


| Basic Information | |
|---|---|
| Family ID | F043013 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 157 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MLLIIIIVLLILWTPGYYGYGRSRWGMGYGGDILTLLLIIVLLWAIFGGRL |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 157 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.17 % |
| % of genes near scaffold ends (potentially truncated) | 31.21 % |
| % of genes from short scaffolds (< 2000 bps) | 82.17 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.815 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.013 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.490 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.688 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.51% β-sheet: 0.00% Coil/Unstructured: 59.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 157 Family Scaffolds |
|---|---|---|
| PF01738 | DLH | 15.29 |
| PF01569 | PAP2 | 7.01 |
| PF14534 | DUF4440 | 5.73 |
| PF11752 | DUF3309 | 3.82 |
| PF00892 | EamA | 3.82 |
| PF13793 | Pribosyltran_N | 3.18 |
| PF08544 | GHMP_kinases_C | 2.55 |
| PF00072 | Response_reg | 1.27 |
| PF14572 | Pribosyl_synth | 1.27 |
| PF13474 | SnoaL_3 | 1.27 |
| PF01661 | Macro | 1.27 |
| PF05977 | MFS_3 | 1.27 |
| PF11528 | DUF3224 | 1.27 |
| PF05974 | DUF892 | 1.27 |
| PF01408 | GFO_IDH_MocA | 1.27 |
| PF07676 | PD40 | 1.27 |
| PF04239 | DUF421 | 1.27 |
| PF05960 | DUF885 | 1.27 |
| PF01433 | Peptidase_M1 | 1.27 |
| PF00719 | Pyrophosphatase | 0.64 |
| PF13091 | PLDc_2 | 0.64 |
| PF00501 | AMP-binding | 0.64 |
| PF13432 | TPR_16 | 0.64 |
| PF03551 | PadR | 0.64 |
| PF00578 | AhpC-TSA | 0.64 |
| PF07681 | DoxX | 0.64 |
| PF06983 | 3-dmu-9_3-mt | 0.64 |
| PF13620 | CarboxypepD_reg | 0.64 |
| PF07715 | Plug | 0.64 |
| PF01431 | Peptidase_M13 | 0.64 |
| PF05163 | DinB | 0.64 |
| PF00288 | GHMP_kinases_N | 0.64 |
| PF13414 | TPR_11 | 0.64 |
| PF03169 | OPT | 0.64 |
| PF12773 | DZR | 0.64 |
| PF03706 | LPG_synthase_TM | 0.64 |
| PF13450 | NAD_binding_8 | 0.64 |
| PF10066 | DUF2304 | 0.64 |
| PF00069 | Pkinase | 0.64 |
| PF12704 | MacB_PCD | 0.64 |
| PF02687 | FtsX | 0.64 |
| PF13544 | Obsolete Pfam Family | 0.64 |
| PF02597 | ThiS | 0.64 |
| PF12973 | Cupin_7 | 0.64 |
| PF06439 | 3keto-disac_hyd | 0.64 |
| PF04237 | YjbR | 0.64 |
| PF00056 | Ldh_1_N | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 157 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.55 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 1.27 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 1.27 |
| COG2323 | Uncharacterized membrane protein YcaP, DUF421 family | Function unknown [S] | 1.27 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.27 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 1.27 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 1.27 |
| COG0039 | Malate/lactate dehydrogenase | Energy production and conversion [C] | 0.64 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.64 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
| COG1297 | Predicted oligopeptide transporter, OPT family | General function prediction only [R] | 0.64 |
| COG1486 | Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase | Carbohydrate transport and metabolism [G] | 0.64 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.64 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.64 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.64 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.64 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.64 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.64 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.64 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.64 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.64 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.64 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.64 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.82 % |
| Unclassified | root | N/A | 3.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps_contig60254.37081 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300000956|JGI10216J12902_100996267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 747 | Open in IMG/M |
| 3300003321|soilH1_10033906 | All Organisms → cellular organisms → Bacteria | 4688 | Open in IMG/M |
| 3300004114|Ga0062593_100176712 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300004153|Ga0063455_100911859 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300004479|Ga0062595_100166480 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300004479|Ga0062595_101009973 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300005167|Ga0066672_10358255 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300005171|Ga0066677_10346327 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300005175|Ga0066673_10036027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2414 | Open in IMG/M |
