


| Basic Information | |
|---|---|
| Family ID | F042985 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 157 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MRRVLRKSIPFVQAALIGTLAAAALAGVAMLISHS |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 157 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.34 % |
| % of genes near scaffold ends (potentially truncated) | 17.83 % |
| % of genes from short scaffolds (< 2000 bps) | 73.25 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.611 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland (14.013 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.675 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.866 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.38% β-sheet: 0.00% Coil/Unstructured: 47.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 157 Family Scaffolds |
|---|---|---|
| PF13419 | HAD_2 | 21.02 |
| PF00892 | EamA | 16.56 |
| PF04116 | FA_hydroxylase | 7.01 |
| PF05656 | DUF805 | 1.91 |
| PF00696 | AA_kinase | 1.91 |
| PF14805 | THDPS_N_2 | 1.27 |
| PF01757 | Acyl_transf_3 | 1.27 |
| PF01593 | Amino_oxidase | 0.64 |
| PF00535 | Glycos_transf_2 | 0.64 |
| PF07813 | LTXXQ | 0.64 |
| PF02911 | Formyl_trans_C | 0.64 |
| PF05199 | GMC_oxred_C | 0.64 |
| PF00474 | SSF | 0.64 |
| PF11295 | DUF3096 | 0.64 |
| PF13000 | Acatn | 0.64 |
| PF01546 | Peptidase_M20 | 0.64 |
| PF01926 | MMR_HSR1 | 0.64 |
| PF01416 | PseudoU_synth_1 | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 157 Family Scaffolds |
|---|---|---|---|
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 7.01 |
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 2.55 |
| COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 1.91 |
| COG0101 | tRNA U38,U39,U40 pseudouridine synthase TruA | Translation, ribosomal structure and biogenesis [J] | 0.64 |
| COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.64 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.61 % |
| Unclassified | root | N/A | 27.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459004|F62QY1Z01CFAD0 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 513 | Open in IMG/M |
| 3300001356|JGI12269J14319_10030464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3600 | Open in IMG/M |
| 3300001356|JGI12269J14319_10244796 | Not Available | 672 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100329691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1408 | Open in IMG/M |
| 3300005534|Ga0070735_10109990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1729 | Open in IMG/M |
| 3300005534|Ga0070735_10215002 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1173 | Open in IMG/M |
| 3300005541|Ga0070733_10016525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10 | 4618 | Open in IMG/M |
| 3300005541|Ga0070733_10751468 | Not Available | 655 | Open in IMG/M |
| 3300005548|Ga0070665_100443300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1308 | Open in IMG/M |
| 3300005602|Ga0070762_10200004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1222 | Open in IMG/M |
| 3300005602|Ga0070762_10922766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300005764|Ga0066903_101199923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1409 | Open in IMG/M |
| 3300005764|Ga0066903_101326569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1346 | Open in IMG/M |
| 3300005764|Ga0066903_102615497 | Not Available | 978 | Open in IMG/M |
| 3300005764|Ga0066903_104474992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300006050|Ga0075028_100382828 | Not Available | 801 | Open in IMG/M |
| 3300006176|Ga0070765_101097347 | Not Available | 752 | Open in IMG/M |
| 3300006893|Ga0073928_10189506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1620 | Open in IMG/M |
| 3300006953|Ga0074063_13515592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1421 | Open in IMG/M |
| 3300009518|Ga0116128_1199188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300009525|Ga0116220_10501665 | Not Available | 551 | Open in IMG/M |
