


| Basic Information | |
|---|---|
| Family ID | F042870 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 157 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSENLPDSKIPWWDNEYEGVYSDDPEDGYPYDMGTKVQE |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 157 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 68.79 % |
| % of genes near scaffold ends (potentially truncated) | 7.64 % |
| % of genes from short scaffolds (< 2000 bps) | 52.87 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.955 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (26.752 % of family members) |
| Environment Ontology (ENVO) | Unclassified (76.433 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (71.338 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.48% β-sheet: 0.00% Coil/Unstructured: 95.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 157 Family Scaffolds |
|---|---|---|
| PF00149 | Metallophos | 8.92 |
| PF14213 | DUF4325 | 7.64 |
| PF05866 | RusA | 4.46 |
| PF04448 | DUF551 | 1.91 |
| PF00085 | Thioredoxin | 1.91 |
| PF05136 | Phage_portal_2 | 1.27 |
| PF02945 | Endonuclease_7 | 1.27 |
| PF12850 | Metallophos_2 | 1.27 |
| PF01391 | Collagen | 1.27 |
| PF01370 | Epimerase | 1.27 |
| PF07596 | SBP_bac_10 | 1.27 |
| PF01844 | HNH | 1.27 |
| PF04862 | DUF642 | 0.64 |
| PF00478 | IMPDH | 0.64 |
| PF13392 | HNH_3 | 0.64 |
| PF13489 | Methyltransf_23 | 0.64 |
| PF04055 | Radical_SAM | 0.64 |
| PF13912 | zf-C2H2_6 | 0.64 |
| PF12705 | PDDEXK_1 | 0.64 |
| PF04024 | PspC | 0.64 |
| PF00156 | Pribosyltran | 0.64 |
| PF07733 | DNA_pol3_alpha | 0.64 |
| PF16363 | GDP_Man_Dehyd | 0.64 |
| PF00588 | SpoU_methylase | 0.64 |
| PF09722 | Xre_MbcA_ParS_C | 0.64 |
| PF03567 | Sulfotransfer_2 | 0.64 |
| PF06067 | DUF932 | 0.64 |
| PF13692 | Glyco_trans_1_4 | 0.64 |
| PF01755 | Glyco_transf_25 | 0.64 |
| PF08279 | HTH_11 | 0.64 |
| PF00268 | Ribonuc_red_sm | 0.64 |
| PF13899 | Thioredoxin_7 | 0.64 |
| PF00692 | dUTPase | 0.64 |
| PF10124 | Mu-like_gpT | 0.64 |
| PF13098 | Thioredoxin_2 | 0.64 |
| PF03851 | UvdE | 0.64 |
| PF13479 | AAA_24 | 0.64 |
| PF07963 | N_methyl | 0.64 |
| PF00089 | Trypsin | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 157 Family Scaffolds |
|---|---|---|---|
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 4.46 |
| COG2165 | Type II secretory pathway, pseudopilin PulG | Cell motility [N] | 2.55 |
| COG5511 | Phage capsid protein | Mobilome: prophages, transposons [X] | 1.27 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.64 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.64 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.64 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.64 |
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 0.64 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.64 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.64 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 0.64 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
| COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.96 % |
| All Organisms | root | All Organisms | 49.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001848|RCM47_1081525 | Not Available | 824 | Open in IMG/M |
| 3300002200|metazooDRAFT_1279622 | Not Available | 1008 | Open in IMG/M |
| 3300002356|B570J29598_103450 | Not Available | 717 | Open in IMG/M |
| 3300002357|B570J29597_100587 | Not Available | 1024 | Open in IMG/M |
| 3300002403|B570J29609_1001657 | All Organisms → Viruses → Predicted Viral | 2822 | Open in IMG/M |
| 3300002408|B570J29032_109891594 | Not Available | 2063 | Open in IMG/M |
| 3300002476|metazooDRAFT_10907440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1589 | Open in IMG/M |
| 3300002835|B570J40625_100003072 | Not Available | 31276 | Open in IMG/M |
| 3300002835|B570J40625_100006581 | All Organisms → cellular organisms → Bacteria | 21513 | Open in IMG/M |
| 3300002835|B570J40625_100202632 | Not Available | 2147 | Open in IMG/M |
| 3300002835|B570J40625_100219167 | All Organisms → Viruses → Predicted Viral | 2031 | Open in IMG/M |
| 3300002835|B570J40625_100286159 | Not Available | 1684 | Open in IMG/M |
| 3300002835|B570J40625_100341698 | Not Available | 1489 | Open in IMG/M |
| 3300003986|Ga0063233_10134539 | Not Available | 744 | Open in IMG/M |
| 3300004772|Ga0007791_10055518 | Not Available | 1272 | Open in IMG/M |