| 3300005175|Ga0066673_10689620 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005178|Ga0066688_10294250 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300005179|Ga0066684_10718653 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 667 | Open in IMG/M |
| 3300005181|Ga0066678_10305550 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1042 | Open in IMG/M |
| 3300005184|Ga0066671_10005326 | All Organisms → cellular organisms → Bacteria | 4689 | Open in IMG/M |
| 3300005184|Ga0066671_10255132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1082 | Open in IMG/M |
| 3300005184|Ga0066671_10411440 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300005187|Ga0066675_10445149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 962 | Open in IMG/M |
| 3300005293|Ga0065715_10338469 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300005329|Ga0070683_100007651 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 9143 | Open in IMG/M |
| 3300005329|Ga0070683_100386792 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300005329|Ga0070683_102138690 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005344|Ga0070661_100906117 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300005345|Ga0070692_11214794 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005353|Ga0070669_100109463 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 2095 | Open in IMG/M |
| 3300005367|Ga0070667_100832504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 858 | Open in IMG/M |
| 3300005434|Ga0070709_10204699 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300005444|Ga0070694_100913043 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300005445|Ga0070708_100000076 | All Organisms → cellular organisms → Bacteria | 63230 | Open in IMG/M |
| 3300005451|Ga0066681_10189680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1226 | Open in IMG/M |
| 3300005454|Ga0066687_10474975 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005457|Ga0070662_100094404 | All Organisms → cellular organisms → Bacteria | 2252 | Open in IMG/M |
| 3300005467|Ga0070706_100163137 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
| 3300005467|Ga0070706_101576190 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005518|Ga0070699_100399300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1243 | Open in IMG/M |
| 3300005536|Ga0070697_100357916 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300005536|Ga0070697_100389235 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300005539|Ga0068853_101995904 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 563 | Open in IMG/M |
| 3300005549|Ga0070704_100415684 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300005549|Ga0070704_100523804 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1032 | Open in IMG/M |
| 3300005554|Ga0066661_10311636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 968 | Open in IMG/M |
| 3300005561|Ga0066699_10785558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300005563|Ga0068855_101430514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 712 | Open in IMG/M |
| 3300005575|Ga0066702_10527045 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300005577|Ga0068857_101334358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 697 | Open in IMG/M |
| 3300005614|Ga0068856_100525313 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300005614|Ga0068856_100841568 | All Organisms → cellular organisms → Bacteria → FCB group | 937 | Open in IMG/M |
| 3300005892|Ga0075275_1007551 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300006028|Ga0070717_11194389 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300006028|Ga0070717_11904855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300006175|Ga0070712_100130231 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300006175|Ga0070712_101132370 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300006852|Ga0075433_11196530 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 660 | Open in IMG/M |
| 3300006903|Ga0075426_11122470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300006954|Ga0079219_10038666 | All Organisms → cellular organisms → Bacteria | 1958 | Open in IMG/M |
| 3300009012|Ga0066710_100970935 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1310 | Open in IMG/M |