| 3300009632|Ga0116102_1163022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300009637|Ga0116118_1124757 | Not Available | 848 | Open in IMG/M |
| 3300009639|Ga0116122_1199327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300009640|Ga0116126_1055155 | Not Available | 1541 | Open in IMG/M |
| 3300009643|Ga0116110_1045280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1594 | Open in IMG/M |
| 3300009645|Ga0116106_1228890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300009764|Ga0116134_1018503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2864 | Open in IMG/M |
| 3300009764|Ga0116134_1174045 | Not Available | 754 | Open in IMG/M |
| 3300009824|Ga0116219_10417035 | Not Available | 748 | Open in IMG/M |
| 3300010048|Ga0126373_10466615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1300 | Open in IMG/M |
| 3300010339|Ga0074046_10396331 | Not Available | 834 | Open in IMG/M |
| 3300010343|Ga0074044_10640672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300010373|Ga0134128_12556302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300010376|Ga0126381_101800488 | Not Available | 884 | Open in IMG/M |
| 3300010379|Ga0136449_100039442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 11047 | Open in IMG/M |
| 3300010379|Ga0136449_100222841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3545 | Open in IMG/M |
| 3300010379|Ga0136449_104492110 | Not Available | 513 | Open in IMG/M |
| 3300012089|Ga0153924_1010764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2083 | Open in IMG/M |
| 3300012177|Ga0153943_1053812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 848 | Open in IMG/M |
| 3300012180|Ga0153974_1104838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
| 3300012181|Ga0153922_1166784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300012985|Ga0164308_10842049 | Not Available | 803 | Open in IMG/M |
| 3300014156|Ga0181518_10035335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3171 | Open in IMG/M |
| 3300014159|Ga0181530_10199747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1101 | Open in IMG/M |
| 3300014160|Ga0181517_10050182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2576 | Open in IMG/M |
| 3300014162|Ga0181538_10306025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 862 | Open in IMG/M |
| 3300014165|Ga0181523_10629909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300014169|Ga0181531_10693809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 633 | Open in IMG/M |
| 3300014169|Ga0181531_11055381 | Not Available | 511 | Open in IMG/M |
| 3300014199|Ga0181535_10027398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 4338 | Open in IMG/M |
| 3300014199|Ga0181535_10659156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 597 | Open in IMG/M |
| 3300014201|Ga0181537_10600244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300014325|Ga0163163_10447376 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300014489|Ga0182018_10126249 | Not Available | 1478 | Open in IMG/M |
| 3300014501|Ga0182024_11880125 | Not Available | 666 | Open in IMG/M |
| 3300014655|Ga0181516_10340844 | Not Available | 763 | Open in IMG/M |
| 3300014838|Ga0182030_10199381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2399 | Open in IMG/M |
| 3300015371|Ga0132258_10828485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2334 | Open in IMG/M |
| 3300015371|Ga0132258_11441718 | Not Available | 1739 | Open in IMG/M |
| 3300016294|Ga0182041_12058611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| 3300016371|Ga0182034_11194666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300016371|Ga0182034_11724760 | Not Available | 551 | Open in IMG/M |
| 3300017823|Ga0187818_10176483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 931 | Open in IMG/M |
| 3300017823|Ga0187818_10412048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 601 | Open in IMG/M |
| 3300017925|Ga0187856_1001088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 22408 | Open in IMG/M |
| 3300017925|Ga0187856_1003700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10536 | Open in IMG/M |