| 3300005527|Ga0068876_10000265 | All Organisms → cellular organisms → Bacteria | 41906 | Open in IMG/M |
| 3300005527|Ga0068876_10095116 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300005581|Ga0049081_10001622 | Not Available | 8485 | Open in IMG/M |
| 3300005805|Ga0079957_1000008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 153585 | Open in IMG/M |
| 3300005805|Ga0079957_1000150 | Not Available | 57103 | Open in IMG/M |
| 3300005805|Ga0079957_1092342 | All Organisms → Viruses → Predicted Viral | 1674 | Open in IMG/M |
| 3300005805|Ga0079957_1335957 | Not Available | 667 | Open in IMG/M |
| 3300006639|Ga0079301_1008214 | Not Available | 4010 | Open in IMG/M |
| 3300007216|Ga0103961_1440987 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300007541|Ga0099848_1195449 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300007541|Ga0099848_1325602 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae | 523 | Open in IMG/M |
| 3300008110|Ga0114343_1034977 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium | 2061 | Open in IMG/M |
| 3300008114|Ga0114347_1013499 | Not Available | 4026 | Open in IMG/M |
| 3300008953|Ga0104241_1000118 | All Organisms → cellular organisms → Bacteria | 6108 | Open in IMG/M |
| 3300008962|Ga0104242_1026721 | Not Available | 990 | Open in IMG/M |
| 3300009081|Ga0105098_10245490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
| 3300009151|Ga0114962_10079177 | All Organisms → cellular organisms → Archaea | 2086 | Open in IMG/M |
| 3300009152|Ga0114980_10074070 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 2048 | Open in IMG/M |
| 3300009152|Ga0114980_10097685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1757 | Open in IMG/M |
| 3300009152|Ga0114980_10144980 | All Organisms → Viruses → Predicted Viral | 1409 | Open in IMG/M |
| 3300009154|Ga0114963_10114841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1631 | Open in IMG/M |
| 3300009154|Ga0114963_10129905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1513 | Open in IMG/M |
| 3300009155|Ga0114968_10043202 | All Organisms → Viruses → Predicted Viral | 2940 | Open in IMG/M |
| 3300009158|Ga0114977_10185092 | Not Available | 1227 | Open in IMG/M |
| 3300009159|Ga0114978_10046731 | All Organisms → Viruses → Predicted Viral | 3009 | Open in IMG/M |
| 3300009159|Ga0114978_10571161 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | 656 | Open in IMG/M |
| 3300009161|Ga0114966_10468605 | Not Available | 724 | Open in IMG/M |
| 3300009164|Ga0114975_10012568 | Not Available | 5246 | Open in IMG/M |
| 3300009180|Ga0114979_10184632 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
| 3300009180|Ga0114979_10361088 | Not Available | 855 | Open in IMG/M |
| 3300009180|Ga0114979_10741136 | Not Available | 554 | Open in IMG/M |
| 3300009185|Ga0114971_10038833 | Not Available | 3024 | Open in IMG/M |
| 3300010160|Ga0114967_10000004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 199884 | Open in IMG/M |
| 3300010334|Ga0136644_10000783 | All Organisms → cellular organisms → Bacteria | 25434 | Open in IMG/M |
| 3300010334|Ga0136644_10014734 | Not Available | 5369 | Open in IMG/M |
| 3300010334|Ga0136644_10085250 | All Organisms → Viruses → Predicted Viral | 1981 | Open in IMG/M |
| 3300010334|Ga0136644_10247189 | Not Available | 1048 | Open in IMG/M |
| 3300010354|Ga0129333_10450990 | Not Available | 1133 | Open in IMG/M |
| 3300010885|Ga0133913_10009549 | All Organisms → cellular organisms → Bacteria | 25434 | Open in IMG/M |
| 3300010885|Ga0133913_11289747 | Not Available | 1866 | Open in IMG/M |
| 3300010885|Ga0133913_12605351 | All Organisms → cellular organisms → Archaea | 1227 | Open in IMG/M |
| 3300012012|Ga0153799_1009700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2163 | Open in IMG/M |
| 3300013004|Ga0164293_10004555 | Not Available | 11864 | Open in IMG/M |
| 3300013004|Ga0164293_10026873 | Not Available | 4789 | Open in IMG/M |
| 3300013004|Ga0164293_10027216 | All Organisms → Viruses → Predicted Viral | 4753 | Open in IMG/M |
| 3300013004|Ga0164293_10120711 | Not Available | 1985 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10251497 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10692167 | Not Available | 685 | Open in IMG/M |
| 3300013372|Ga0177922_10475815 | Not Available | 10054 | Open in IMG/M |
| 3300014962|Ga0134315_1002849 | Not Available | 3110 | Open in IMG/M |
