNRRSYIRNLVVNVAKELGEA |
| Ga0210401_111853961 | 3300020583 | Soil | ARADEATRKGVMAKLNELLNRRSYIRNLVVNVQKELL |
| Ga0179596_104558622 | 3300021086 | Vadose Zone Soil | AAVSGDAATRKKIMAQLNGLLNRRSYIRNLVTNVQKELL |
| Ga0179596_106433391 | 3300021086 | Vadose Zone Soil | AALEANAGDNDRAAIKVRLNELLNRRSYIRNLVNNVQKELE |
| Ga0210404_101319922 | 3300021088 | Soil | AARQWDAALDGDAATRTKIMAQLNELLNRRSYIRNLVTNVQKELL |
| Ga0210400_106569682 | 3300021170 | Soil | AAVDANADDSARKKIMAHLNELLNRRSYIRNLVVNVAKELGEV |
| Ga0210400_111587432 | 3300021170 | Soil | NADEAARKKIMTRLNELLNRRSYIRNLVVNVQKELTT |
| Ga0210408_108171241 | 3300021178 | Soil | NADDAARKKIMARLNELLNRRSYIRNLVVNVAKELGEV |
| Ga0210408_111656682 | 3300021178 | Soil | AREWDNALDGGAVTLGEIMAKLNELLNRRSYIRNLVTNVQKELL |
| Ga0210396_111413261 | 3300021180 | Soil | AQMKTAAQQWDADLDANASESDREAILQRLNELLNRRSYIRNLVAGVEKELQGAAC |
| Ga0210393_106054442 | 3300021401 | Soil | QTDEASRNTAMGKLNELLNRRSYVRNLVVNVQKELL |
| Ga0210387_109125051 | 3300021405 | Soil | DAGVDASADEAARKKIMTRLNELLNRRSYIRNLVVNVQKELTT |
| Ga0210386_103240551 | 3300021406 | Soil | GADDAVRKKIMARLNELLNRRSYIRNLVVNVAKELGEA |
| Ga0210394_112435141 | 3300021420 | Soil | ALEAEAGDNDRRAIMVRLNELLNRRSYIRNLVKNVQMELQ |
| Ga0210394_113741252 | 3300021420 | Soil | DKTVDGNADGTARKSTMAKLNELLNRRSYIRNLVANVQKELV |
| Ga0210402_103613031 | 3300021478 | Soil | EWDVVLDGDVGARKKIMARLNELLNRRSYIRNLVTNVQKELL |
| Ga0210402_107282392 | 3300021478 | Soil | ADANADEAARKKIMTRLNELLNRRSYIRNLVVNVQKELTT |
| Ga0210402_118181231 | 3300021478 | Soil | TARDWDAGVDANADDPARKKLMTRMNELLNRRSYIRNLVVNVQKELS |
| Ga0242665_101927821 | 3300022724 | Soil | ELQSAAREWDAALDGDTAMRNTIKARLNEMLNRRSYVRNLVTNVQKELL |
| Ga0242654_101293731 | 3300022726 | Soil | AIDANAAAPARKTLMAQMNECLNRRSYIRNLVAGVAKELGEI |
| Ga0179589_100135011 | 3300024288 | Vadose Zone Soil | DETGRKQIFVRMNELLNRRSYIRNLVANVAKELEA |
| Ga0179589_103830822 | 3300024288 | Vadose Zone Soil | QETPQQWDAAIDANASDTDRKGILVRLNELLNRRSYIRNLVTNVQKELQ |
| Ga0209341_103593452 | 3300025325 | Soil | KLFAEWDRAVEAGASGPAQQQLMERMNEALNRRSYIRNLVESVEKELAED |
| Ga0208691_11582471 | 3300025612 | Peatland | NAGDSDRAAIKVRLNELLNRRSYIRNLVNNVAKELTES |
| Ga0209839_102473202 | 3300026294 | Soil | EMKIAAQQWDAALDANAGDADREAILQRLNELLNRRSYIRNLVAGVEKELTGAAG |
| Ga0209235_10635682 | 3300026296 | Grasslands Soil | LDSGGDDTARKRIMARMNELLNRRSYIRNLVANVQKEL |
| Ga0209239_11579232 | 3300026310 | Grasslands Soil | ARKWDTALQGNAAMRKKIMAKLNDLLNRRSYIRNLVTNVQKELV |
| Ga0209154_11044642 | 3300026317 | Soil | TALQGNAAMRKKIIAKLNDLLNRRSYIRNLVTNVQKELV |
