


| Basic Information | |
|---|---|
| Family ID | F042819 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 157 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTWKRVATAAVLIPFVVGIVLWGSTAIVALAVALVTVLALFEY |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 157 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.35 % |
| % of genes near scaffold ends (potentially truncated) | 98.09 % |
| % of genes from short scaffolds (< 2000 bps) | 89.81 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.083 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (36.943 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.943 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.675 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 157 Family Scaffolds |
|---|---|---|
| PF01255 | Prenyltransf | 43.31 |
| PF00903 | Glyoxalase | 12.74 |
| PF01433 | Peptidase_M1 | 3.18 |
| PF12681 | Glyoxalase_2 | 1.91 |
| PF02585 | PIG-L | 1.27 |
| PF07228 | SpoIIE | 1.27 |
| PF04191 | PEMT | 1.27 |
| PF01566 | Nramp | 1.27 |
| PF05163 | DinB | 1.27 |
| PF03551 | PadR | 0.64 |
| PF13462 | Thioredoxin_4 | 0.64 |
| PF13493 | DUF4118 | 0.64 |
| PF03702 | AnmK | 0.64 |
| PF03544 | TonB_C | 0.64 |
| PF05050 | Methyltransf_21 | 0.64 |
| PF01494 | FAD_binding_3 | 0.64 |
| PF03448 | MgtE_N | 0.64 |
| PF07883 | Cupin_2 | 0.64 |
| PF05973 | Gp49 | 0.64 |
| PF01928 | CYTH | 0.64 |
| COG ID | Name | Functional Category | % Frequency in 157 Family Scaffolds |
|---|---|---|---|
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 43.31 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 3.18 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.27 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 1.27 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 1.27 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.27 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.64 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.64 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.64 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.64 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.64 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.64 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.64 |
| COG2377 | 1,6-Anhydro-N-acetylmuramate kinase | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.64 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.64 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.08 % |
| Unclassified | root | N/A | 8.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10129157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1772 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100386962 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300002914|JGI25617J43924_10224876 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005176|Ga0066679_10768634 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005537|Ga0070730_10028043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4280 | Open in IMG/M |
| 3300005545|Ga0070695_101346936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 591 | Open in IMG/M |
| 3300005554|Ga0066661_10305575 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300005556|Ga0066707_10070225 | All Organisms → cellular organisms → Bacteria | 2087 | Open in IMG/M |
| 3300005560|Ga0066670_10779572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300005568|Ga0066703_10051527 | All Organisms → cellular organisms → Bacteria | 2306 | Open in IMG/M |
| 3300005575|Ga0066702_10537686 | Not Available | 707 | Open in IMG/M |
| 3300006059|Ga0075017_101197526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300006796|Ga0066665_11308726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 557 | Open in IMG/M |
| 3300006804|Ga0079221_11136304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 601 | Open in IMG/M |