| 3300017707|Ga0181363_1047608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
| 3300017761|Ga0181356_1154280 | Not Available | 709 | Open in IMG/M |
| 3300019784|Ga0181359_1000486 | Not Available | 8924 | Open in IMG/M |
| 3300019784|Ga0181359_1002534 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 5334 | Open in IMG/M |
| 3300020048|Ga0207193_1021821 | Not Available | 7942 | Open in IMG/M |
| 3300020172|Ga0211729_10522346 | All Organisms → Viruses → Predicted Viral | 1998 | Open in IMG/M |
| 3300020172|Ga0211729_10879580 | All Organisms → Viruses → Predicted Viral | 1337 | Open in IMG/M |
| 3300020504|Ga0208484_1008212 | All Organisms → Viruses → Predicted Viral | 1301 | Open in IMG/M |
| 3300020506|Ga0208091_1001638 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium | 3466 | Open in IMG/M |
| 3300020506|Ga0208091_1008381 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 37-13 | 1323 | Open in IMG/M |
| 3300020515|Ga0208234_1000887 | All Organisms → cellular organisms → Archaea | 4970 | Open in IMG/M |
| 3300020515|Ga0208234_1016470 | Not Available | 880 | Open in IMG/M |
| 3300020516|Ga0207935_1000599 | Not Available | 8550 | Open in IMG/M |
| 3300020530|Ga0208235_1000232 | All Organisms → cellular organisms → Bacteria | 14489 | Open in IMG/M |
| 3300020531|Ga0208487_1022461 | Not Available | 759 | Open in IMG/M |
| 3300020535|Ga0208228_1017649 | All Organisms → cellular organisms → Archaea | 1228 | Open in IMG/M |
| 3300020541|Ga0208359_1047665 | Not Available | 635 | Open in IMG/M |
| 3300020544|Ga0207937_1013992 | Not Available | 1485 | Open in IMG/M |
| 3300020547|Ga0208361_1000704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiohalocapsa → Thiohalocapsa halophila | 8002 | Open in IMG/M |
| 3300020555|Ga0208358_1003307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3863 | Open in IMG/M |
| 3300022747|Ga0228703_1011761 | All Organisms → cellular organisms → Bacteria | 3194 | Open in IMG/M |
| 3300022752|Ga0214917_10174838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1096 | Open in IMG/M |
| 3300022752|Ga0214917_10211537 | Not Available | 944 | Open in IMG/M |
| 3300023179|Ga0214923_10000104 | Not Available | 122466 | Open in IMG/M |
| 3300023179|Ga0214923_10000258 | All Organisms → cellular organisms → Bacteria | 81337 | Open in IMG/M |
| 3300023179|Ga0214923_10000487 | All Organisms → cellular organisms → Bacteria | 60358 | Open in IMG/M |
| 3300023179|Ga0214923_10004934 | All Organisms → cellular organisms → Bacteria | 15766 | Open in IMG/M |
| 3300023179|Ga0214923_10050445 | All Organisms → cellular organisms → Bacteria | 3180 | Open in IMG/M |
| 3300023179|Ga0214923_10266002 | Not Available | 955 | Open in IMG/M |
| 3300023179|Ga0214923_10348859 | Not Available | 781 | Open in IMG/M |
| 3300023184|Ga0214919_10722135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300025532|Ga0208249_1124490 | Not Available | 564 | Open in IMG/M |
| 3300025578|Ga0208864_1037095 | Not Available | 1341 | Open in IMG/M |
| 3300025687|Ga0208019_1047339 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300027114|Ga0208009_1012653 | Not Available | 2033 | Open in IMG/M |
| 3300027581|Ga0209651_1015671 | All Organisms → cellular organisms → Archaea | 2416 | Open in IMG/M |
| 3300027608|Ga0208974_1009860 | Not Available | 3129 | Open in IMG/M |
| 3300027656|Ga0209357_1202020 | Not Available | 505 | Open in IMG/M |
| 3300027708|Ga0209188_1000055 | All Organisms → cellular organisms → Bacteria | 131248 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1021751 | Not Available | 4657 | Open in IMG/M |
| 3300027733|Ga0209297_1319884 | Not Available | 572 | Open in IMG/M |
| 3300027734|Ga0209087_1002877 | Not Available | 9570 | Open in IMG/M |
| 3300027746|Ga0209597_1168407 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 922 | Open in IMG/M |
| 3300027747|Ga0209189_1001478 | All Organisms → cellular organisms → Bacteria | 17509 | Open in IMG/M |
| 3300027747|Ga0209189_1017078 | Not Available | 3983 | Open in IMG/M |
| 3300027747|Ga0209189_1031868 | All Organisms → Viruses → Predicted Viral | 2697 | Open in IMG/M |
| 3300027763|Ga0209088_10004303 | All Organisms → cellular organisms → Archaea | 8319 | Open in IMG/M |
| 3300027777|Ga0209829_10149539 | Not Available | 1069 | Open in IMG/M |