| 3300009012|Ga0066710_102643252 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300009093|Ga0105240_10100656 | All Organisms → cellular organisms → Bacteria | 3516 | Open in IMG/M |
| 3300009093|Ga0105240_11091097 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300009093|Ga0105240_11157621 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300009094|Ga0111539_11333559 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300009137|Ga0066709_101241347 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300009143|Ga0099792_10292840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 963 | Open in IMG/M |
| 3300009551|Ga0105238_10441095 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1298 | Open in IMG/M |
| 3300010146|Ga0126320_1391045 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300010323|Ga0134086_10368377 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 571 | Open in IMG/M |
| 3300010325|Ga0134064_10318397 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 598 | Open in IMG/M |
| 3300010326|Ga0134065_10338255 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 588 | Open in IMG/M |
| 3300010358|Ga0126370_10838997 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 823 | Open in IMG/M |
| 3300010364|Ga0134066_10039554 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1160 | Open in IMG/M |
| 3300010371|Ga0134125_10022980 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6949 | Open in IMG/M |
| 3300010371|Ga0134125_10032230 | All Organisms → cellular organisms → Bacteria | 5836 | Open in IMG/M |
| 3300010373|Ga0134128_10107143 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3175 | Open in IMG/M |
| 3300010373|Ga0134128_10115009 | All Organisms → cellular organisms → Bacteria | 3053 | Open in IMG/M |
| 3300010373|Ga0134128_11730009 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300010396|Ga0134126_10077584 | All Organisms → cellular organisms → Bacteria | 4116 | Open in IMG/M |
| 3300010396|Ga0134126_10747771 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1108 | Open in IMG/M |
| 3300012198|Ga0137364_10021245 | All Organisms → cellular organisms → Bacteria | 3997 | Open in IMG/M |
| 3300012198|Ga0137364_11374057 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 524 | Open in IMG/M |
| 3300012199|Ga0137383_10494896 | Not Available | 895 | Open in IMG/M |
| 3300012200|Ga0137382_10573061 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300012201|Ga0137365_11206375 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012204|Ga0137374_10074941 | All Organisms → cellular organisms → Bacteria | 3310 | Open in IMG/M |
| 3300012204|Ga0137374_10771598 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012206|Ga0137380_11180346 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300012207|Ga0137381_10871651 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 779 | Open in IMG/M |
| 3300012208|Ga0137376_10049382 | All Organisms → cellular organisms → Bacteria | 3436 | Open in IMG/M |
| 3300012208|Ga0137376_10426346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1152 | Open in IMG/M |
| 3300012208|Ga0137376_10705835 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 870 | Open in IMG/M |
| 3300012208|Ga0137376_10938599 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 742 | Open in IMG/M |
| 3300012209|Ga0137379_11077940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300012210|Ga0137378_11126967 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300012211|Ga0137377_11100128 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 725 | Open in IMG/M |
| 3300012285|Ga0137370_10128707 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300012285|Ga0137370_10138730 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1399 | Open in IMG/M |
| 3300012356|Ga0137371_10123189 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
| 3300012357|Ga0137384_11044365 | Not Available | 656 | Open in IMG/M |
| 3300012955|Ga0164298_10867488 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 653 | Open in IMG/M |
| 3300013104|Ga0157370_10610374 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300013104|Ga0157370_12017905 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300013105|Ga0157369_11698102 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300013296|Ga0157374_10026889 | All Organisms → cellular organisms → Bacteria | 5182 | Open in IMG/M |
| 3300013306|Ga0163162_10628201 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300013307|Ga0157372_10103052 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3260 | Open in IMG/M |