| 3300007255|Ga0099791_10474257 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300007265|Ga0099794_10070625 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300009038|Ga0099829_11187266 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300009088|Ga0099830_11583848 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300009088|Ga0099830_11674850 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300009089|Ga0099828_10688881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 918 | Open in IMG/M |
| 3300009089|Ga0099828_10728227 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300009090|Ga0099827_11378368 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300009101|Ga0105247_10132137 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
| 3300009143|Ga0099792_10772078 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300009635|Ga0116117_1091952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300009839|Ga0116223_10177300 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300010043|Ga0126380_10989593 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300010046|Ga0126384_10430607 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300010048|Ga0126373_11343207 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300010048|Ga0126373_12269081 | Not Available | 603 | Open in IMG/M |
| 3300010321|Ga0134067_10280330 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300010358|Ga0126370_11839919 | Not Available | 587 | Open in IMG/M |
| 3300010358|Ga0126370_12666247 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300010362|Ga0126377_11905116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300010396|Ga0134126_10944573 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300011269|Ga0137392_11249722 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300011270|Ga0137391_10540775 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300011271|Ga0137393_10175256 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
| 3300011271|Ga0137393_10443442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1113 | Open in IMG/M |
| 3300011271|Ga0137393_10828425 | Not Available | 790 | Open in IMG/M |
| 3300011271|Ga0137393_11584154 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300011271|Ga0137393_11625836 | Not Available | 535 | Open in IMG/M |
| 3300011271|Ga0137393_11667042 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012096|Ga0137389_10635947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
| 3300012096|Ga0137389_10838468 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300012096|Ga0137389_11034817 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012096|Ga0137389_11114561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300012189|Ga0137388_10072650 | All Organisms → cellular organisms → Bacteria | 2871 | Open in IMG/M |
| 3300012189|Ga0137388_11180833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300012203|Ga0137399_11060386 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300012205|Ga0137362_10243348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1553 | Open in IMG/M |
| 3300012205|Ga0137362_11164277 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300012207|Ga0137381_10650407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
| 3300012210|Ga0137378_11256507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300012351|Ga0137386_11217087 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012361|Ga0137360_10535705 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300012362|Ga0137361_11728266 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012685|Ga0137397_10280932 | Not Available | 1240 | Open in IMG/M |
| 3300012685|Ga0137397_10337926 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300012917|Ga0137395_11236959 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012918|Ga0137396_10197388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1479 | Open in IMG/M |
| 3300012922|Ga0137394_10528592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1001 | Open in IMG/M |
| 3300012922|Ga0137394_11206616 | Not Available | 620 | Open in IMG/M |