| 3300017940|Ga0187853_10519392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300017941|Ga0187850_10216613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 871 | Open in IMG/M |
| 3300017943|Ga0187819_10054655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2370 | Open in IMG/M |
| 3300017946|Ga0187879_10323533 | Not Available | 856 | Open in IMG/M |
| 3300017955|Ga0187817_10417293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 856 | Open in IMG/M |
| 3300017955|Ga0187817_10822030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300017955|Ga0187817_11019103 | Not Available | 531 | Open in IMG/M |
| 3300017970|Ga0187783_10654529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 759 | Open in IMG/M |
| 3300017972|Ga0187781_10000452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 29172 | Open in IMG/M |
| 3300017972|Ga0187781_10009712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6945 | Open in IMG/M |
| 3300017972|Ga0187781_10081664 | Not Available | 2233 | Open in IMG/M |
| 3300017972|Ga0187781_10088424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2143 | Open in IMG/M |
| 3300017972|Ga0187781_10402821 | Not Available | 977 | Open in IMG/M |
| 3300017972|Ga0187781_11005819 | Not Available | 610 | Open in IMG/M |
| 3300017973|Ga0187780_10016496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5350 | Open in IMG/M |
| 3300017973|Ga0187780_10448204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 919 | Open in IMG/M |
| 3300017975|Ga0187782_10066766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2623 | Open in IMG/M |
| 3300017975|Ga0187782_10289033 | Not Available | 1236 | Open in IMG/M |
| 3300017975|Ga0187782_10378341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1074 | Open in IMG/M |
| 3300017975|Ga0187782_10461942 | Not Available | 968 | Open in IMG/M |
| 3300017975|Ga0187782_10670414 | Not Available | 799 | Open in IMG/M |
| 3300017975|Ga0187782_10986032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300017988|Ga0181520_10002311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 35785 | Open in IMG/M |
| 3300018008|Ga0187888_1040696 | Not Available | 2211 | Open in IMG/M |
| 3300018013|Ga0187873_1181159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300018013|Ga0187873_1381338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300018017|Ga0187872_10217292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 873 | Open in IMG/M |
| 3300018033|Ga0187867_10252795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 992 | Open in IMG/M |
| 3300018042|Ga0187871_10107775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1601 | Open in IMG/M |
| 3300018057|Ga0187858_10083343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2207 | Open in IMG/M |
| 3300018058|Ga0187766_10631058 | Not Available | 734 | Open in IMG/M |
| 3300018060|Ga0187765_10833710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300018062|Ga0187784_10000458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 29829 | Open in IMG/M |
| 3300018085|Ga0187772_10052927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2499 | Open in IMG/M |
| 3300018085|Ga0187772_11458829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300018086|Ga0187769_10067407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2517 | Open in IMG/M |
| 3300018086|Ga0187769_10188564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1523 | Open in IMG/M |
| 3300020579|Ga0210407_10010058 | All Organisms → cellular organisms → Bacteria | 7057 | Open in IMG/M |
| 3300020582|Ga0210395_10012784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6220 | Open in IMG/M |
| 3300021168|Ga0210406_10193063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1691 | Open in IMG/M |
| 3300021388|Ga0213875_10412347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300021406|Ga0210386_11017610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 706 | Open in IMG/M |
| 3300022525|Ga0242656_1029710 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 867 | Open in IMG/M |