| 3300014157|Ga0134078_10375822 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 631 | Open in IMG/M |
| 3300014166|Ga0134079_10024336 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
| 3300014325|Ga0163163_10262295 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1779 | Open in IMG/M |
| 3300015265|Ga0182005_1219093 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 578 | Open in IMG/M |
| 3300015356|Ga0134073_10229454 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 631 | Open in IMG/M |
| 3300015371|Ga0132258_11742687 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1571 | Open in IMG/M |
| 3300015371|Ga0132258_12235111 | Not Available | 1373 | Open in IMG/M |
| 3300015371|Ga0132258_13176269 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1134 | Open in IMG/M |
| 3300015371|Ga0132258_13990052 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1002 | Open in IMG/M |
| 3300015373|Ga0132257_103588027 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300018482|Ga0066669_10175407 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300018482|Ga0066669_10517702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300018482|Ga0066669_11864358 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 558 | Open in IMG/M |
| 3300019874|Ga0193744_1051200 | Not Available | 790 | Open in IMG/M |
| 3300019888|Ga0193751_1191676 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300021384|Ga0213876_10471779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300021445|Ga0182009_10054790 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1700 | Open in IMG/M |
| 3300021445|Ga0182009_10325718 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 779 | Open in IMG/M |
| 3300021445|Ga0182009_10665879 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300021953|Ga0213880_10164307 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300025910|Ga0207684_10130844 | All Organisms → cellular organisms → Bacteria | 2154 | Open in IMG/M |
| 3300025910|Ga0207684_10155297 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1969 | Open in IMG/M |
| 3300025913|Ga0207695_10007624 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 13715 | Open in IMG/M |
| 3300025913|Ga0207695_10798352 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300025915|Ga0207693_10248435 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1396 | Open in IMG/M |
| 3300025920|Ga0207649_10749847 | Not Available | 760 | Open in IMG/M |
| 3300025922|Ga0207646_10035695 | All Organisms → cellular organisms → Bacteria | 4490 | Open in IMG/M |
| 3300025923|Ga0207681_10395439 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1115 | Open in IMG/M |
| 3300025930|Ga0207701_10605771 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 932 | Open in IMG/M |
| 3300025939|Ga0207665_10298052 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1204 | Open in IMG/M |
| 3300025944|Ga0207661_11910585 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300025949|Ga0207667_12060800 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300025949|Ga0207667_12061508 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300025981|Ga0207640_10123156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1862 | Open in IMG/M |
| 3300026078|Ga0207702_10210349 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1808 | Open in IMG/M |
| 3300026118|Ga0207675_100083092 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3003 | Open in IMG/M |
| 3300026300|Ga0209027_1007408 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4137 | Open in IMG/M |
| 3300026331|Ga0209267_1075008 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1472 | Open in IMG/M |
| 3300026552|Ga0209577_10755836 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 545 | Open in IMG/M |
| 3300027857|Ga0209166_10134970 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1354 | Open in IMG/M |
| 3300027903|Ga0209488_10690680 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 732 | Open in IMG/M |
| 3300028881|Ga0307277_10266010 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 758 | Open in IMG/M |
| 3300031716|Ga0310813_11152030 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300031820|Ga0307473_10372667 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 926 | Open in IMG/M |
| 3300031938|Ga0308175_100081928 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2913 | Open in IMG/M |
| 3300031962|Ga0307479_11185503 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300031996|Ga0308176_10299601 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1565 | Open in IMG/M |