| Ga0209473_10463001 | 3300026330 | Soil | QLQAASREWDAALEADSITRKKVMAKLNDLLNRRSYIRNLLASVQKELV |
| Ga0209377_11301042 | 3300026334 | Soil | AALEGDAATRKKIMARLNDLLNRRSYIRNLVTNVQKELL |
| Ga0257150_10239192 | 3300026356 | Soil | QGEAATRKQVMAKLNDLLNRRSYIRNLVVNVQKELL |
| Ga0209805_11993051 | 3300026542 | Soil | DAALSGDAATRKKIMAQLNGLLNRRSYIRNLVTNVQKELL |
| Ga0209161_104276901 | 3300026548 | Soil | AREWDGALSADAATRTKIMAQLNGLLNRRSYIRNLVTNVQKELL |
| Ga0179593_10852576 | 3300026555 | Vadose Zone Soil | LQGEAATRKKIMAKLNDLLNRRSYIRNLVTNVQKELL |
| Ga0207824_10289652 | 3300026990 | Tropical Forest Soil | LDAKTDPSVRQQVMNQLNDLLNRRSYIRNLVVNVQKELS |
| Ga0207803_10238522 | 3300027000 | Tropical Forest Soil | AIDGNADESARKQVMTKLNELLNRRSYVRNLVVNVQKELL |
| Ga0209219_10806402 | 3300027565 | Forest Soil | WDAALDANASESDREAILQRLNELLNRRSYIRNLVLGVEKELQGASC |
| Ga0209733_10772311 | 3300027591 | Forest Soil | QQWDAALDANASESDREAILQRLNELLNRRSYIRNLVAGVEKELQGAAC |
| Ga0209588_10877901 | 3300027671 | Vadose Zone Soil | DANASDSDRKAIMVRLNELLNRRSYIRNLVNNVQKELM |
| Ga0209588_11212172 | 3300027671 | Vadose Zone Soil | ALTADSAARKKIMARLNELLNRRSYIRNLVTNVQKELL |
| Ga0209588_11842991 | 3300027671 | Vadose Zone Soil | LDGDAVTRKKIMAKLNDLLNRRSYIRNLVTNVQKELL |
| Ga0209772_101491462 | 3300027768 | Bog Forest Soil | NADERVRKKLMARMNELLNRRSYIRNLVVNVQKELS |
| Ga0209580_105631591 | 3300027842 | Surface Soil | DAAIDAKSGDDLKAILVRLNELLNRRSYIRNLVTNVEKELV |
| Ga0209275_101173882 | 3300027884 | Soil | AALEAEAGDNDRRAIMVRLNELLNRRSYIRNLVKNVQMELQ |
| Ga0302224_101663242 | 3300028759 | Palsa | LQIAAEQWDAAVDADASVSDRDAIMIRLNELLNRRSYIRNLVNSVRQELL |
| Ga0222749_107129802 | 3300029636 | Soil | AGDNDRRAIMVRLNELLNRRSYIRNLVKNVQMELQ |
| Ga0311369_114012532 | 3300029910 | Palsa | ASKDARAALMAQMNEILNRRSYIRNLVANVEQELAKTS |
| Ga0310038_102661801 | 3300030707 | Peatlands Soil | DSATDDAARRRAMSKLNELLNRRSYIRNLVVNVQKELL |
| Ga0170834_1090466041 | 3300031057 | Forest Soil | NSDDAARKKIFARMNELLNRRSYIRNLVANVAKELEA |
| Ga0170834_1137676482 | 3300031057 | Forest Soil | ADAAARKALMARMNECLNRRSYIRNLVTGVAKELGEI |
| Ga0170823_132883421 | 3300031128 | Forest Soil | AVDANADEAKRKIVMAKLNELLNRRSYIRNLVVNVQKELL |
| Ga0170824_1055487102 | 3300031231 | Forest Soil | VDANAESGGRKELFARMNELLNRRSYIRNLVTNVAKELAEV |
| Ga0265320_101849511 | 3300031240 | Rhizosphere | TVDANADDAARKKIMSRMNELLNRRAYVRNLVVNVQKELS |
| Ga0170818_1150966372 | 3300031474 | Forest Soil | AVDANADETGRKPIFARMNELLNRRSYIRNLVANVAKELEA |