| 3300022557|Ga0212123_10115587 | Not Available | 2149 | Open in IMG/M |
| 3300022881|Ga0224545_1027201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 818 | Open in IMG/M |
| 3300025459|Ga0208689_1093587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300025460|Ga0208562_1074527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300025919|Ga0207657_10449532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1011 | Open in IMG/M |
| 3300026095|Ga0207676_12154892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300027504|Ga0209114_1079149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300027570|Ga0208043_1004274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5063 | Open in IMG/M |
| 3300027652|Ga0209007_1002319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 5447 | Open in IMG/M |
| 3300027698|Ga0209446_1117096 | Not Available | 686 | Open in IMG/M |
| 3300027703|Ga0207862_1216864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300027783|Ga0209448_10082762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1076 | Open in IMG/M |
| 3300027795|Ga0209139_10324464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129 | 540 | Open in IMG/M |
| 3300027867|Ga0209167_10275198 | Not Available | 907 | Open in IMG/M |
| 3300027908|Ga0209006_11037328 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
| 3300027986|Ga0209168_10148157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1191 | Open in IMG/M |
| 3300028792|Ga0307504_10299798 | Not Available | 605 | Open in IMG/M |
| 3300029910|Ga0311369_10667955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 857 | Open in IMG/M |
| 3300029999|Ga0311339_10668698 | Not Available | 1021 | Open in IMG/M |
| 3300030617|Ga0311356_10810472 | Not Available | 888 | Open in IMG/M |
| 3300030659|Ga0316363_10026839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3010 | Open in IMG/M |
| 3300030707|Ga0310038_10007142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7698 | Open in IMG/M |
| 3300030813|Ga0265750_1054481 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300030862|Ga0265753_1122689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300031234|Ga0302325_10904472 | Not Available | 1224 | Open in IMG/M |
| 3300031544|Ga0318534_10461875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 727 | Open in IMG/M |
| 3300031670|Ga0307374_10016045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9991 | Open in IMG/M |
| 3300031680|Ga0318574_10365122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 842 | Open in IMG/M |
| 3300031708|Ga0310686_102373482 | Not Available | 775 | Open in IMG/M |
| 3300031708|Ga0310686_103776202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300031708|Ga0310686_110359664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300031708|Ga0310686_113548373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3133 | Open in IMG/M |
| 3300031708|Ga0310686_115298383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 920 | Open in IMG/M |
| 3300031823|Ga0307478_11012564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300031942|Ga0310916_10152280 | Not Available | 1909 | Open in IMG/M |
| 3300032059|Ga0318533_10156424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium HGW-Alphaproteobacteria-3 | 1616 | Open in IMG/M |
| 3300032180|Ga0307471_104078120 | Not Available | 516 | Open in IMG/M |
| 3300032261|Ga0306920_100360903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2161 | Open in IMG/M |
| 3300032261|Ga0306920_101017219 | Not Available | 1206 | Open in IMG/M |
| 3300032770|Ga0335085_10011989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12806 | Open in IMG/M |
| 3300032805|Ga0335078_10056084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5808 | Open in IMG/M |
| 3300032893|Ga0335069_10163744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2743 | Open in IMG/M |
| 3300032893|Ga0335069_10195732 | Not Available | 2467 | Open in IMG/M |
| 3300032897|Ga0335071_11145903 | Not Available | 723 | Open in IMG/M |