| 3300032180|Ga0307471_102372857 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 670 | Open in IMG/M |
| 3300032421|Ga0310812_10001949 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 6678 | Open in IMG/M |
| 3300033412|Ga0310810_10117132 | All Organisms → cellular organisms → Bacteria | 3150 | Open in IMG/M |
| 3300033412|Ga0310810_10365113 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300033412|Ga0310810_11050652 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300033486|Ga0316624_11701768 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.01% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.73% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.73% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.55% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.27% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.64% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.64% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.64% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.64% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.64% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.64% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005892 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_00324710 | 2199352024 | Soil | MLLIIIIVLLLLWTPGYYGYGRSRWGMGNGGHGITLLLVIILLWALFSGRV |
| JGI10216J12902_1009962672 | 3300000956 | Soil | SRSPLPEVDMLLIIIIILLILWAPGYYGYGRSRWGMGYGGDIVTLLLIIILLWAIFGGRL |
| soilH1_100339064 | 3300003321 | Sugarcane Root And Bulk Soil | MLLIIIIVLLILWAPGYYGYGRRRWGLGYGGDILTLLLIIVLLWAIFGGRI* |
| Ga0062593_1001767122 | 3300004114 | Soil | MLLVIVIILLLIWTPGYYGYGRTRWGLGYGGHLLTLLLVILVIWLLIGGTTVR* |
| Ga0063455_1009118591 | 3300004153 | Soil | MLLIIIIVLLVLWAPGYYGYGRSRWGIGYGGDIVTLLLIIILLWAIFGGRL* |
| Ga0062595_1001664801 | 3300004479 | Soil | MLLIIIIVLLILWAPGYYGYGRRRWGLGYGGDILTLILIVVLLWVLF |
| Ga0062595_1010099731 | 3300004479 | Soil | MLLIIVIVLLLLWTPGYYGYGRTRWGLGNGGHVLTLILVIVLLWALFGGRM* |
| Ga0066672_103582552 | 3300005167 | Soil | MLLIIIIVLLILWAPGYYGYGRTRWRMGYGGDILTLLLIIILLWVIFGGRL* |
| Ga0066677_103463272 | 3300005171 | Soil | MLLVIIIILLLLWTPGYYGYGRSRWGLGGGGHIITVILIIVLLWALLGGRI* |
| Ga0066673_100360273 | 3300005175 | Soil | MLLIIIIVLLVLWTPGYYGYGRSRWGMGYGGDILTLLLVIILLWAIFGGGRI* |
| Ga0066673_106896202 | 3300005175 | Soil | MLLIIIIVLLILWAPGYYGYGRSRWGMGYGGDIVTLLLIIVLLWAIFGGRL* |
| Ga0066688_102942502 | 3300005178 | Soil | MLLIIIIILLILWAPGYYGYGRSRWGMGYGGDILTLLLIIILLWAIFGGRL* |
| Ga0066684_107186531 | 3300005179 | Soil | MLLIIIIILLILWAPGYYGYGRTRWGLGYGGDILTLLLIIILLWAIFGGRL* |
| Ga0066678_103055502 | 3300005181 | Soil | LILWAPGYYGYGRTRWRMGYGGDILTLLLIIILLWVIFGGRL* |
| Ga0066671_100053263 | 3300005184 | Soil | MLLIIIIILLILWAPGYYGYGRSRWGMGYGGDIVTLLLIIILLWAIFGGRL* |
| Ga0066671_102551321 | 3300005184 | Soil | MLLIIIIVLLVLWAPGYYGYGRSRWGIGYGGDIVTLLLIIILLW |
| Ga0066671_104114402 | 3300005184 | Soil | MLLIIIIVLLILWTPGYYGYGRSRWGMGYGGDILTLLLIIVLLWAIFGGRL* |
| Ga0066675_104451491 | 3300005187 | Soil | MLLIIIIVLLVLWTPGYYGYGRSRWGMGYGGDILTLLLVVILLWAIFGGGRI* |
| Ga0065715_103384692 | 3300005293 | Miscanthus Rhizosphere | LLIIIIVLLILWAPGYYGYGRRRWGLGYGGDILTLLLIIVLLWAIFGGRL* |
| Ga0070683_1000076517 | 3300005329 | Corn Rhizosphere | MLLIIVIVLLLLWTPGYYGYGRSRWGLGYGGHLLTLILVIVLLWALFGGRL* |
| Ga0070683_1003867922 | 3300005329 | Corn Rhizosphere | MLLIIIIVLLLLWTPGYYGYGRTRWGMGAGGHGVTLLLLIILLWALFSGRV* |
| Ga0070683_1021386901 | 3300005329 | Corn Rhizosphere | MLLIVIIVLLVLWTPGYYGYGRKRWGWGYGGDTLTLILVILLV |
| Ga0070661_1009061172 | 3300005344 | Corn Rhizosphere | MLLIVIIVLLVLWTPGYYGYGRKRWGWGYGGDTLTLILVILLVWALVGGQL* |
| Ga0070692_112147942 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLVIIIILLLLWTPGYYGYGRSRWGLGGGGHIITLILIVVLLWALLGGRI* |
| Ga0070669_1001094632 | 3300005353 | Switchgrass Rhizosphere | VLLIIIIVLLLLWTPGYYGYGRSRWGLGYGGHLLTLILVILLIWVLVGGRV* |
| Ga0070667_1008325042 | 3300005367 | Switchgrass Rhizosphere | MLLIIIIVLLLLWTPGYYGYGRTRWGFGYGGHFITLILVIVLIWALLGGRV* |
| Ga0070709_102046992 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIIVIVLLLLWTPGYYGYGRSRWGWGNGGHLITLVLVIVLLWVLFGGRM* |
| Ga0070694_1009130432 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIIIIVLLILWAPGYYGYGRRRWGLGYGGDILTLLLIIVLLWAIFGGRL* |
| Ga0070708_1000000761 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIIIIVLLILWAPGYYGYGRNRWGMGYGGDILTLLLIIILLWVIFGGRL* |
| Ga0066681_101896802 | 3300005451 | Soil | MLLIIIIVLLVLWAPGYYGYGRSRWGIGYGGDIVTLLLIMILLWAIFGGRL* |
| Ga0066687_104749752 | 3300005454 | Soil | MLLVIIIILLLLWTPGYYGYGRSRWGLGGGGHIITVILIVVLLWALLGGRI* |