| 3300027782|Ga0209500_10455610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300027793|Ga0209972_10000233 | All Organisms → cellular organisms → Bacteria | 55622 | Open in IMG/M |
| 3300027963|Ga0209400_1000687 | All Organisms → cellular organisms → Bacteria | 29205 | Open in IMG/M |
| 3300027974|Ga0209299_1195825 | Not Available | 741 | Open in IMG/M |
| 3300028025|Ga0247723_1065831 | Not Available | 989 | Open in IMG/M |
| 3300028394|Ga0304730_1000024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 199903 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1000222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 135304 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10090060 | Not Available | 2074 | Open in IMG/M |
| 3300029349|Ga0238435_102647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2528 | Open in IMG/M |
| 3300031758|Ga0315907_10171139 | All Organisms → Viruses → Predicted Viral | 1832 | Open in IMG/M |
| 3300031787|Ga0315900_10048266 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 | 4517 | Open in IMG/M |
| 3300031857|Ga0315909_10031307 | All Organisms → cellular organisms → Bacteria | 5159 | Open in IMG/M |
| 3300031857|Ga0315909_10092235 | Not Available | 2638 | Open in IMG/M |
| 3300031857|Ga0315909_10114782 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium | 2290 | Open in IMG/M |
| 3300031951|Ga0315904_10000070 | Not Available | 157712 | Open in IMG/M |
| 3300031951|Ga0315904_10299056 | All Organisms → Viruses → Predicted Viral | 1509 | Open in IMG/M |
| 3300033816|Ga0334980_0008210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 4594 | Open in IMG/M |
| 3300033980|Ga0334981_0034204 | Not Available | 2721 | Open in IMG/M |
| 3300033981|Ga0334982_0227387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 908 | Open in IMG/M |
| 3300033981|Ga0334982_0530268 | Not Available | 517 | Open in IMG/M |
| 3300033993|Ga0334994_0036047 | All Organisms → Viruses → Predicted Viral | 3173 | Open in IMG/M |
| 3300033993|Ga0334994_0143912 | Not Available | 1348 | Open in IMG/M |
| 3300033994|Ga0334996_0091680 | Not Available | 1786 | Open in IMG/M |
| 3300034061|Ga0334987_0000567 | Not Available | 34415 | Open in IMG/M |
| 3300034061|Ga0334987_0524881 | Not Available | 716 | Open in IMG/M |
| 3300034062|Ga0334995_0130430 | Not Available | 1846 | Open in IMG/M |
| 3300034062|Ga0334995_0321048 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300034062|Ga0334995_0417057 | Not Available | 835 | Open in IMG/M |
| 3300034063|Ga0335000_0215697 | Not Available | 1227 | Open in IMG/M |
| 3300034066|Ga0335019_0038692 | Not Available | 3287 | Open in IMG/M |
| 3300034072|Ga0310127_007401 | All Organisms → cellular organisms → Bacteria | 8749 | Open in IMG/M |
| 3300034072|Ga0310127_052624 | All Organisms → Viruses → Predicted Viral | 2023 | Open in IMG/M |
| 3300034073|Ga0310130_0007048 | Not Available | 4206 | Open in IMG/M |
| 3300034073|Ga0310130_0075699 | Not Available | 1002 | Open in IMG/M |
| 3300034092|Ga0335010_0118180 | Not Available | 1733 | Open in IMG/M |
| 3300034092|Ga0335010_0150645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans → Methylobacterium nodulans ORS 2060 | 1475 | Open in IMG/M |
| 3300034101|Ga0335027_0179151 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300034106|Ga0335036_0667279 | Not Available | 621 | Open in IMG/M |
| 3300034120|Ga0335056_0136787 | Not Available | 1469 | Open in IMG/M |
| 3300034120|Ga0335056_0479002 | Not Available | 658 | Open in IMG/M |
| 3300034167|Ga0335017_0486877 | Not Available | 655 | Open in IMG/M |
| 3300034200|Ga0335065_0594340 | Not Available | 647 | Open in IMG/M |
| 3300034284|Ga0335013_0187437 | Not Available | 1381 | Open in IMG/M |
| 3300034284|Ga0335013_0283452 | Not Available | 1061 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 26.75% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 23.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 12.10% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.37% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 4.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.46% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 2.55% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 2.55% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.91% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.27% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.27% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.27% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.27% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.64% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.64% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.64% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.64% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.64% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.64% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.64% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