| 3300032898|Ga0335072_10146653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2903 | Open in IMG/M |
| 3300033402|Ga0326728_11143143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300033755|Ga0371489_0000043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 255228 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 14.01% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.64% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 7.64% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 7.01% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.73% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.82% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.82% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.18% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.55% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 2.55% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.91% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.27% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.27% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.27% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.27% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.27% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.64% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.64% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.64% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.64% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.64% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.64% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.64% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.64% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459004 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2) | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012089 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG | Host-Associated | Open in IMG/M |
| 3300012177 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaG | Host-Associated | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4B_05251970 | 2170459004 | Grass Soil | MRRVLRKSIPFVQAALIGTLAAAAVAGVAMLISHS |
| JGI12269J14319_100304644 | 3300001356 | Peatlands Soil | MRRVLRKSVPFVQAALIGTLAAAALAGVAMLIPHS* |
| JGI12269J14319_102447962 | 3300001356 | Peatlands Soil | MRRALRKSIPFMQAALIGTVAAAALAGVAMLISHS* |
| JGIcombinedJ26739_1003296912 | 3300002245 | Forest Soil | MRRVLRKSIPFVQAVLIGTLTAAAIAGVAMLIPHS* |
| Ga0070735_101099903 | 3300005534 | Surface Soil | MRRVLRKSIPFVQAALIGTLAAAALAGVAMLISHS* |
| Ga0070735_102150022 | 3300005534 | Surface Soil | MRRVLRKSIPFVQAALIGTLAAAALAGAALLITHS* |
| Ga0070733_100165256 | 3300005541 | Surface Soil | MMRRKLRKTVALIQAALIGTLAAAAIAGIALWISHS* |
| Ga0070733_107514682 | 3300005541 | Surface Soil | MRRVLRKSVPFVQAALIGTLAAAVIAGVAMLLPHS* |
| Ga0070665_1004433003 | 3300005548 | Switchgrass Rhizosphere | MRRTFRRSVPFVQAAFIGTFAAALLAGLAILISHLAA* |
| Ga0070762_102000043 | 3300005602 | Soil | MMQRALRRSVPFVQAALIGTLAAAALAGLAILISHS* |
| Ga0070762_109227662 | 3300005602 | Soil | MRRALRRSVPFVQAAFIGTFAAALLAGLAMLISHS* |
| Ga0066903_1011999232 | 3300005764 | Tropical Forest Soil | MRHVLRKSIPFVQAALIGTLAAAALAGVAFLISHS* |
| Ga0066903_1013265693 | 3300005764 | Tropical Forest Soil | MRRVLRKSIPFVQAVLIGTLAAAAVAGVAMLISHS* |
| Ga0066903_1026154972 | 3300005764 | Tropical Forest Soil | MCHALWKSIPFVQAALIGTLAAAALADVDFLISHS* |
| Ga0066903_1044749922 | 3300005764 | Tropical Forest Soil | MRRTFRMSVPFVQAAFIGTFAAALLAGLAILISHLAA* |
| Ga0075028_1003828282 | 3300006050 | Watersheds | MRRVLRKSIPFVQAAMIGTLAAAAVAGVAMLISHS* |
| Ga0070765_1010973471 | 3300006176 | Soil | MQRVLRKSIPFVQAVLIGTLAAAAIAGVAMLIPHS* |
| Ga0073928_101895062 | 3300006893 | Iron-Sulfur Acid Spring | MRRVLRKSIPFVQAALIGTLAAAAIAGVALLIPHS* |
| Ga0074063_135155922 | 3300006953 | Soil | MRRVLRKSIPFVQAALIGTLAAAVLAGVAMLISHS* |
| Ga0116128_11991882 | 3300009518 | Peatland | MRRVLRKSVPFVQAALIGTLTAAALAGVAILISHS* |
| Ga0116220_105016652 | 3300009525 | Peatlands Soil | MRRVLRKSIPFVQAALIGTLAAAAVAGVAMLISHS* |
| Ga0116102_11630222 | 3300009632 | Peatland | MRRVLRKSVPFVQAALIGTFAAVTLAGVAMLISHS* |