| Ga0318560_107363951 | 3300031682 | Soil | IDGNADESARKQVMTRLNELLNRRSYVRNLVVNVQKELL |
| Ga0307476_100313656 | 3300031715 | Hardwood Forest Soil | LAEVDAQLQTTAREWDAAVDANADDAARKKLMSRMNDLLNRRAYVRNLVVNVQKELS |
| Ga0307474_111343982 | 3300031718 | Hardwood Forest Soil | DANADDAARKKLMSRMNDLLNRRAYVRNLVVNVQKELS |
| Ga0307474_116050331 | 3300031718 | Hardwood Forest Soil | TAREWDAALDGDAVTRNKIKARLNELLNRRSYIRNLVTNVQKELL |
| Ga0307469_119278532 | 3300031720 | Hardwood Forest Soil | WDTAIDANASANDRKGIMVRLNELLNRRSYIRNLVTNVAKELL |
| Ga0307477_110743111 | 3300031753 | Hardwood Forest Soil | VALEADAATQKKIMAKLNDLLNRRSYVRNLVANVQKELL |
| Ga0307475_100016231 | 3300031754 | Hardwood Forest Soil | DADAGDANRKAIMVRLNELLNRRSYIRNLVTNVQKELL |
| Ga0307478_103414091 | 3300031823 | Hardwood Forest Soil | AALQADSATRKKIMAKLNDLLNRRSYIRNLVTNVQKELS |
| Ga0306925_107091482 | 3300031890 | Soil | IDANGAGEARKKLMARMNELLNRRSYLRNLVANVQKELAVS |
| Ga0310912_107040691 | 3300031941 | Soil | NGTGEARKKLMARMNELLNRRSYIRNLVTNVQKELAAS |
| Ga0310912_112759661 | 3300031941 | Soil | ADESARKQVMNRLNELLNRRSYVRNLVVSVQKELL |
| Ga0307479_108189422 | 3300031962 | Hardwood Forest Soil | NAAGEAHKKLMARMNELLNRRSYIRNLVANVAKELAEV |
| Ga0307479_109665402 | 3300031962 | Hardwood Forest Soil | QLQAAAREWDNALDGDAVKREKIMAKLNELLNRRSYIRNLVTNVQKELL |
| Ga0307479_110033281 | 3300031962 | Hardwood Forest Soil | ADSATRKKIMAKLNDLLNRRSYIRNLVTNVEKELL |
| Ga0307479_110543081 | 3300031962 | Hardwood Forest Soil | LQAAAREWDVALEADAATQKKIMAKLNDLLNRRSYVRNLVANVQKELL |
| Ga0307479_112040751 | 3300031962 | Hardwood Forest Soil | ALAGDAATRKKIMAQLNELLNRRSYIRNLVTNVQKELL |
| Ga0318525_103570431 | 3300032089 | Soil | GEARKKLMARMNQLLNRRSYIRNLVTNVQKELAAS |
| Ga0307471_1005131362 | 3300032180 | Hardwood Forest Soil | NAGDVDRKAIMVRLNELLNRRSYIRNLVTNVQKELQ |
| Ga0307471_1020222902 | 3300032180 | Hardwood Forest Soil | ALIGDAATRKKIMARLNELLNRRSYIRNLVTNVQKELV |
| Ga0306920_1025106071 | 3300032261 | Soil | AIDVHADDAGKKGVMARLNELLNRRSYIRNLVVNVQKELA |
| Ga0335069_117999402 | 3300032893 | Soil | QAAARDWDQAIDQNSDKVRRDAIKTRLNDLLNRRSYIRNLVVNVQKELL |
| Ga0335083_108342281 | 3300032954 | Soil | DSGAESADAERKKLMGRMNEALNRRSYVRNLVDSVERELAEV |
| Ga0310914_104611231 | 3300033289 | Soil | AKADAAARKGVMARLNELLNRRSYIRNLVVNVQKELA |
| Ga0326724_0647450_388_519 | 3300034091 | Peat Soil | EAIDAGADMPDRGKIMAQLNELLNRRSYIRNLVVNVQKELLGS |
| Ga0370484_0106933_592_732 | 3300034125 | Untreated Peat Soil | DAARDANASESDREAILQRLNELLNRRSYIRNLVAGVEKELEGASS |
| ⦗Top⦘ |