| 3300002200 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - APR 2013 | Environmental | Open in IMG/M |
| 3300002356 | Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002357 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002403 | Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
| 3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020504 | Freshwater microbial communities from Lake Mendota, WI - 09AUG2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020515 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020516 | Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020531 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020535 | Freshwater microbial communities from Lake Mendota, WI - 25JUL2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020544 | Freshwater microbial communities from Lake Mendota, WI - 04SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020547 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020555 | Freshwater microbial communities from Lake Mendota, WI - 10AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300025532 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M (SPAdes) | Environmental | Open in IMG/M |
| 3300025578 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM47_10815253 | 3300001848 | Marine Plankton | MTADADDKNLPDSKIPWWDNHYEDVYSEEWEDAYPYDTGTKVQE* |
| metazooDRAFT_12796221 | 3300002200 | Lake | MSDELPDSKIPWWDNHSEGTYSDDPEHGYPYDVGTKVQE* |
| B570J29598_1034502 | 3300002356 | Freshwater | MNTTNEDTEYSLPDSKPFWDNHYEGVYSDDPENGYPYDVGTKVQE* |
| B570J29597_1005872 | 3300002357 | Freshwater | MTDAADDSLPDSKIPWWDNDYEGTYSDDPENGYPYDVGTKVQE* |
| B570J29609_10016577 | 3300002403 | Freshwater | MSEELPDSKIPWWDNEYEGIYSEDPDNGYPYDVGTKVQE* |
| B570J29032_1098915942 | 3300002408 | Freshwater | MTNEDLPDVGPAWWDNESEGTYSEDHEDGYPYDE* |
| metazooDRAFT_109074404 | 3300002476 | Lake | MSEDNEELPDVKPWFDNESEGVYSDDPENGFPYDNGSKVQE* |
| B570J40625_10000307250 | 3300002835 | Freshwater | MLNEEHDEINDNLPDSKIPWFDNEYEGVYSEDPEDGYPYDVGSKVQE* |
| B570J40625_10000658128 | 3300002835 | Freshwater | MSEELPDVPPCWWDNEYEGIYSDDPEDGYPYDMGTKVQE* |
| B570J40625_1002026323 | 3300002835 | Freshwater | MSNTENNLPDSKIPWWDNHYEDIYSDDPEDGYPYDMGTKIQE* |
| B570J40625_1002191672 | 3300002835 | Freshwater | MSEQLPDSKIPWWDNEYEGVYSDDPKDGYPYDMGTKVQE* |
| B570J40625_1002861594 | 3300002835 | Freshwater | MTADVDSELPDSKIPWWDNEYEGVYSNDPENGYPYDMGTKVQE* |
| B570J40625_1003416983 | 3300002835 | Freshwater | MQAEENNDDLPDSKIPWWDNHYEGVYSDDPEHGYPYDIGTKVQE* |
| Ga0063233_101345393 | 3300003986 | Freshwater Lake | MSEELPDSKIPWFDNEYEGVYSDDQEHGYPYDMGTKVQE* |
| Ga0007791_100555184 | 3300004772 | Freshwater | MTNTNSEHQENLPDSKIPWWDNHYEDVYSEEAEDGYPYDMGSKVQE* |
| Ga0068876_1000026521 | 3300005527 | Freshwater Lake | MISDNTDGESLPDSKIPWYDNEYEGVYSDDPENGYPYDMGTKVQE* |
| Ga0068876_100951161 | 3300005527 | Freshwater Lake | ATAGADQMTDAADDSLPDSKIPWWDNDYEGTYSDDPENGYPYDVGTKVQE* |
| Ga0049081_1000162213 | 3300005581 | Freshwater Lentic | MTNTNSEHQENLPDSKIPWWDNHYEDVYSEDPEDGYPYDMGSKVQE* |
| Ga0079957_1000008127 | 3300005805 | Lake | MSEILPDSKIPWWDNEYEGVYSDDPEDGYAYDMGTKIQE* |
| Ga0079957_100015076 | 3300005805 | Lake | MTDELPDSKIPWWDNEYEGVYSDDPEDGYPYDVGTKVQE* |
| Ga0079957_10923424 | 3300005805 | Lake | MSSNETNELPDSKIPWWDNHYEDVYSEEWDDGYPYDTGTKVQE* |
| Ga0079957_13359573 | 3300005805 | Lake | MSSELPDSKIPWWDNHYEDTYSEEREDGYPYDMGTKIQE* |
| Ga0079301_10082143 | 3300006639 | Deep Subsurface | MSTLPDSKIPWWDNHYEDTYSEEVEDGYPYDLGTKVQE* |
| Ga0103961_14409873 | 3300007216 | Freshwater Lake | LDNEEELPDIDPYWENDYEGVYSDDPEDGYPYDTGTKVQE* |
| Ga0099848_11954492 | 3300007541 | Aqueous | VNETLPDNDIPWWDNHYEGTYSEDPEDGYPYDTGTKVQE* |
| Ga0099848_13256022 | 3300007541 | Aqueous | LSKELPDSKIPWWDNHYEGTYSDDYEDGYPYDNGTKVQE* |