| Ga0116118_11247572 | 3300009637 | Peatland | MRRALRRSIPFVQAALIGTLAAVALAAVAMLISHS* |
| Ga0116122_11993272 | 3300009639 | Peatland | GQSMRRVLRKSVPFVQAALIGTLAAAALAGVAMLMSHS* |
| Ga0116126_10551553 | 3300009640 | Peatland | MRRALRRSIPFVQAALIGTLAAAALAAVAMLISHS* |
| Ga0116110_10452801 | 3300009643 | Peatland | RRVLRKSVPFVQAALIGTLAAAALAGVAMLIPHS* |
| Ga0116106_12288901 | 3300009645 | Peatland | MRRVLRRSIPFVQAALIGTLAAAAVAGVAMFISHS* |
| Ga0116134_10185034 | 3300009764 | Peatland | MRRALRRSIPFVQAVLIGVLAAAALATVAMLISHS* |
| Ga0116134_11740452 | 3300009764 | Peatland | MRRVLRKSVPFVQAALVGTFAAAALAGVAMLISHS* |
| Ga0116219_104170352 | 3300009824 | Peatlands Soil | MRRALRRSIPFVQAALIGTLAAAALAAVAMLISHT* |
| Ga0126373_104666153 | 3300010048 | Tropical Forest Soil | MCHALWKSIPFVQAALIGTLAAAALADVGFLISHS* |
| Ga0074046_103963311 | 3300010339 | Bog Forest Soil | MRRALRRSIPFVQAALIGTLAAAALAGIAMLISHS* |
| Ga0074044_106406721 | 3300010343 | Bog Forest Soil | MRRVLRRSIPFVQAALIGTLAAAALAGVAMFISHS* |
| Ga0134128_125563022 | 3300010373 | Terrestrial Soil | REQAMRHVVRKSIPFVQAALIGTLAAAALAGVALLISHS* |
| Ga0126381_1018004882 | 3300010376 | Tropical Forest Soil | MRRVLRKSIPFVQAMIIGTLAAAALAGAAMLIPHS* |
| Ga0136449_1000394426 | 3300010379 | Peatlands Soil | MRRVLRKSIPFVQAALIGTLAAVALAGVALLISHS* |
| Ga0136449_1002228416 | 3300010379 | Peatlands Soil | MRRVLRRSIPFVQAALIGTLAAVALAGVAVLISHS* |
| Ga0136449_1044921102 | 3300010379 | Peatlands Soil | MRRALRRSVPFVQAAFIGTFAAALLAGLAMLISQS* |
| Ga0153924_10107642 | 3300012089 | Attine Ant Fungus Gardens | MSRALRRSVPFVQAAFIGTSAAALLTGIAMLISHS* |
| Ga0153943_10538122 | 3300012177 | Attine Ant Fungus Gardens | MRHLLRKSIPFVQAALIGSLAAAVLAAVAVLISHS* |
| Ga0153974_11048382 | 3300012180 | Attine Ant Fungus Gardens | MRRLLRKSIPFVQAALIGTLAAAAVAGVAMLISHS* |
| Ga0153922_11667842 | 3300012181 | Attine Ant Fungus Gardens | MRRVLRKSVPFVQAVLIGTLAAAVIAGVAMLLPHS* |
| Ga0164308_108420492 | 3300012985 | Soil | MRRALRRSVPFVQAAFIGTLAAALLAGLAMLISHS* |
| Ga0181518_100353354 | 3300014156 | Bog | MRRVLRKSVPFVQAALIGTLAAAALAGVAMLISHS* |
| Ga0181530_101997471 | 3300014159 | Bog | SRGQSMRRVLRKSVPFVQAALIGTLAAAALAGVAMLIPHS* |
| Ga0181517_100501824 | 3300014160 | Bog | MRKAIRKTLPFVQSALIGTLAAAALAGVALLVSYF* |
| Ga0181538_103060251 | 3300014162 | Bog | SMRRVLRKSVPFVQAALIGTLAAAALAGVAMLMSHS* |
| Ga0181523_106299091 | 3300014165 | Bog | QAESRGQSMRRVLRKSVPFVQAALIGTLAAAALAGVAMLMSHS* |
| Ga0181531_106938091 | 3300014169 | Bog | MRRALRRSIPFVQAALIGTVAAAALVGFAMLISHS* |
| Ga0181531_110553812 | 3300014169 | Bog | MRRVLRKSIPFVQAVLIGTLAAAAIAGAAMLIPHS* |
| Ga0181535_100273984 | 3300014199 | Bog | MRRALRKSIPFVQAALIGTLAAAALAGVALLISHS* |
| Ga0181535_106591562 | 3300014199 | Bog | RKAIRKTLPFVQSALIGTLAAAALAGVALLVSYF* |
| Ga0181537_106002441 | 3300014201 | Bog | MRRSLRKSVPFMQAALIGTLAAAALAAVAMLISHS* |
| Ga0163163_104473762 | 3300014325 | Switchgrass Rhizosphere | MRHALRKSIPFVQAALIGTLAAAALAGVAFLILHS* |
| Ga0182018_101262492 | 3300014489 | Palsa | MRRALRKSIPFMQAVLIGTLAAAALAGVAMLISHS* |
| Ga0182024_118801251 | 3300014501 | Permafrost | MRRKLRKSIPFMQAALIGTMAAAALAGVALLISHS* |
| Ga0181516_103408442 | 3300014655 | Bog | MRKAIRKTVPFVQSALIGTLAAAALAGVALLVSYF* |
| Ga0182030_101993812 | 3300014838 | Bog | MRRVLRKTIPFVQAVLIGTLAAAVVVGFAIYVSHS* |
| Ga0132258_108284851 | 3300015371 | Arabidopsis Rhizosphere | SWELAMRHVLRKSIPFVQAALIGTLAAAALAGVAFLISHS* |
| Ga0132258_114417183 | 3300015371 | Arabidopsis Rhizosphere | MRRTFRRSVPFVQAAFIGTFAAAVLAGLAILISHLAA* |
| Ga0182041_120586112 | 3300016294 | Soil | MCHALWKSIPFVQAALIGTLAAAALAGVTFLIAHS |
| Ga0182034_111946662 | 3300016371 | Soil | EQAMRRVLRKSIPFVQAALIGTLAAAAVAGVAMLISHS |
| Ga0182034_117247601 | 3300016371 | Soil | MRRVLRKSVPFVQAVIIGTLAAAALAGVAMLIPHS |
| Ga0187818_101764831 | 3300017823 | Freshwater Sediment | MRSVLRKSVPFVQAALIGTLAAAALAGVAMLIPHS |
| Ga0187818_104120482 | 3300017823 | Freshwater Sediment | MRRVLRKSIPFVQAALIGTLAAAVLAGVAMLISHS |
| Ga0187856_100108820 | 3300017925 | Peatland | MRRVLRRSIPFVQAALIGTLAAAALAGVAMFISHS |
| Ga0187856_10037008 | 3300017925 | Peatland | MRRVLRKSVPFVQAALIGTLTAAALAGVAILISHS |