| 3300012923|Ga0137359_10367914 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300012923|Ga0137359_10421434 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300012925|Ga0137419_10640081 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300012925|Ga0137419_11199407 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012927|Ga0137416_11039806 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300012929|Ga0137404_10492502 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300012929|Ga0137404_12282105 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012930|Ga0137407_10667588 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300012944|Ga0137410_11045860 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012944|Ga0137410_11255726 | Not Available | 639 | Open in IMG/M |
| 3300012977|Ga0134087_10487668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300015053|Ga0137405_1360816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3231 | Open in IMG/M |
| 3300015067|Ga0167640_115003 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300016445|Ga0182038_10546598 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300017927|Ga0187824_10126224 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300017943|Ga0187819_10755502 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300017955|Ga0187817_10218623 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300018015|Ga0187866_1002323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15983 | Open in IMG/M |
| 3300018060|Ga0187765_11381133 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300018088|Ga0187771_10352346 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300018088|Ga0187771_11121724 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300018431|Ga0066655_10691311 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300018433|Ga0066667_11998099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300018468|Ga0066662_12984612 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300019788|Ga0182028_1247042 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300020199|Ga0179592_10415895 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300020579|Ga0210407_10820943 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300020579|Ga0210407_10991405 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300020581|Ga0210399_10412974 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300020582|Ga0210395_11183047 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300020583|Ga0210401_10260202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1595 | Open in IMG/M |
| 3300021168|Ga0210406_10170770 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300021170|Ga0210400_10107674 | All Organisms → cellular organisms → Bacteria | 2213 | Open in IMG/M |
| 3300021171|Ga0210405_11169241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300021178|Ga0210408_10539064 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300021401|Ga0210393_10864958 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300021401|Ga0210393_11272835 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300021404|Ga0210389_10567543 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300021420|Ga0210394_10695515 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300021474|Ga0210390_10468583 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300021478|Ga0210402_10480190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1154 | Open in IMG/M |
| 3300021478|Ga0210402_11464586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300021559|Ga0210409_11222502 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300021559|Ga0210409_11235545 | Not Available | 623 | Open in IMG/M |
| 3300021559|Ga0210409_11394393 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300024347|Ga0179591_1128154 | All Organisms → cellular organisms → Bacteria | 2308 | Open in IMG/M |
| 3300025900|Ga0207710_10516558 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300025921|Ga0207652_10027017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4783 | Open in IMG/M |