| Ga0114343_10349773 | 3300008110 | Freshwater, Plankton | MTDAADESLPDAKIPWWDNHSEGTYSDDPENGYPYDVGTKVQE* |
| Ga0114347_101349910 | 3300008114 | Freshwater, Plankton | MSEEINDELPDSKIPWWDNHYEDTYSEEWENGYPYDTGTKVQE* |
| Ga0104241_10001183 | 3300008953 | Freshwater | LDKELPDVSPSWWDNEYEGTYSDDPENGYAYDIGNKIQE* |
| Ga0104242_10267212 | 3300008962 | Freshwater | MSNEENLPDSKIPWFDNEYEGVYSDDPEHGYPYDMGTKVQE* |
| Ga0105098_102454903 | 3300009081 | Freshwater Sediment | MSSENENLPDSKIPWLDNEYEGVYSYDPEDGYPYDMGTKVQE* |
| Ga0114962_100791776 | 3300009151 | Freshwater Lake | MTELPDSKIPWWDNHYEDIYSEEIEDGYPYDMGTKVQE* |
| Ga0114980_100740703 | 3300009152 | Freshwater Lake | MSEVLPDSKIPWFDNEYEGVYSDDPENGYPYDMGTKVQE* |
| Ga0114980_100976853 | 3300009152 | Freshwater Lake | MSILPDSKIPWWDNHYEDTYSEEVEDGYPYDMGTKIQE* |
| Ga0114980_101449802 | 3300009152 | Freshwater Lake | MSDENLPDNKIPWWDNEYEGVYSDDPEDGYPYDMGSKVQE* |
| Ga0114963_101148411 | 3300009154 | Freshwater Lake | LPDSKIPWWDNHYEDVYSEEVEDGYPYDVGTKVQE* |
| Ga0114963_101299053 | 3300009154 | Freshwater Lake | MSELPDSKIPWWDNHYEDFYSEEVEDGYPYDLGTKIQE* |
| Ga0114968_1004320211 | 3300009155 | Freshwater Lake | MHEELPDSKIPWFDNEYEGVYSDDPEHGYPYDVGTKVQE* |
| Ga0114977_101850921 | 3300009158 | Freshwater Lake | IMGELPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKVQE* |
| Ga0114978_100467314 | 3300009159 | Freshwater Lake | MGELPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKVQE* |
| Ga0114978_105711612 | 3300009159 | Freshwater Lake | MSETLPDSKIPWFDNEYEGVYSDDPENGYPYDMGTKVQE* |
| Ga0114966_104686052 | 3300009161 | Freshwater Lake | MSQILPDSKIPWWDNHYEDTYSEEVEDGYPYDVGTKVQE* |
| Ga0114975_100125689 | 3300009164 | Freshwater Lake | MNNELPDSKIPWWDNHYEDVYSEEVEDGYPYDLGTKVQE* |
| Ga0114979_101846324 | 3300009180 | Freshwater Lake | MNNQLPDSKIPWWDNHYEDIYSEEIEDGYPYDMGTKIQE* |
| Ga0114979_103610882 | 3300009180 | Freshwater Lake | MGEVLPDSKIPWWDNHYEDIYSEEVEDGYPYDMGTKVQE* |
| Ga0114979_107411362 | 3300009180 | Freshwater Lake | MTELPDSKIPWCDNHYEDIYSEEIEDGYPYDMGTKVQE* |
| Ga0114971_100388332 | 3300009185 | Freshwater Lake | MINELPDSKIPWWDNHYEDTYTEEVEDGYPYDIGTKVQE* |
| Ga0114967_10000004130 | 3300010160 | Freshwater Lake | MFNFNELPDTKIPWWDNHYEDTYSEEIEDGYPYDMGTKVQE* |
| Ga0136644_1000078343 | 3300010334 | Freshwater Lake | MSENLPDSKIPWWDNEYEGVYSDDPEDGYPYDMETKVQE* |
| Ga0136644_100147348 | 3300010334 | Freshwater Lake | MSTLPDSKIPWWDNHYEDVYSEEVEDGYPYDVGSKVQE* |
| Ga0136644_100852502 | 3300010334 | Freshwater Lake | MSTLPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKVQE* |
| Ga0136644_102471895 | 3300010334 | Freshwater Lake | MSENLPDSKIPWLDNEYEGVYSDDPEDGYPYDMGTKVQE* |
| Ga0129333_104509903 | 3300010354 | Freshwater To Marine Saline Gradient | MSDELPDSKIPWWDNEYEGTYSDDHEDGYPYDMGTKVQE* |
| Ga0133913_1000954943 | 3300010885 | Freshwater Lake | MSENLPDSKIPWWDNEYEGVYSDDPEDGYPYDMGTKVQE* |
| Ga0133913_112897475 | 3300010885 | Freshwater Lake | MSEELPDSKIPWFDNEYEGVYSDDPEHGYPYDIGTKIQE* |
| Ga0133913_126053514 | 3300010885 | Freshwater Lake | MNNQLPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKVQE* |
| Ga0153799_10097002 | 3300012012 | Freshwater | MSEENLRDSKIPWWDNHYEYVYSEDPEDGYPYDMGTKVQE* |
| Ga0164293_1000455523 | 3300013004 | Freshwater | MCNEEENNDYLPDSKIPWWDNHYEGVYSDDTENGYPYDIGTKVQE* |
| Ga0164293_1002687314 | 3300013004 | Freshwater | MSELPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKIQE* |
| Ga0164293_100272164 | 3300013004 | Freshwater | MSTLPDSKIPWWDNHYEDTYSEEVEDGYPYDIGTKVQE* |
| Ga0164293_101207116 | 3300013004 | Freshwater | MSTLPDSKIPWWDNHYEDVYSEEVEDGYPYDVGTKVQE* |
| (restricted) Ga0172367_102514973 | 3300013126 | Freshwater | LSEDKIETNQSLPDSKIPWWDNEYEDVYSEEWDDGYPYDVGTKVQE* |
| (restricted) Ga0172362_106921672 | 3300013133 | Sediment | MEDILPDDDIPWFDNEYEGVYSDDPEDGYPYDMGTKVQE* |
| Ga0177922_1047581526 | 3300013372 | Freshwater | MENNEELPDSKIPWWDNHYEDVYSEDPEDGYPYDMGTKVQE* |
| Ga0134315_10028495 | 3300014962 | Surface Water | VSGEALPDSKLPWWDNHYEGTYSDDPENGYPYDVGTKVQE* |
| Ga0181363_10476083 | 3300017707 | Freshwater Lake | MTADEDSGLPDSKIPWWDNDYEGVYSDDPANGYPYDIGTKVQE |
| Ga0181356_11542804 | 3300017761 | Freshwater Lake | MNNELPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKIQE |
| Ga0181359_10004865 | 3300019784 | Freshwater Lake | MSTLPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKIQE |
| Ga0181359_10025343 | 3300019784 | Freshwater Lake | MSEELPDSKIPWFDNEYEGVYSDDQEHGYPYDMGTKVQE |