| Ga0070662_1000944043 | 3300005457 | Corn Rhizosphere | VLLIIIVLLLLWTPGYYGYGRSRWGLGYGGHLLTLILVILLIWVLVGGRV* |
| Ga0070706_1001631372 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIIIIVLLILWAPGYYGYGRTRWRMGYGGDILTLLLIIIMLWVIFGGRM* |
| Ga0070706_1015761902 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIIIIILLLLWTPGYYGYGRTRWGLGYSGHFLTLVLVIVLLWALLSGRV* |
| Ga0070699_1003993001 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIIIIVLLILWAPGYYGYGRNRWGMGYGGDILTLLLIIILLW |
| Ga0070697_1003579162 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIIIIVLLILWAPGYYGYGRTRWGMGYGGDILTLLLIIVLLWAIFGGRL* |
| Ga0070697_1003892352 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIIIIVLLILWAPGYYGYGRTRWRMGYGGDILTLLLIIILLWAIFGGGRL* |
| Ga0068853_1019959042 | 3300005539 | Corn Rhizosphere | MLLIVIIVLLLLWTPGYYGYGRTRWGFGYGGHFITLILVIVLIWALLGGRV* |
| Ga0070704_1004156841 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VPFDEEVAVLLIIIIVLLLLWTPGYYGYGRSRWGLGYGGHLLTLILVILLIWALVGGRV* |
| Ga0070704_1005238041 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LLILWAPGYYGYGRRRWGLGYGGDILTLLLIIVLLWAIFGGRL* |
| Ga0066661_103116362 | 3300005554 | Soil | MLLIIIIVLLILWAPGYYGYGRTRWRMGYGGDILTLLLIIIL |
| Ga0066699_107855582 | 3300005561 | Soil | VLLIIIIILLILWTPGYYGYGRIRWGWGYGGDVFTLILIVLLVWLLVGGR* |
| Ga0068855_1014305141 | 3300005563 | Corn Rhizosphere | VLLIIIIVLLVLWTPGYYGYGRSRWGFGWGGDILTLILVIILIWALVGGRP* |
| Ga0066702_105270452 | 3300005575 | Soil | MLLVLIIILLVLWTPGYYGYGRKRWGIGYGGDVLTLILVIVLVWVLIGR* |
| Ga0068857_1013343582 | 3300005577 | Corn Rhizosphere | NVYEAPMLLIVIIVLLVLWTPGYYGYGRKRWGWGYGGDTLTLILVILLVWALVGGQL* |
| Ga0068856_1005253132 | 3300005614 | Corn Rhizosphere | MLLIIIIVLLVLWTPGYYGYGRTRWGIGYGGHFITLILVIVLIWALLGGRV* |
| Ga0068856_1008415681 | 3300005614 | Corn Rhizosphere | TPGYYGYGRTRWGLGYGGHLLTLLLVILVIWLLIGGTTVR* |
| Ga0075275_10075513 | 3300005892 | Rice Paddy Soil | MLLIIIIILLLLWTPGYYGYGRSRWGMGFGGDILTLILVIVLVWALIGR* |
| Ga0070717_111943892 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIIIIILLLLWTPGYYGYGRTRWGLGGGGHFVTLLLVIILLWALFSGRV* |
| Ga0070717_119048552 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIIIIILLVLWTPGYYGYGRTRWNFGYGGHFITLLLVIILIWALVSGRV* |
| Ga0070712_1001302314 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIIVIVLLLLWTPGYYGYGRSRWVWGNGGHLITLVLVIVLLWVLFGGRM* |
| Ga0070712_1011323702 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIIIIVLLILWAPGYYGYGRSRWGMGYGGDILTLLLIIVLLWAIFGGRL* |
| Ga0075433_111965301 | 3300006852 | Populus Rhizosphere | ILWAPGYYGYGRRRWGLGYGGDILTLLLIIVLLWAIFGGRL* |
| Ga0075426_111224703 | 3300006903 | Populus Rhizosphere | MLLIIIIVLLLLWTPGYYGYGRTRWGFGYGGHFITLILVIVLIW |
| Ga0079219_100386663 | 3300006954 | Agricultural Soil | MLLIIIIVLLILWAPGYYGYGRRRWGLGYGGDILTLL |
| Ga0066710_1009709352 | 3300009012 | Grasslands Soil | MLLIIIIILLILWAPGYYGYGRSRWGVGYGGDIVTLLLIIILLWAIFGGRL |
| Ga0066710_1026432523 | 3300009012 | Grasslands Soil | MLLIIIIVLLLLWAPGYYGYGRSRWGLGYGGDLLTLLLVIVLVWILVGGRV |
| Ga0105240_101006563 | 3300009093 | Corn Rhizosphere | VIDAFSSANVYEAPMLLIVIIVLLVLWTPGYYGYGRKRWGWGYGGDTLTLILVILLVWALVGGQL* |
| Ga0105240_110910973 | 3300009093 | Corn Rhizosphere | VPFDEEVAVLLIIIIVLLLLWTPGYYGYGRSRWGLGYGGHLLTLILVILLIWVLVGGRV* |
| Ga0105240_111576212 | 3300009093 | Corn Rhizosphere | MLLIIIIIVLVLWAPGYYGYGRRRWGLGCGGDVLTLILVLVLLWAIFGV* |
| Ga0111539_113335592 | 3300009094 | Populus Rhizosphere | VPFDEEVAVLLIIIVLLLLWTPGYYGYGRSRWGLGYGGHLLTLILVILLIWVLVGGRV* |
| Ga0066709_1012413473 | 3300009137 | Grasslands Soil | MLLIIIIVLLLLWAPGYYGYGRSRWGLGYGGDLLTLLLVIVLVWILVGGRV* |
| Ga0099792_102928402 | 3300009143 | Vadose Zone Soil | MLLIIIIVLLVLWAPGYYGYGRSRWGIGYGGDILTLLLIIILLWAIFGGRL* |
| Ga0105238_104410952 | 3300009551 | Corn Rhizosphere | MLLIIIIVLLVLWTPGYYGYGRTRWGIGYGGHFITLILVIVLIWALLVGRV* |
| Ga0126320_13910452 | 3300010146 | Soil | MLLIIIIVLLILWTPGYYGYGRSRWGLGFGGDILTLLLIIVLLWAIFGGRL* |
| Ga0134086_103683772 | 3300010323 | Grasslands Soil | FSIPHREVDMLLIIIIILLILWAPGYYGYGRSRWGMGYGGDIVTLLLIIILLWAIFGGRL |
| Ga0134064_103183971 | 3300010325 | Grasslands Soil | MLLIIIIVLLVLWAPGYYGYGRSRWGIGYGGDIVTLLLIIILL |
| Ga0134065_103382551 | 3300010326 | Grasslands Soil | MLLIIIIVLLVLWAPGYYGYGRSCWGIGYGGDIVTLLLIIILLWAIFGGRL* |
| Ga0126370_108389972 | 3300010358 | Tropical Forest Soil | LIIIIVMLLLWTPGYYGYGRSRWGIGYGGHFITLILIIVLIWALLGGRI* |
| Ga0134066_100395542 | 3300010364 | Grasslands Soil | MLLIIIIILLILWAPGYYGYGRTRWGMGYGGDILTLLLIIVLLWAIFGGRL* |
| Ga0134125_100229805 | 3300010371 | Terrestrial Soil | MLLIIIIVLLVVWAPGYYGYGRRRWGLGLGGDALTLILIIVLLWAIFGSGRL* |
| Ga0134125_100322302 | 3300010371 | Terrestrial Soil | MLLIIIIVLLVLWAPGYYGYGRRRWGLGLGGDALTLILIIVLLWAIFGSGRL* |