| 3300025922|Ga0207646_11547450 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300026291|Ga0209890_10262850 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300026295|Ga0209234_1031535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2013 | Open in IMG/M |
| 3300026307|Ga0209469_1130687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300026317|Ga0209154_1109222 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300026342|Ga0209057_1218151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300026532|Ga0209160_1244713 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300026551|Ga0209648_10339815 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300026551|Ga0209648_10527653 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300027512|Ga0209179_1028782 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300027643|Ga0209076_1021726 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300027857|Ga0209166_10708750 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300027867|Ga0209167_10743653 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300027874|Ga0209465_10006345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5191 | Open in IMG/M |
| 3300027875|Ga0209283_10605066 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300027884|Ga0209275_10657641 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300027889|Ga0209380_10830479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300027898|Ga0209067_10456778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300027903|Ga0209488_10991165 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300027911|Ga0209698_11153350 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300028536|Ga0137415_10260240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1543 | Open in IMG/M |
| 3300028536|Ga0137415_10381404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1213 | Open in IMG/M |
| 3300028536|Ga0137415_10991149 | Not Available | 651 | Open in IMG/M |
| 3300028792|Ga0307504_10004510 | All Organisms → cellular organisms → Bacteria | 2839 | Open in IMG/M |
| 3300028808|Ga0302228_10274122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300030737|Ga0302310_10290301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300030940|Ga0265740_1011881 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300031128|Ga0170823_10674837 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300031446|Ga0170820_14883394 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300031715|Ga0307476_10724276 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300031720|Ga0307469_10587376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
| 3300031720|Ga0307469_10731908 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300031753|Ga0307477_10532580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300031912|Ga0306921_11776000 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300031946|Ga0310910_10335825 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300031947|Ga0310909_10949885 | Not Available | 704 | Open in IMG/M |
| 3300031962|Ga0307479_10083663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3089 | Open in IMG/M |
| 3300031962|Ga0307479_10148615 | All Organisms → cellular organisms → Bacteria | 2297 | Open in IMG/M |
| 3300031962|Ga0307479_12037254 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300032174|Ga0307470_11031925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300032174|Ga0307470_11482550 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300032180|Ga0307471_100524659 | Not Available | 1335 | Open in IMG/M |