| Ga0207193_10218217 | 3300020048 | Freshwater Lake Sediment | MNIEEENNLPDTKIPWFDNEYEGVYSDDPEDGYPYDMGTKVQE |
| Ga0211729_105223463 | 3300020172 | Freshwater | MSEENLPDSKIPWWDNEYERVYSDDPEDGYPYDVGTKVQE |
| Ga0211729_108795802 | 3300020172 | Freshwater | MSEENLPDSKIPWLDNEYEGVYSDDPEDGYPYDVGTKVQE |
| Ga0208484_10082122 | 3300020504 | Freshwater | MSEQLPDSKIPWWDNEYEGVYSDDPKDGYPYDMGTKVQE |
| Ga0208091_10016387 | 3300020506 | Freshwater | MTDAADDSLPDSKIPWWDNDYEGTYSDDPENGYPYDVGTKVQE |
| Ga0208091_10083816 | 3300020506 | Freshwater | MSEELPDVPPCWWDNEYEGIYSDDPEDGYPYDMGTKVQE |
| Ga0208234_100088718 | 3300020515 | Freshwater | MSTLPDSKIPWWDNHYEDTYSEEVEDGYPYDIGTKVQE |
| Ga0208234_10164701 | 3300020515 | Freshwater | MSEELPDSKIPWWDNEYEGIYSEDPDNGYPYDVGTKVQE |
| Ga0207935_100059926 | 3300020516 | Freshwater | MNTTNEDTEYSLPDSKPFWDNHYEGVYSDDPENGYPYDVGTKVQE |
| Ga0208235_100023210 | 3300020530 | Freshwater | MLNEEHDEINDNLPDSKIPWFDNEYEGVYSEDPEDGYPYDVGSKVQE |
| Ga0208487_10224614 | 3300020531 | Freshwater | MCNEEENNDYLPDSKIPWWDNHYEGVYSDDTENGYPYDIGTKVQE |
| Ga0208228_10176494 | 3300020535 | Freshwater | MSTLPDSKIPWWDNHYEDVYSEEVEDGYPYDVGTKVQE |
| Ga0208359_10476652 | 3300020541 | Freshwater | MSEVLPDSKIPWFDNEYEGVYSDDPENGYPYDMGTKVQE |
| Ga0207937_10139923 | 3300020544 | Freshwater | MNELPDSKIPWWDNHYEDTYSEEVEDGYPYDMGTKIQE |
| Ga0208361_100070417 | 3300020547 | Freshwater | MTDAADESLPDSKIPWWDNAYEGTYSDDPENGYPYDVGTKVQE |
| Ga0208358_10033072 | 3300020555 | Freshwater | MTADEDSGLPDSKIPWWDNHYEDTYSEEVEDGYPYDMGTKVQE |
| Ga0228703_10117615 | 3300022747 | Freshwater | MSKQLPDSKIPWWDNESEGVYSDDPDDGYPYDIGTKVQE |
| Ga0214917_101748384 | 3300022752 | Freshwater | MIGAAMTQENEEDILPDSKSPWWDNEYEGVYSDDPEDGYPYDMGTKVQE |
| Ga0214917_102115373 | 3300022752 | Freshwater | MSNEENLPDSKIPWFDNEYEGVYSDDPEHGYPYDMGTKVQE |
| Ga0214923_1000010427 | 3300023179 | Freshwater | MTKQQINGHIEELPDSKIPWFDNEYEGVYSDDPEHGYPYDMGTKVQE |
| Ga0214923_1000025835 | 3300023179 | Freshwater | MTTDSDSVLPDSKIPWWDNDYEGVYSDDPENGYPYDMGTKVQE |
| Ga0214923_10000487117 | 3300023179 | Freshwater | MTNQESESDNLPDSKIPWWDNHYEDTYSEEVEDGYPYDMGTKVQE |
| Ga0214923_1000493453 | 3300023179 | Freshwater | MIDQSQSDDLPDSKIPWWDNHYEDTYSEEVEDGYPYDMGTKVQE |
| Ga0214923_1005044511 | 3300023179 | Freshwater | MIGVVMLEKNSEEDILPDSKIPWWDNEYERVYSDDPEDGYPYDIGTKVQE |
| Ga0214923_102660024 | 3300023179 | Freshwater | MAEENLPDSKIPWFDNEYEGVYSDDPEHGYPYDMGTKVQE |
| Ga0214923_103488592 | 3300023179 | Freshwater | MSSNEQNELPDSKIPWWDNHYEDVYSEEWEDGYPYDTGTKAQE |
| Ga0214919_107221352 | 3300023184 | Freshwater | MTNTNSEHQENLPDTKIPWWDNHYEDVYSEEVEDGYPYDMGSKVQE |
| Ga0208249_11244901 | 3300025532 | Freshwater | TNSEHQENLPDSKIPWWDNHYEDVYSEEAEDGYPYDMGSKVQE |
| Ga0208864_10370954 | 3300025578 | Freshwater | MTNTNSEHQENLPDSKIPWWDNHYEDVYSEEAEDGYPYDMGSKVQE |
| Ga0208019_10473394 | 3300025687 | Aqueous | VNETLPDNDIPWWDNHYEGTYSEDPEDGYPYDTGTKVQE |
| Ga0208009_10126534 | 3300027114 | Deep Subsurface | MSTLPDSKIPWWDNHYEDTYSEEVEDGYPYDLGTKVQE |
| Ga0209651_10156719 | 3300027581 | Freshwater Lake | MSTLPDSKIPWWDNHYEDVYSEEVEDGYPYDLGTKVQE |
| Ga0208974_10098602 | 3300027608 | Freshwater Lentic | MTNTNSEHQENLPDSKIPWWDNHYEDVYSEDPEDGYPYDMGSKVQE |
| Ga0209357_12020201 | 3300027656 | Freshwater Lake | MSEELPDSKIPWFDNEYEGVYSDDPEHGYPYDMGTKVQE |
| Ga0209188_1000055144 | 3300027708 | Freshwater Lake | MTELPDSKIPWWDNHYEDIYSEEIEDGYPYDMGTKVQE |
| (restricted) Ga0247833_10217517 | 3300027730 | Freshwater | MNNENTEENLPDSKIPWWDNHYEDVYSEEVEDGYSYDMGTKVQE |
| Ga0209297_13198843 | 3300027733 | Freshwater Lake | IMGELPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKVQE |
| Ga0209087_10028778 | 3300027734 | Freshwater Lake | MGELPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKVQE |
| Ga0209597_11684072 | 3300027746 | Freshwater Lake | MINELPDSKIPWWDNHYEDTYTEEVEDGYPYDIGTKVQE |
| Ga0209189_100147839 | 3300027747 | Freshwater Lake | MSTLPDSKIPWWDNHYEDVYSEEVEDGYPYDVGSKVQE |
| Ga0209189_101707812 | 3300027747 | Freshwater Lake | MSENLPDSKIPWWDNEYEGVYSDDPEDGYPYDMGTKVQE |
| Ga0209189_10318688 | 3300027747 | Freshwater Lake | MSTLPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKVQE |
| Ga0209088_1000430330 | 3300027763 | Freshwater Lake | MNNQLPDSKIPWWDNHYEDIYSEEIEDGYPYDMGTKIQE |
| Ga0209829_101495392 | 3300027777 | Freshwater Lake | MNELPDSKIPWWDNHYEDVYSEEVEDGYPYDVGTKVQE |
| Ga0209500_104556101 | 3300027782 | Freshwater Lake | MSDENLPDNKIPWWDNEYEGVYSDDPEDGYPYDMGSKVQE |