| Ga0134128_101071434 | 3300010373 | Terrestrial Soil | MLLIIIIILLVLWTPGYYGYGRSRWGFGYGGDLLTLILVIILIWALVGGRI* |
| Ga0134128_101150096 | 3300010373 | Terrestrial Soil | MLLIIIIIVLVLWAPGYYGYGRRRWGLGCGGDVLTLILVLVLLWAIFGGGRY* |
| Ga0134128_117300092 | 3300010373 | Terrestrial Soil | IIVLLVLWTPGYYGYGRKRWGWGYGGDTLTLILVILLVWALVGGQL* |
| Ga0134126_100775843 | 3300010396 | Terrestrial Soil | MLLIIIIVLLVLWTPGYYGYGRSRWGWGFGGDLLTLILIIILIWAILGR* |
| Ga0134126_107477712 | 3300010396 | Terrestrial Soil | MLLIIIIVLLILWAPGYYGYGRRRWGLGYGGDILTLILIVVLLWVLFGGGRI* |
| Ga0137364_100212454 | 3300012198 | Vadose Zone Soil | MLLIIIIILLILWAPGYYGYGRSRWGVGYGGDIVTLLLIIILLWAIFGGRL* |
| Ga0137364_113740572 | 3300012198 | Vadose Zone Soil | YPRFPLPEVDMLLIIIIVLLVLWTPGYYGYGRSRWGMGYGGDIVTLLLIIVLLWVIFGARL* |
| Ga0137383_104948963 | 3300012199 | Vadose Zone Soil | MLLIIVIVLLLLWTPGYYGYGRSRWGLGNGGHVLTLILVVVLLWALLGGRT* |
| Ga0137382_105730613 | 3300012200 | Vadose Zone Soil | LIIIIILLILWAPGYYGYGRTRWGMGYGGDIHTLLLIIVLLWAIFGGRL* |
| Ga0137365_112063751 | 3300012201 | Vadose Zone Soil | MLLIIIIILLILWAPGYYGYGRTRWGMGYGGDILTLLLIIILLWAIFGGRL* |
| Ga0137374_100749415 | 3300012204 | Vadose Zone Soil | MLLIIIIVLLLLWTPGYYGYGRTRWALGRGGDLLTVILVIVLLWALLNGRI* |
| Ga0137374_107715983 | 3300012204 | Vadose Zone Soil | MLLIIIIVLLLLWTPGYYGYGRTRWGMGRGGDLLTVILVIVLLWALLNGRI* |
| Ga0137380_111803462 | 3300012206 | Vadose Zone Soil | MLLVIIIILLLLWTPGYYGYGRSRWGLGGGGHTITVILVIVLLWVLLSGRI* |
| Ga0137381_108716512 | 3300012207 | Vadose Zone Soil | MLLIIIIILLILWAPGYYGYGRSRWGMGYGGHGLTLLLVIILLWAIFRGRL* |
| Ga0137376_100493825 | 3300012208 | Vadose Zone Soil | MLLIIIIVLLVLWTPGYYGYGRSRWGIGYGGDILTLLLIIVLLWVIFGARL* |
| Ga0137376_104263462 | 3300012208 | Vadose Zone Soil | MLLIIIIVLLVLWTPGYYGYGRSRWGMGYGGDILTLLLVIILLWVIFGGGRV* |
| Ga0137376_107058352 | 3300012208 | Vadose Zone Soil | MLLIIIIILLILWAPGYYGYGRSRWGMGSGGEIVTLLLIIILLWAIFGGRL* |
| Ga0137376_109385991 | 3300012208 | Vadose Zone Soil | MLLIIVIVLLLLWTPGYYGYGRSRWGLGNGGHVLTLILVV |
| Ga0137379_110779401 | 3300012209 | Vadose Zone Soil | LLWTPGYYGYGRTRWGWGRGGDALTLILVIVLVLALLGRI* |
| Ga0137378_111269672 | 3300012210 | Vadose Zone Soil | MLLIIIIVLLLLWTPGYYGYGRTRWGLGNGGHLLTLILVIVLIWILLGGRA* |
| Ga0137377_111001282 | 3300012211 | Vadose Zone Soil | MLLIIIIILLILWAPGYYGYGRSRWRMGYGGDILTLLLIIVLLWAIFGGRL* |
| Ga0137370_101287072 | 3300012285 | Vadose Zone Soil | MLLIIIIVLLVLWTPGYYGYGRSRWGMSYGGDIVTLLLIIVLLWVIFGARL* |
| Ga0137370_101387302 | 3300012285 | Vadose Zone Soil | MLLIIIIVLLILWAPGYYGYGRRRWGLGYGGDILTLLLIVVLLWAIFGGRL* |
| Ga0137371_101231891 | 3300012356 | Vadose Zone Soil | ILLILWAPGYYGYGRTRWGMGYGGDILTLLLIIILLWAIFGGRL* |
| Ga0137384_110443651 | 3300012357 | Vadose Zone Soil | IVLLLLWMPGYYGYGRSRWGLGNGGHVLTLILVVVLLWALLGGRT* |
| Ga0164298_108674882 | 3300012955 | Soil | MLLVIIIILLLLWTPGYYGYGRSRWGLGGGGHIVTVILIVVLLWALLGGRI* |
| Ga0157370_106103741 | 3300013104 | Corn Rhizosphere | MLLVIVIILLLIWTPGYYGYGRTRWGLGYGGHLLTL |
| Ga0157370_120179051 | 3300013104 | Corn Rhizosphere | MLLVIVIILLLIWAPGYYGYGRTRWGLGYGGHLLTL |
| Ga0157369_116981023 | 3300013105 | Corn Rhizosphere | MLLIIIIVLLLLWTPGYYGYGRTRWGFGYGGHFITLILVIILIWALLGGRI* |
| Ga0157374_100268897 | 3300013296 | Miscanthus Rhizosphere | MLLVIIIILLLLWTPGYYGYGRSRWGLGGGGHIITLILIVVLLWALLGGKI* |
| Ga0163162_106282013 | 3300013306 | Switchgrass Rhizosphere | MLLIVIIVLLLLWTPGYYGYGRTRWGFGYGGHFITLILVIVLIW |
| Ga0157372_101030522 | 3300013307 | Corn Rhizosphere | MLLVIVIILLLIWAPGYYGYGRTRWGLGYGGHLLTLLLVILVIWLLIGGTTLR* |
| Ga0134078_103758222 | 3300014157 | Grasslands Soil | MLLIIIIVLLVLWAPGYYGYGRSRWGIGYGGDIVTLLLIIIL |
| Ga0134079_100243363 | 3300014166 | Grasslands Soil | LTEVDMLLIIIIVLLVLWTPGYYGYGRSRWGMGYGGDILTLLLVIILLWAIFGGGRI* |
| Ga0163163_102622951 | 3300014325 | Switchgrass Rhizosphere | GYYGYGRTRWGFGYGGHFITLILVIVLIWALLGGRV* |
| Ga0182005_12190931 | 3300015265 | Rhizosphere | SYYGYGRTRWNWGYGGHTITLILVIILIWALVSGRV* |
| Ga0134073_102294541 | 3300015356 | Grasslands Soil | MLLIIIIVLLVLWAPGYYGYGRSRWGIGYGGDIVTLLLIII |
| Ga0132258_117426873 | 3300015371 | Arabidopsis Rhizosphere | MLLIIIIVLLLLWTPGYYGYGRTIWGFGYGGHFITLILVIVLIWALLGGRI* |
| Ga0132258_122351112 | 3300015371 | Arabidopsis Rhizosphere | MLLIIVIVLLLLWTPGYYGYGRTRWGLGNGGHVLTLIFVIVLLWALFGGRM* |
| Ga0132258_131762692 | 3300015371 | Arabidopsis Rhizosphere | MLLITIIVLLLLWTPGYYGYGRTRWGLGYGGHLLTLLLVILLIWVLVGGRV* |
| Ga0132258_139900522 | 3300015371 | Arabidopsis Rhizosphere | LLLWTPGYYGYGRTRWGFGYGGHFITLILVIVLIWALLGGRA* |
| Ga0132257_1035880272 | 3300015373 | Arabidopsis Rhizosphere | MLLVIIIVLLLLWTPGYYGYGRTRWGFGYGGHFITLILVIVLIWALLGGRI* |