| 3300032180|Ga0307471_101452876 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300032180|Ga0307471_103457280 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 36.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.01% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.46% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.91% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.91% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.27% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.27% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.27% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.64% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.64% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.64% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.64% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.64% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.64% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.64% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.64% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015067 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7A, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_101291574 | 3300001593 | Forest Soil | MTWKRVATAVVLIPFVVGLVVWGSTAIVALAVALVTLL |
| JGIcombinedJ26739_1003869623 | 3300002245 | Forest Soil | MTWKRVATAAVLXPVVVGLVLWGSTIVVALVLALVMLLALFEYFALG |
| JGI25617J43924_102248762 | 3300002914 | Grasslands Soil | MTWKRVATAAVLIPFVVGIVLWGSTAIVALAVALVTVLALFEY |
| Ga0066679_107686342 | 3300005176 | Soil | MTWKRVATAAVLIPFVVSLVVRGSTAIVALAVALVTLLALFEYFALG |
| Ga0070730_100280431 | 3300005537 | Surface Soil | MTWKRVATAVVLIPGVVALILLGSTALVAIGMALVILLALFEFFTLG |
| Ga0070695_1013469361 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MTWKRVATAVVLIPCVVGLVLWGSTAVVALGIALVITLALFEYFAL |
| Ga0066661_103055751 | 3300005554 | Soil | MTWKRVATAVVLIPFVVGIVLWGSTAILALAVGLVTMLALFEYF |
| Ga0066707_100702251 | 3300005556 | Soil | MTWKRVATAALLIPFAVGLALWSSTAVLALALALVVMIAL |
| Ga0066670_107795722 | 3300005560 | Soil | MTWKRVATAVVLIPFVVGIVLWGSTAILALAVGLVT |
| Ga0066703_100515272 | 3300005568 | Soil | MTWKRVATAVVLIPFVVGIVLRGSTAILALAVGLVTMLALF |
| Ga0066702_105376861 | 3300005575 | Soil | MTWKRVATAAVLIPIVVGIVLWGSTAVMALALALVIPLALFEYFALGEAI |
| Ga0075017_1011975262 | 3300006059 | Watersheds | MTWKRVATAAVLIPFAVGIVLWGSTAVLALAVALVTLLALFEY |
| Ga0066665_113087261 | 3300006796 | Soil | MTWKRVLTAAVLVPAVVLLVFEASTAVVSLAVALVMLF |
| Ga0079221_111363042 | 3300006804 | Agricultural Soil | MTWKRVATAVVLIPAVVGLVVWGSTAWVALALALIILVALFEYFSLGDAIG |
| Ga0099791_104742571 | 3300007255 | Vadose Zone Soil | MTWKRVATAVVLIPAVVALIVKGSTALVALALALVIL |
| Ga0099794_100706251 | 3300007265 | Vadose Zone Soil | MTWKRVVTAAVLIPFVVGLVLWGSTAILALGVALVVMLAMFEYFA |
| Ga0099829_111872661 | 3300009038 | Vadose Zone Soil | MTWKRVATAVVLIPSVVGIVLWGSTAIVALAVGLVTLL |
| Ga0099830_115838481 | 3300009088 | Vadose Zone Soil | MTWKRVATAAVLIPFVVGVVLWGSTAVMALAVALVT |
| Ga0099830_116748501 | 3300009088 | Vadose Zone Soil | MTWKRVATAAVLIPFVVGIVLWGSTAWVALALALIILL |
| Ga0099828_106888812 | 3300009089 | Vadose Zone Soil | MTWKRVATAGVLIPFAVGIVLWGSTALLAVTVALVTLLA |
| Ga0099828_107282271 | 3300009089 | Vadose Zone Soil | MTWKRVATAVVLMPFVVGLVLWGSTAWVALALALIIVLAL |
| Ga0099827_113783682 | 3300009090 | Vadose Zone Soil | MTWKRVATAAVLIPFVVGIVLWGSTAIVALAVGLVTVLALFEYFALGEAI |
| Ga0105247_101321371 | 3300009101 | Switchgrass Rhizosphere | MTWKRVATAVVLIPFVVGLVLFAATAWVAAALGVVTILAMVEYFSLGDA |
| Ga0099792_107720781 | 3300009143 | Vadose Zone Soil | MTWKRVATAGVLIPFVVGIVLWGSTAIVALAVGLVTLLALFEYFNL |
| Ga0116117_10919522 | 3300009635 | Peatland | MTWKRVVTAVVLIPFVVGLVLYGSTLLVAAGTGVFMVLAL |
| Ga0116223_101773002 | 3300009839 | Peatlands Soil | MTWKRVGTAVVLMPVVIALVLWGSTTVVAVAVAVLT |
| Ga0126380_109895931 | 3300010043 | Tropical Forest Soil | MTWKRVATAVVLIPGVVALSLKGSTALVAIGMALVILLALFEFFALG |
| Ga0126384_104306071 | 3300010046 | Tropical Forest Soil | MTWKRVATAVVLIPSVVALILLESTAFVAIGMALVILLGLFEFF |
| Ga0126384_107032601 | 3300010046 | Tropical Forest Soil | MTWKRVATALVLIPVVVGLVLFTPTWVVAMATAAITVRALGIFRPRRRH |
| Ga0126373_113432071 | 3300010048 | Tropical Forest Soil | MTWQRVATALVLVPLVVGVVLWGSTALVSMAIALVTLLA |
| Ga0126373_122690812 | 3300010048 | Tropical Forest Soil | VTWKRVATAIVLIPLVVGLVLWASTAIVSIAIALVTLL |