| Ga0209972_1000023368 | 3300027793 | Freshwater Lake | MISDNTDGESLPDSKIPWYDNEYEGVYSDDPENGYPYDMGTKVQE |
| Ga0209400_100068754 | 3300027963 | Freshwater Lake | MHEELPDSKIPWFDNEYEGVYSDDPEHGYPYDVGTKVQE |
| Ga0209299_11958252 | 3300027974 | Freshwater Lake | KMSEVLPDSKIPWFDNEYEGVYSDDPENGYPYDMGTKVQE |
| Ga0247723_10658311 | 3300028025 | Deep Subsurface Sediment | MNEELPDSKIPWFDNEYEGVYSDDPEHGYPYDMGTKVQE |
| Ga0304730_1000024102 | 3300028394 | Freshwater Lake | MFNFNELPDTKIPWWDNHYEDTYSEEIEDGYPYDMGTKVQE |
| (restricted) Ga0247843_1000222156 | 3300028569 | Freshwater | MNQDWSLGYIEMSGENLPDSKIPWWDNEYEGVYSEDDEDGYPYDVGTKVQE |
| (restricted) Ga0247840_100900601 | 3300028581 | Freshwater | LPDSKIPWWDNHYEDVYSEEVEDGYSYDMGTKVQE |
| Ga0238435_1026478 | 3300029349 | Freshwater | MSEEINDELPDSKIPWWDNHYEDTYSEEWENGYPYDTGTKVQE |
| Ga0315907_101711394 | 3300031758 | Freshwater | MSDELPDSKIPWWDNEYEGVYSDDPEDGYPYDMGAKVQE |
| Ga0315900_1004826611 | 3300031787 | Freshwater | MSDELPDSKIPWWDNEYEGTYSDDPEDGCPYDMGTKVQE |
| Ga0315909_100313071 | 3300031857 | Freshwater | MIENGEENSLPDSKIPWWDNEYEGVYSDDPEDGYPYDMGTKVQE |
| Ga0315909_100922353 | 3300031857 | Freshwater | MSDELPDSKSPWWDNEYEGTYSDDPEDGYPYDMGTKVQE |
| Ga0315909_101147822 | 3300031857 | Freshwater | MTDAADESLPDAKIPWWDNHSEGTYSDDPENGYPYDVGTKVQE |
| Ga0315904_1000007097 | 3300031951 | Freshwater | MIENEADNSLPDSKIPWWDNEYEGVYSDDPEDGYPYDMGTKVQE |
| Ga0315904_102990564 | 3300031951 | Freshwater | MSEEINDELPDSKIPWWDNHYEDTYSEEWDNGYPYDTGTKVQE |
| Ga0334980_0008210_668_826 | 3300033816 | Freshwater | MSCSSRKNDMTTDTDNELPDSKIPWWDNDYEGVYSNDPENGYPYDMGTKVQE |
| Ga0334981_0034204_353_484 | 3300033980 | Freshwater | MTDAADDSLPDSKIPWWDNAYEGTYSDDPENGYPYDVGTKVQE |
| Ga0334982_0227387_657_776 | 3300033981 | Freshwater | MSKELPDVPPSWWDNEYEGTYSDDPENGYPYDVGSKIQE |
| Ga0334982_0530268_21_176 | 3300033981 | Freshwater | MKKTKIMTKLTDEDSELPDSKIPWWDNEYEGVYSNDPENGYPYDIGTKVQE |
| Ga0334994_0036047_1273_1389 | 3300033993 | Freshwater | MNELPDSKIPWWDNHYEDTYSEELEDGYPYDIGTKVQE |
| Ga0334994_0143912_1223_1348 | 3300033993 | Freshwater | MTDAADDSLPDSKIPWWDNDYEGTYSDDPENGYPYDVGTKVQ |
| Ga0334996_0091680_1607_1726 | 3300033994 | Freshwater | MSDALPDSKIPWLDNEYEGVYSDDPEDGYPYDMGSKVQE |
| Ga0334987_0000567_11283_11399 | 3300034061 | Freshwater | MNELPDSKIPWWDNHYEDVYSEELEDGYPYDMGTKIQE |
| Ga0334987_0524881_215_331 | 3300034061 | Freshwater | MSGLPDSKIPWWDNESEGVYSDDPEDGYPYDMGTKVQE |
| Ga0334995_0130430_575_706 | 3300034062 | Freshwater | MTDAADDSLPDSKIPWWENDYEGTYSDDPENGYPYDVGTKVQE |
| Ga0334995_0321048_785_898 | 3300034062 | Freshwater | MFNMTNEDLPDVGPAWWDNESEGTYSEDHEDGYPYDE |
| Ga0334995_0417057_46_174 | 3300034062 | Freshwater | MSNTENNLPDSKIPWWDNHYEDIYSDDPEDGYPYDMGTKIQE |
| Ga0335000_0215697_642_761 | 3300034063 | Freshwater | MSEVLPDSKIPWLDNEYEGVYSDDPENGYPYDMGTKVQE |
| Ga0335019_0038692_647_763 | 3300034066 | Freshwater | MSELPDSKIPWWDNHYEDVYSEEVEDGYPYDMGTKIQE |
| Ga0310127_007401_1962_2081 | 3300034072 | Fracking Water | MSDQLPDSKLPWWDNHYEGTYSDDPEDGYPYDVGTKVQE |
| Ga0310127_052624_612_731 | 3300034072 | Fracking Water | LDKELPDVPPSWWDNEYEGTYSDDPENGYAYDIGNKIQE |
| Ga0310130_0007048_3210_3329 | 3300034073 | Fracking Water | LDKELPDVPPSWWDNEYEGTYSDDPENGYPYDLGTKVQE |
| Ga0310130_0075699_438_557 | 3300034073 | Fracking Water | LDKELPDVSPSWWDNGYEGTYSDDPENGYAYDIGNKIQE |
| Ga0335010_0118180_1468_1599 | 3300034092 | Freshwater | MTADVDSELPDSKIPWWDNEYEGVYSNDPENGYPYDMGTKVQE |
| Ga0335010_0150645_690_821 | 3300034092 | Freshwater | MTADEDSGLPDSKIPWWDNDYEGVYSDDPENGYPYDMGTKVQE |
| Ga0335027_0179151_746_865 | 3300034101 | Freshwater | MSEELPDVPPSWWDNEYEGTYSDDPENGYPYDVGSKIQE |
| Ga0335036_0667279_321_446 | 3300034106 | Freshwater | MENNEELPDSKIPWWDNHHEDVYSEDPEDGYPYDMGSKVQE |
| Ga0335056_0136787_521_652 | 3300034120 | Freshwater | MTDAADGSLPDSKIPWWDNHSEGTYSDDPENGYPYDVGTKVQE |
| Ga0335056_0479002_124_255 | 3300034120 | Freshwater | MTADVDSELPDSKIPWWDNDYEGVYSNDPENGYPYDMGTKVQE |
| Ga0335017_0486877_457_603 | 3300034167 | Freshwater | MSLNWRIKMSEENLPDTKIPWWDNHYEDVYSEDPEDGYPYDMGSKVQE |
| Ga0335065_0594340_217_348 | 3300034200 | Freshwater | MTDAADDSLPDSKIPWWDNDYEGTNSDDPENGYPYDVGTKVQE |
| Ga0335013_0187437_894_1028 | 3300034284 | Freshwater | MQAEENNDDLPDSKIPWWDNHYEGVYSDDPEHGYPYDIGTKVQE |
| Ga0335013_0283452_755_871 | 3300034284 | Freshwater | MSTLPDSKTPWWDNHYEDTYSEEVEDGYPYDIGTKVQE |
| ⦗Top⦘ |