| Ga0187853_105193922 | 3300017940 | Peatland | MRRALRRSIPFVQAALIGTLAAAALAAVAMLISHS |
| Ga0187850_102166133 | 3300017941 | Peatland | SMRRVLRKSVPFVQAALIGTLAAAALAGVAMLMSHS |
| Ga0187819_100546555 | 3300017943 | Freshwater Sediment | MRRVLRKSIPFVQAALIGTLAAVAVAGVAMLISHS |
| Ga0187879_103235332 | 3300017946 | Peatland | MRRVLRKSVPFVQAALVGTFAAAALAGVAMLISHS |
| Ga0187817_104172931 | 3300017955 | Freshwater Sediment | MRRVLRKSVPFVQAALMGTLTAAALAGVAMLISHS |
| Ga0187817_108220301 | 3300017955 | Freshwater Sediment | GAMMRRVLRRSMPFVQAALIGTLAAAALAGFAMLISHT |
| Ga0187817_110191031 | 3300017955 | Freshwater Sediment | MGRVLRKSVPFVQAALMGTLTAAALAGVAMLISDS |
| Ga0187783_106545291 | 3300017970 | Tropical Peatland | MRRVLRKSIPFVQAMLIGTLAAAVIAGVAMLLPHS |
| Ga0187781_1000045222 | 3300017972 | Tropical Peatland | MRRVLRKSIPFVQAVLIGTLAAAMLAGVAMLISRS |
| Ga0187781_100097124 | 3300017972 | Tropical Peatland | MRRVVRRSVPFVQAALIGAIAAAVLAGVAMAVSHS |
| Ga0187781_100816644 | 3300017972 | Tropical Peatland | MRKALRRSAPFVQAALIGTVAAAALAGFAMLISHS |
| Ga0187781_100884243 | 3300017972 | Tropical Peatland | MHRVLRKSVPFVQAALMGALAAAALAGVAMLISHS |
| Ga0187781_104028212 | 3300017972 | Tropical Peatland | MRHVLRKSIPFVQAALIGSLAAAALAGVAMLISHS |
| Ga0187781_110058192 | 3300017972 | Tropical Peatland | MHRVLRKSVPFVQAALMGALTAAALAGVAMLISHS |
| Ga0187780_100164962 | 3300017973 | Tropical Peatland | MRRILRRSIPFVQAVLIGTLLAAALAGFAIFVSHS |
| Ga0187780_104482042 | 3300017973 | Tropical Peatland | MRKAIRKTMPFVQSALIGTLAAAALAGVALLVSHS |
| Ga0187782_100667663 | 3300017975 | Tropical Peatland | MHRVLRKSVPFVQAALMGALTAAALVGVAMLISHS |
| Ga0187782_102890332 | 3300017975 | Tropical Peatland | MRHVLRKSIPFVQAALIGSLAAAVLAGVAMLISHS |
| Ga0187782_103783411 | 3300017975 | Tropical Peatland | MRRVLRRSVPFVQAALIGAMAAAALAGVAMMISHS |
| Ga0187782_104619422 | 3300017975 | Tropical Peatland | MRRVLRKSVPFVKAVLIGTLAAAALAGVAILVSHS |
| Ga0187782_106704142 | 3300017975 | Tropical Peatland | MRRKLRKTIALMAAALIGTLAAAALAGIALLISHS |
| Ga0187782_109860321 | 3300017975 | Tropical Peatland | QSMRRVLRKSIPFVQAVLIGTLAAAVIAGVAMLLPHS |
| Ga0181520_1000231130 | 3300017988 | Bog | MRKAIRKTLPFVQSALIGTLAAAALAGVALLVSYF |
| Ga0187888_10406964 | 3300018008 | Peatland | MRRALRRSIPFVQAALIGTLAAVALAAVAMLISHS |
| Ga0187873_11811592 | 3300018013 | Peatland | MRRVLRRSIPFVQAALIGTLAAAAVAGVAMFISHS |
| Ga0187873_13813382 | 3300018013 | Peatland | AGWEQSMRRALRRSIPFVQAALIGTLAAAALAAVAMLISHS |
| Ga0187872_102172923 | 3300018017 | Peatland | RGQSMRRVLRKSVPFVQAALIGTLAAAALAGVAMLMSHS |
| Ga0187867_102527953 | 3300018033 | Peatland | MRQVLRKSIPFIGAVLIGMTAAALLGGVAMLASHS |
| Ga0187871_101077753 | 3300018042 | Peatland | MMQRALRRSVPFVQAALIGTLAAAALAGLAILISHS |
| Ga0187858_100833432 | 3300018057 | Peatland | MRRVLRKSVPFVQAALIGAFAAAALAGVAMLISHS |
| Ga0187766_106310582 | 3300018058 | Tropical Peatland | MRRVLRRSVPFVQAALIGAMAAAALAGVAIVISHS |
| Ga0187765_108337102 | 3300018060 | Tropical Peatland | MRHLLRKSIPFVQAALIGSLAAAVLAAVAVLISHS |
| Ga0187784_1000045816 | 3300018062 | Tropical Peatland | MSQILRKSIPFVQAALIGTLAAATLVGVAMLMAHS |
| Ga0187772_100529271 | 3300018085 | Tropical Peatland | MMRRVLRKSIPFVQAALIGTVAAAALAAFAVYVSHS |
| Ga0187772_114588291 | 3300018085 | Tropical Peatland | MRRVLRKSIPFVQAVLIGTLAAAVIAGVAMLLPHS |
| Ga0187769_100674073 | 3300018086 | Tropical Peatland | MRRVLRQSVPFVQAVLIGALAAAALAGVAMLISHS |
| Ga0187769_101885642 | 3300018086 | Tropical Peatland | MMRRVLRKSIPFVHAALIGTVAAAALAAFAVYVSHS |
| Ga0210407_100100582 | 3300020579 | Soil | MRRALRRSVPFVQAAFIGTLAAALLAGLAMLISHS |
| Ga0210395_100127842 | 3300020582 | Soil | MRRVLRKSVPFVQAVLIGTLAAAVIAGVAMLLPHS |
| Ga0210406_101930631 | 3300021168 | Soil | EQSMRRALRRSAPFVQAAFIGTLAAALLAGLAMLISHS |
| Ga0213875_104123472 | 3300021388 | Plant Roots | MRRVLRKSVPFVQAVLIGTLAAVAIAGVALLIPHS |
| Ga0210386_110176101 | 3300021406 | Soil | MRHLLRKSIPFVQAALIGSLAAAVLAAVAVLISHA |
| Ga0242656_10297102 | 3300022525 | Soil | MRRALRRSVPFVQAAFIGTFAAALLASLAMLISHS |
| Ga0212123_101155873 | 3300022557 | Iron-Sulfur Acid Spring | MRRVLRKSIPFVQAALIGTLAAAAIAGVALLIPHS |