| Ga0134067_102803302 | 3300010321 | Grasslands Soil | MTWKRVATAVALVPLVVSLVLWGSTATVSLGVALVTLLALFE |
| Ga0126370_118399191 | 3300010358 | Tropical Forest Soil | MTWKRAATAVVLTPLVVGLVLWGSTAVVSMAVALVTLLALFEYFALG |
| Ga0126370_126662472 | 3300010358 | Tropical Forest Soil | MTWKRVATAAVLIPVVVGLVGYAPTSWMAIALTLVMLLALFEYFA |
| Ga0126377_119051162 | 3300010362 | Tropical Forest Soil | VTWKRVATAAILIPVVVALVLWGSTAVVAIAVALFTM |
| Ga0134126_109445731 | 3300010396 | Terrestrial Soil | MTWKRVATAVVLIPFVVGLVLFAATAWVAAALGVVTILAMVEYFSLGD |
| Ga0137392_112497222 | 3300011269 | Vadose Zone Soil | MTWKRVATAAVLIPFVVGIVLWGSTAWVALALALIILLALF |
| Ga0137391_105407753 | 3300011270 | Vadose Zone Soil | MTWKRVATAAVLIPFAVGIVLLGSTAIVALAVGLVTML |
| Ga0137393_101752561 | 3300011271 | Vadose Zone Soil | MTWKRVATAAVLIPFVVGIVLWGSTAVMALAVALVTLLALFEYFA |
| Ga0137393_104434423 | 3300011271 | Vadose Zone Soil | MTWKRVATAAVLIPFAVGIVLWGSTALLALAVALVTLLALFEY |
| Ga0137393_108284251 | 3300011271 | Vadose Zone Soil | MTWKRVATAGVLIPFVVGIVLWGSTAIVALAVGLVTLLALFEYFT |
| Ga0137393_115841542 | 3300011271 | Vadose Zone Soil | MTWKRVATAAVLIPFAVGIVLWGSTAIVALAVGLV |
| Ga0137393_116258361 | 3300011271 | Vadose Zone Soil | MTWKRVATAVVLIPCVVGLVLWASTAIVALAVGLVTVLALFEY |
| Ga0137393_116670421 | 3300011271 | Vadose Zone Soil | MTWTRVATAAVLIPFVVGMVLWGSTAWVALALALIILLALFEYFALGDAIG |
| Ga0137389_106359471 | 3300012096 | Vadose Zone Soil | MTWKRVATAAVLIPFAVGLVLWGSTAIVALAVGLVTL |
| Ga0137389_108384682 | 3300012096 | Vadose Zone Soil | MTWKRVATAAVLIPFAVGIVLWGSTAIVALAVALVTLLALFEYFALG |
| Ga0137389_110348172 | 3300012096 | Vadose Zone Soil | MTWKRVATGAVLIPVVVGLVLWGSTAIVALATALVMLLALFEYF |
| Ga0137389_111145612 | 3300012096 | Vadose Zone Soil | MTWKRVATAVVLIPCVVGLVLWASTAIVALAVGLVTVLALFE* |
| Ga0137388_100726503 | 3300012189 | Vadose Zone Soil | MTWKRVVTAAVLIPFVVGLVLWGSTAILALGVALVVLLAMFEYFA |
| Ga0137388_111808332 | 3300012189 | Vadose Zone Soil | MTWKRVATAVVLIPIAVGLVLWGSTALVSLAIALVT |
| Ga0137399_110603861 | 3300012203 | Vadose Zone Soil | MTWKRVATAVVLIPFVVGLVLWASTAWVALALALI |
| Ga0137362_102433481 | 3300012205 | Vadose Zone Soil | MTWKRVATAAVLIPFAVGIVLWGSTALLALVVALVTLLA |
| Ga0137362_111642772 | 3300012205 | Vadose Zone Soil | MTLKRVATAAVLIPFVVGLVLFGSTNWVAVALALVTVLAL |
| Ga0137380_100655274 | 3300012206 | Vadose Zone Soil | MTWKRVATAAVLIPFAVGLVLWGSTALLALASLVDNRCQI* |
| Ga0137381_106504071 | 3300012207 | Vadose Zone Soil | MTWKRVATAAVLIPFAVGLVLWGSTALLGLAVALVTLLALFEYFS |
| Ga0137378_112565073 | 3300012210 | Vadose Zone Soil | MTWKRVATAVVLVPFAVGLVLWGSTAMVSIAVALVTLLALFEYF |
| Ga0137386_112170871 | 3300012351 | Vadose Zone Soil | MTWKRVATAAVLIPFAVGLVLWGSTALLALAVALVTLLAL |
| Ga0137360_105357051 | 3300012361 | Vadose Zone Soil | MTWKRVVTAALLIPFVVGLVLWGSTAILSLGVALVVML |
| Ga0137361_117282661 | 3300012362 | Vadose Zone Soil | MTWKRVATAGVLIPFAVGLILWGSTALLALAMALVTLFALFEYF |
| Ga0137397_102809321 | 3300012685 | Vadose Zone Soil | MTWKRVVTAAVLIPFVVGLVLWGSTAILSLGVALVVMLAMFEYFALGDAI |
| Ga0137397_103379262 | 3300012685 | Vadose Zone Soil | MTWTRVATAAVLIPFVVGLVVWGSTAWVALALALVVVL |
| Ga0137395_112369591 | 3300012917 | Vadose Zone Soil | MTWKRVATAAVLIPCVVGLVLGAPTALVAVALALVILLA |
| Ga0137396_101973882 | 3300012918 | Vadose Zone Soil | MTWKRVATAAVLIPLAVGLVLRGSTALLTLAVALVTMLALFEYFALGEA |
| Ga0137394_105285921 | 3300012922 | Vadose Zone Soil | MTWKRVVTAAVLIPFVVGLVLWGSTAILALGVALV |
| Ga0137394_112066161 | 3300012922 | Vadose Zone Soil | MTWKRVVTAAVLIPFVVGLVLWGSTAILALGVALVVMLAMFEYF |
| Ga0137359_103679141 | 3300012923 | Vadose Zone Soil | MTWKRVVTAAVLIPFVVGLVLWGSTAILALGVALVV |
| Ga0137359_104214341 | 3300012923 | Vadose Zone Soil | MTWKRVATAVVLIPFVVGLVLWGSTAWVALVLALII |
| Ga0137419_106400811 | 3300012925 | Vadose Zone Soil | MTWTRVATAAVLIPFVVGLVVWGSTAWVALALALVV |
| Ga0137419_111994072 | 3300012925 | Vadose Zone Soil | MTWKRVVTAAVLIPFAVGIVLWGSTALLALAVALVTMLALFEYFALGEA |
| Ga0137416_110398061 | 3300012927 | Vadose Zone Soil | MTWKRVATAVVLIPFVVGLVVWGSTAIVALAVALVTLLALFEYFA |