| Ga0066669_101754072 | 3300018482 | Grasslands Soil | MLLIIIIVLLVLWAPGYYGYGRSRWGIGYGGDIVTLLLIIILLWAIFGGRL |
| Ga0066669_105177022 | 3300018482 | Grasslands Soil | MLLIIIIVLLVLWTPGYYGYGRSRWGMGYGGDILTLLLVIILLWAIFGGGRI |
| Ga0066669_118643582 | 3300018482 | Grasslands Soil | WEPGYYGYGRRRWGMGYGGVILTLLLVIILLWVIFGGGRV |
| Ga0193744_10512001 | 3300019874 | Soil | VLLIVLIILLLLWTPGYYGYGRQRMNLGYGGHAITVILIVVLVLA |
| Ga0193751_11916762 | 3300019888 | Soil | MLLVIIIILLLLWTPGYYGYGRSRWGLGGGGHTITVILVIVLLWVLLSGRI |
| Ga0213876_104717792 | 3300021384 | Plant Roots | IIVLLVLWTPGYYGYGRSRWGIGYGGDILTLILVIVLIWVLIGGRP |
| Ga0182009_100547902 | 3300021445 | Soil | MLLIIIIVLLLLWTPGYYGYGRTRWGFGYGGHFITLILVIVLIWALVGGRV |
| Ga0182009_103257182 | 3300021445 | Soil | MLLIIIIVLLLLWTPGYYGYGRTRWGFGYGGHFITLILVIVLIWALLGGRV |
| Ga0182009_106658791 | 3300021445 | Soil | MLLIIIIVLLLLWTPGYYGYGRTRWGFGYGGHFITLILVIILIWALLGGRI |
| Ga0213880_101643071 | 3300021953 | Exposed Rock | QGANTMLLIIVIILLLLWTPGYYGYGRSRWGIGYGGDIVTLLLVIIVIWVLIGR |
| Ga0207684_101308443 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIILIVLLLLWTPGYYGYGRSRWGWGNGGHLITLVLVIVLLWVLFGGRM |
| Ga0207684_101552972 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIIIIVLLILWAPGYYGYGRTRWRMGYGGDILTLLLIIIMLWVIFGGRM |
| Ga0207695_1000762415 | 3300025913 | Corn Rhizosphere | MLLIIVIVLLLLWTPGYYGYGRSRWGLGYGGHLLTLILVIVLLWALFGGRL |
| Ga0207695_107983522 | 3300025913 | Corn Rhizosphere | MLLIVIIVLLVLWTPGYYGYGRKRWGWGYGGDTLTLILVILLVWALVGGQL |
| Ga0207693_102484351 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIIVIVLLLLWTPGYYGYGRSRWVWGNGGHLITLVLVIVLLW |
| Ga0207649_107498472 | 3300025920 | Corn Rhizosphere | LLWTPGYYGYGRSRWGLGYGGHLLTLILVIVLLWALFGGRL |
| Ga0207646_100356951 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIIIIVLLILWAPGYYGYGRNRWGMGYGGDILTLLLIIILLWVIFGGRL |
| Ga0207681_103954392 | 3300025923 | Switchgrass Rhizosphere | VPFDEEVAVLLIIIIVLLLLWTPGYYGYGRSRWGLGYGGHLLTLILVILLIWVLVGGRV |
| Ga0207701_106057712 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLIVIIVLLLLWTPGYYGYGRTRWGFGYGGHFITLILVIVLIWALLGGRV |
| Ga0207665_102980522 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLREDGMLLIIIIVLLILWAPGYYGYGRTRWGMGYGGDILTLLLIIVLLWAIFGGRL |
| Ga0207661_119105852 | 3300025944 | Corn Rhizosphere | MLLIVIIVLLVLWTPGYYGYGRKRWGWGYGGDTLTLILVILLVW |
| Ga0207667_120608002 | 3300025949 | Corn Rhizosphere | VLLIIIIVLLVLWTPGYYGYGRSRWGFGWGGDILTLILVIILIWALVGGRP |
| Ga0207667_120615081 | 3300025949 | Corn Rhizosphere | MLLIIIIVLLLLWTPGYYGYGRRRWRMGYGGDFLTLILVI |
| Ga0207640_101231564 | 3300025981 | Corn Rhizosphere | MLLIIIIVLLILWAPGYYGYGRRRWGLGYGGDILTLLLIIVLLWAIFGGRL |
| Ga0207702_102103492 | 3300026078 | Corn Rhizosphere | MLLIIIIVLLVLWTPGYYGYGRTRWGIGYGGHFITLILVIVLIWALLGGRV |
| Ga0207675_1000830921 | 3300026118 | Switchgrass Rhizosphere | VPFDEEVAVLLIIIVLLLLWTPGYYGYGRSRWGLGYGGHLLTLILVILLI |
| Ga0209027_10074083 | 3300026300 | Grasslands Soil | MLLIIIIILLILWAPGYYGYGRSRWGMGYGGDIVTLLLIIILLWAIFGGRL |
| Ga0209267_10750082 | 3300026331 | Soil | MLLIIIIVLLILWAPGYYGYGRTRWRMGYGGDILTLLLIIILLWVIFGGRL |
| Ga0209577_107558362 | 3300026552 | Soil | MLLIIIIVLLILWAPGYYGYGRTRWRMGYGGDILTLLLIII |
| Ga0209166_101349701 | 3300027857 | Surface Soil | MLLILIIVLLVLWTPGYYGYGRSRWGFGFGGDILTLILVLILIWALIGR |
| Ga0209488_106906802 | 3300027903 | Vadose Zone Soil | MLLIIIIVLLVLWAPGYYGYGRSRWGIGYGGDILTLLLIIILLWAIFGGRL |
| Ga0307277_102660101 | 3300028881 | Soil | VLLIIIIVLLILWAPGYYGYGRRRWGLGYGGDILTLLLIIVLLWVIFGGRI |
| Ga0310813_111520302 | 3300031716 | Soil | MLLVIVIILLLIWTPGYYGYGRTRWGLGYGGHLLTLLLVILVIWLLIGGTTVR |
| Ga0307473_103726672 | 3300031820 | Hardwood Forest Soil | MLLIIIIVLLILWAPGYYGYGRTRWRMGYGGDILTLLLIIILLWAIFGGGRL |
| Ga0308175_1000819282 | 3300031938 | Soil | MLLIIVIVLLLLWTPGYYGYGRSRWGLGYGGHLLTLILVIVLLWALFGGRM |
| Ga0307479_111855032 | 3300031962 | Hardwood Forest Soil | MLLIIIIILLLLWTPGYYGYGRRRWGFGYGGDLLTLILIIVLLWALFGGRM |
| Ga0308176_102996011 | 3300031996 | Soil | MLLIIIIVLLLLWTPGYYGYGRSRLNWGYGGHLITLIL |
| Ga0307471_1023728572 | 3300032180 | Hardwood Forest Soil | MLLIIIIILLILWAPGYYGYGRTRWGMGYGGDVLTLILIIVLLWAIFGGRL |
| Ga0310812_100019498 | 3300032421 | Soil | LLLWTPGYYGYGRTRWGFGYGGHFITLILVIVLIWALLGGRV |
| Ga0310810_101171325 | 3300033412 | Soil | MLLIIVIILLLIWAPGYYGYGRHRWGLGYGGHFLTILLVILVLWLLFARGGL |
| Ga0310810_103651132 | 3300033412 | Soil | ILLLIWTPGYYGYGRTRWGLGYGGHLLTLLLVILVIWLLIGGTTVR |
| Ga0310810_110506521 | 3300033412 | Soil | MLLIIVIILLVLWTPGYYGYGRSRWGIGYGGDLMTLILVILVIWLLIGR |
| Ga0316624_117017681 | 3300033486 | Soil | IILLLIWTPGYHFYGRRRWGLGCGGHVLTLLLVILVLWLLLGGRY |
| ⦗Top⦘ |