| Ga0224545_10272012 | 3300022881 | Soil | MRRALRKSIPFMQAVLIGTLAAAALAGVAMLISHS |
| Ga0208689_10935872 | 3300025459 | Peatland | QSMRRVLRKSVPFVQAALIGTLAAAALAGVAMLMSHS |
| Ga0208562_10745273 | 3300025460 | Peatland | ESRGQSMRRVLRKSVPFVQAALIGTLAAAALAGVAMLMSHS |
| Ga0207657_104495322 | 3300025919 | Corn Rhizosphere | MRRTFRRSVPFVQAAFIGTFAAALVAGLAILISHLAA |
| Ga0207676_121548923 | 3300026095 | Switchgrass Rhizosphere | MRRTFRRSVPFVQAAFIGTFAAAVLAGLAILISHLAA |
| Ga0209114_10791492 | 3300027504 | Forest Soil | QPASLEQAVRRVLRKSIPFIQAALIGTLAAAAVAGVAMLISHS |
| Ga0208043_10042748 | 3300027570 | Peatlands Soil | MRRALRKSIPFMQAALIGTVAAAALAGVAMLISHS |
| Ga0209007_10023198 | 3300027652 | Forest Soil | VRSVLRKSVPFVGAVLIGLMIAAALAGVAFMVSHS |
| Ga0209446_11170962 | 3300027698 | Bog Forest Soil | MRRALRRSIPFVQAALMGTMAAAALAGIAMLISHS |
| Ga0207862_12168642 | 3300027703 | Tropical Forest Soil | QVLRRGQSMRRVLRKSVPFVQAALVGTLAAAALAGVAMLISHS |
| Ga0209448_100827622 | 3300027783 | Bog Forest Soil | MRRALRRSIPFVQAALIGTLAAAALAGIAMLISHS |
| Ga0209139_103244642 | 3300027795 | Bog Forest Soil | MRRVLRKSIPFVQAVLIGTLTAAAIAGVAMLIPHS |
| Ga0209167_102751983 | 3300027867 | Surface Soil | MMRRKLRKTVALIQAALIGTLAAAAIAGIALWISHS |
| Ga0209006_110373283 | 3300027908 | Forest Soil | MRRALRKSIPFIQAALIGTLAAAAVAGIALLISHS |
| Ga0209168_101481573 | 3300027986 | Surface Soil | MRRVLRKSIPFVQAALIGTLAAAALAGVAMLISHS |
| Ga0307504_102997982 | 3300028792 | Soil | MRRALRRSVPFVQAAFIGTLAAALLAGIAMLISHS |
| Ga0311369_106679553 | 3300029910 | Palsa | MRRVLRRSIPFVQAALIGTLAVAALVAVAMLISHS |
| Ga0311339_106686983 | 3300029999 | Palsa | MRKAIRKTVPFVQSALIGTLAAAALAGFARMVSYF |
| Ga0311356_108104722 | 3300030617 | Palsa | MRKAIRKTVPFVQSALIGTLAAAALAGFALLVSYF |
| Ga0316363_100268392 | 3300030659 | Peatlands Soil | MRRVLRKSVPFVQAALIGTLAAAALAGVAMLIPHS |
| Ga0310038_100071424 | 3300030707 | Peatlands Soil | MRRVLRKSIPFVQAALIGTLAAVALAGVALLISHS |
| Ga0265750_10544812 | 3300030813 | Soil | MMQRALRRSVPFVQAALIGALAAAALAGLAILISHS |
| Ga0265753_11226891 | 3300030862 | Soil | MRRALRRSVPFVQATFIGTFAAALLAGLAMLISHS |
| Ga0302325_109044723 | 3300031234 | Palsa | MRKAIRKTVPFVQSALIGTLAAAALAGVALLVSYF |
| Ga0318534_104618752 | 3300031544 | Soil | MRHLLRKFVPFVQAALIGSLAAAVLAAVAVLISHS |
| Ga0307374_100160456 | 3300031670 | Soil | MMRRKLRKTVALLQAALIGTLAAAAIAGIALWISHS |
| Ga0318574_103651222 | 3300031680 | Soil | MRRVLRKSIPFVQAMIIGTLAAAALAGAAMLIPHS |
| Ga0310686_1023734821 | 3300031708 | Soil | MRRVLRKSIPFVQAVLIGTLAAAAIAGVAMLIPHS |
| Ga0310686_1037762022 | 3300031708 | Soil | MRQVLRKSIPFVAAVLVGAGAAALLVGAAMLAPHS |
| Ga0310686_1103596642 | 3300031708 | Soil | GREQSMRRVLRKSIPFVQAVLIGTLAAAAIAGVAMLIPHS |
| Ga0310686_1135483731 | 3300031708 | Soil | PGATMQRVLRRSVPFVQAALIGTLAAAALAGLAILISHS |
| Ga0310686_1152983833 | 3300031708 | Soil | MMRRKLRKTIALMEAALIGTLAAAVLAGIALLISHS |
| Ga0307478_110125642 | 3300031823 | Hardwood Forest Soil | MRRVLRKSIPFVQAVLIGTLAAAAIAGVALLLPHS |
| Ga0310916_101522801 | 3300031942 | Soil | MRRVLRKSIPFVQAMIIGTLAATALAGAAMLIPHS |
| Ga0318533_101564244 | 3300032059 | Soil | MRRGLRKSIPFVQAALIGTLAAAAVAGVAMLISHS |
| Ga0307471_1040781202 | 3300032180 | Hardwood Forest Soil | MRRVLRKSIPFVQAALIGTLAAAAVAGVAMRISHS |
| Ga0306920_1003609031 | 3300032261 | Soil | ASREQSMRRVLRKSVPFVQAVIIGTLAAAALAGVAMLIPHS |
| Ga0306920_1010172192 | 3300032261 | Soil | MCHALWKSIPFVQAALIGTLAAAALADVGFLISHS |
| Ga0335085_100119896 | 3300032770 | Soil | MIQKLLRGSVPFVQAALIGTLAAAALAAFAMLISGA |
| Ga0335078_100560844 | 3300032805 | Soil | MRKALRRSVPFVQAALIGTVAAAALAGLAMLISHS |
| Ga0335069_101637445 | 3300032893 | Soil | MMRRVLRRSIPFVQAVLIGTLAAAAIAGFAMYVSHS |
| Ga0335069_101957324 | 3300032893 | Soil | MRRVIRKSMPFVQSALIGSLAAAALAGIALWASHV |
| Ga0335071_111459032 | 3300032897 | Soil | MRRVLRRSIPFVQAVLIGTLAAAAIAGFAMYVSHS |
| Ga0335072_101466536 | 3300032898 | Soil | MRRALRKSIPFMQAALIGTLAAAALVAVAMLISHS |
| Ga0326728_111431432 | 3300033402 | Peat Soil | MRKAIRKTVPFVQSALIGTLVAAALAGMALLISHS |
| Ga0371489_0000043_151505_151612 | 3300033755 | Peat Soil | MRRVLRRSMPFFGAILIGAMAAGLVAGVAMLVSHS |
| ⦗Top⦘ |