| Ga0137404_104925021 | 3300012929 | Vadose Zone Soil | MTWKRVVTAAVLIPFVVGLVLWGSTALLALGVALVVML |
| Ga0137404_122821051 | 3300012929 | Vadose Zone Soil | MTWKRVATAVVLIPFVVGLVVWGSTAIVALAVGLVTLVALFEYFALGEAIGH |
| Ga0137407_106675881 | 3300012930 | Vadose Zone Soil | MTWKRVVTAAVLIPFAVGIVLWGSTAVLALAVALVT |
| Ga0137410_110458602 | 3300012944 | Vadose Zone Soil | MTWKRVATAVVLIPFVVGIVLWGSTAIVALAVGLVTVLALFEYF |
| Ga0137410_112557261 | 3300012944 | Vadose Zone Soil | MTWKRVVTAAVLIPFVVGLVLWGSTAILALGLALVVM |
| Ga0134087_104876681 | 3300012977 | Grasslands Soil | MTWKRVATAVVLIPFVVGIVLWGSTALLALAVALVT |
| Ga0137405_13608161 | 3300015053 | Vadose Zone Soil | VWATAAVLIPFVVGLVVWGSTAWVALALALVVVLALFEY |
| Ga0167640_1150032 | 3300015067 | Glacier Forefield Soil | MTWKRVATAAVLIPIVVALVLFASTGGVAIALSIIIVLALFEYFSLGDAI |
| Ga0182038_105465981 | 3300016445 | Soil | MTWKRVATAVILIPVVVGLVLLAPPSWLAIVLALL |
| Ga0187824_101262241 | 3300017927 | Freshwater Sediment | MTWKRIATAVVLIPCVIGLVLWGSTAVVALCLALVML |
| Ga0187819_107555021 | 3300017943 | Freshwater Sediment | MTWKRVATAAVLIPFVVGLVLWGSTALVALVTALVI |
| Ga0187817_102186232 | 3300017955 | Freshwater Sediment | MMWKRVATAVVLMPLVVGLVLWASTAVVAVAVAALT |
| Ga0187866_10023231 | 3300018015 | Peatland | MTWKRVATAAVLMPVVIGLVLWGSTTVVAVAVAVLT |
| Ga0187765_113811331 | 3300018060 | Tropical Peatland | MTWKRVATAVVLIPLVVGIVLYGSTAWVAVALGLVT |
| Ga0187771_103523461 | 3300018088 | Tropical Peatland | MMWKRVATAVVLMPVAIALVLWGSTTVVAAAVAALTAV |
| Ga0187771_111217242 | 3300018088 | Tropical Peatland | MMWKRVATAVVLMPLVVVLVLWGSTLVLAAAVAALAA |
| Ga0066655_106913112 | 3300018431 | Grasslands Soil | MTWKRVATAAVLIPFVVGIVLWGSTAILALAVGLVTMLALF |
| Ga0066667_119980991 | 3300018433 | Grasslands Soil | MTWKRVATAVVLVPFAVGLVLWGSTAIVSIAVALVTLLALF |
| Ga0066662_129846122 | 3300018468 | Grasslands Soil | MTWKRVATAVVLIPFVVGIVLWGSTALLALAVALVTMLALFEYFALG |
| Ga0182028_12470422 | 3300019788 | Fen | MTWKRVATAVVLMPVVIGLVLWGSTTVVAVAVAVL |
| Ga0179592_104158952 | 3300020199 | Vadose Zone Soil | MTLKRVATAAVLIPFVVGLVLFGSTNWVAVALALVTVLALHEFFALGDAI |
| Ga0210407_108209432 | 3300020579 | Soil | MTWKRVATAVVLIPCVVGLVLWGSAAVLAVGLAFVILLALFEYFA |
| Ga0210407_109914052 | 3300020579 | Soil | MTWKRVATAVVLIPCVVGLVLWGSTAVLAVGVALVTVLALFE |
| Ga0210399_104129742 | 3300020581 | Soil | MTWKRVATAAVLIPCVVGLVLWGSTAAMAIGVAFVILLALFEYFALGDAIGH |
| Ga0210395_111830472 | 3300020582 | Soil | MTWKRVATAAVLIPFAVGLVLWGSTAMVALAVGLLTLLAL |
| Ga0210401_102602023 | 3300020583 | Soil | MTWKRIATAAVLIPCVVGLVLWGSTAFVAIGTALVVLIALFEFFALGDA |
| Ga0210406_101707701 | 3300021168 | Soil | MTWKRVLTAAVLIPFAVGIVFWGSTALLALAVALVTM |
| Ga0210400_101076742 | 3300021170 | Soil | MTWKRVATAAVLIPFVVGLVVWGSTAIVALAVALVTL |
| Ga0210405_111692411 | 3300021171 | Soil | MTWKRVATAAVLIPFAVGIVLWGSTAVLALVVGLVTLLALFEYF |
| Ga0210408_105390641 | 3300021178 | Soil | MTWKRVATAVILIPFVVGLVLWGSTAWVALALALITVMALF |
| Ga0210393_108649581 | 3300021401 | Soil | MTWKRVATAAVLIPFVVGLVLLGSTAWVAAGTALIV |
| Ga0210393_112728351 | 3300021401 | Soil | MTWKRVATAAVLIPCVVGLVLWGSTAVVAIATAFVI |
| Ga0210389_105675432 | 3300021404 | Soil | MTWKRVATAVVLIPFVVGLVLYASTAWVAVALAAIIALAMIEYFALG |
| Ga0210394_106955152 | 3300021420 | Soil | MTWKRVATAVVLIPCVVGLVLWGSTGVLAAGLAFVILLALF |
| Ga0210390_104685832 | 3300021474 | Soil | MTWKRVATAAVLIPCVVGLVLWGSTAAVTIGTALVIL |
| Ga0210402_104801902 | 3300021478 | Soil | MTWKRVATAAVLIPFAVGLVLWGSTAIVALVVGLVMML |
| Ga0210402_114645861 | 3300021478 | Soil | MTWKRVATAAVLIPFAVGLVLWGSTAIVALATALVTLVALFEYFAL |
| Ga0210409_112225022 | 3300021559 | Soil | MTWKRVATAVVLIPCVVGLVLWGSTAVLAVGLTFVILLALFEYFALG |
| Ga0210409_112355452 | 3300021559 | Soil | MTWKRVATAAVLIPFVVGLVLWGSTAIVALATALVSMLALFEYF |
| Ga0210409_113943932 | 3300021559 | Soil | MTWKRVATAAALIPLAVGLVLWGSTAVLALAVALVTLLALFEYF |
| Ga0179591_11281543 | 3300024347 | Vadose Zone Soil | MTWKRVVTAAVLIPFAVGIVLWGSTAVLALAVALVTMLALFE |
| Ga0207710_105165582 | 3300025900 | Switchgrass Rhizosphere | MTWKRVATAVVLIPFVVGLVLFAATAWVAAALGVVTILA |
| Ga0207652_100270175 | 3300025921 | Corn Rhizosphere | MTWKRVATAVVLIPCVIGLVLWGSTAVVALGLALVIALALFEYFA |
| Ga0207646_115474502 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTWKRVATAVVLIPCVIGLVLWGSTAVVALGLALVIALALFEYFALGDA |
| Ga0209890_102628501 | 3300026291 | Soil | MTWKRVATAAVLIPFVVGLVLFGSTNWVAVALALVVLL |
| Ga0209234_10315352 | 3300026295 | Grasslands Soil | MTWKRVATAVVLIPFVVGIVLWGSTAILALAVGLVTLLALFEYFTLG |
| Ga0209469_11306871 | 3300026307 | Soil | MTWKRVATAVVLVPFAVGLLLWGSTAIVSIAVALVTLLALFEYFA |
| Ga0209154_11092221 | 3300026317 | Soil | MTWKRVATAVVLIPFVVGIVLWGSTAILALAVGLVTMLALFEYFA |
| Ga0209057_12181511 | 3300026342 | Soil | MTWKRVATAVVLIPFVVGIVLWGSTAILALAVGLVTMLALFEYFALGDA |
| Ga0209160_12447132 | 3300026532 | Soil | MTWKRVATAAVLIPFVVGIVLRGSTAIVALAVGLVTMVA |
| Ga0209648_103398152 | 3300026551 | Grasslands Soil | MTWKRVATAAVLIPCVVGLVLGAPTALVAVALALVI |
| Ga0209648_105276532 | 3300026551 | Grasslands Soil | MTWTRVATAAVLIPFVVGIVLWGSTAWVALALALIILLALFEYFA |
| Ga0209179_10287821 | 3300027512 | Vadose Zone Soil | MTWTRVATAAVLIPFVVGLVVWGSTAWVALALALVVVLAL |
| Ga0209076_10217263 | 3300027643 | Vadose Zone Soil | MTWKRVATAAVLIPFVVGIVLWGSTAVMALAVALV |
| Ga0209166_107087501 | 3300027857 | Surface Soil | MTWKRVATAVVLIPGVVALILLGSTALVAIGMALVILLALFEFFTLGTPLGTVP |
| Ga0209167_107436532 | 3300027867 | Surface Soil | MTWKRVATAAVLIPFVVGLVLFGSTAWVAAGTALIVVLALREYFGLGDAI |
| Ga0209465_100063451 | 3300027874 | Tropical Forest Soil | MTWKRVSTAVVLVPVAVGLVLWGSTAIVAIAVALITLLALFE |
| Ga0209283_106050661 | 3300027875 | Vadose Zone Soil | MTWKRVATAAVLIPVVVGLVVWGSTAIVALAVALVTL |
| Ga0209275_106576411 | 3300027884 | Soil | MTWKRVATAVVLIPFVVGLVLYASTAVVAVALAAI |
| Ga0209380_108304792 | 3300027889 | Soil | MTWKRVVTAAVLIPLVVGLVLYGATWVVALGVSVFI |
| Ga0209067_104567782 | 3300027898 | Watersheds | MTWKRVATAAVLIPFAVGIVLWGSTAVLALAVALVTLL |
| Ga0209488_109911652 | 3300027903 | Vadose Zone Soil | MTWTRVATAAVLIPFVVGLVVWGSTAWVALALALVVVLALFEYFSL |
| Ga0209698_111533501 | 3300027911 | Watersheds | MIWKRLATAAVLIPVVVGMVLKASTGILAIGTALVMLLALFEYFA |
| Ga0137415_102602403 | 3300028536 | Vadose Zone Soil | MTWKRVATAAALIPFAVGLALWSSTAVLALALALVVMIALF |
| Ga0137415_103814041 | 3300028536 | Vadose Zone Soil | MTWKRVATAAVLIPFAVGIVLWGSTALLTLAVALVTMLALFEYFALGEAI |
| Ga0137415_109911492 | 3300028536 | Vadose Zone Soil | MTWKRVVTAAVLIPFVVGLVLWGTTAILALGVALVVRL |
| Ga0307504_100045104 | 3300028792 | Soil | MTWKRVATAVVLIPFVVGLVLWASTAWVALALALIIVLALFEYFAL |
| Ga0302228_102741222 | 3300028808 | Palsa | MTWKRVATAVVLIPFVVGLVLWGSTLVVAVATGVFMVLALLEYFALG |
| Ga0302310_102903012 | 3300030737 | Palsa | MTWKRVATAVVLIPFVVGLVLWGSTLVVAVATGVFMVLA |
| Ga0265740_10118811 | 3300030940 | Soil | MTWKRVATAVVLIPCVVGLVLWGSTAVVAIALALVILLALFEFFTL |
| Ga0170823_106748372 | 3300031128 | Forest Soil | MTWKRVATAAVLIPCVVGLVLGAPTALVAVAVALVILLATFEYFSLGEAI |
| Ga0170820_148833941 | 3300031446 | Forest Soil | MTWKRVATAAVLIPCVVGLVLGAPTALVAVAVALVILL |
| Ga0307476_107242762 | 3300031715 | Hardwood Forest Soil | MTWKRVATAGVLIPFAVGIVLWGSTAVLALVVALVTL |
| Ga0307469_105873763 | 3300031720 | Hardwood Forest Soil | MTWKRVATAVVLIPIVVGLVLWCATAWVALAMGLIIVL |
| Ga0307469_107319081 | 3300031720 | Hardwood Forest Soil | MTWKRVATAVVLVPGVVALIFLESTAMVALGMALVILLSLFEFFALGD |
| Ga0307477_105325801 | 3300031753 | Hardwood Forest Soil | MTWKRVATAAVLIPFVVGIVLWASTAWMAVVLALIIVLALFEYFA |
| Ga0306921_117760002 | 3300031912 | Soil | MTWKRAATAAVLVPVVVDLVLWGSTAIVAIALITLLALQTKALNFEEQR |
| Ga0310910_103358252 | 3300031946 | Soil | MTWKRVATAIVLIPGVVALVSAAPTSWLAIVLALIILLALFEYFALGDAI |
| Ga0310909_109498852 | 3300031947 | Soil | MTWKRAATAAVLVPVVVDLVLWGSTAIVAIALITLLALQTKA |
| Ga0307479_100836634 | 3300031962 | Hardwood Forest Soil | MTWKRVATAVVLIPFVVGLVAAAPTSWVTIAVALVVLLALFEFFALGNAIGH |
| Ga0307479_101486153 | 3300031962 | Hardwood Forest Soil | MTWKRVATAAVLIPFVVGIVLWGSTAIMALAVGLVTLLALFEYF |
| Ga0307479_120372541 | 3300031962 | Hardwood Forest Soil | MTWKRVATAVVLIPFVVGLVLFGSTAWVAVVLALIVALALWEYF |
| Ga0307470_110319252 | 3300032174 | Hardwood Forest Soil | MTWKRVATAVVLIPFVVGLVLWGSTAWVALVLALI |
| Ga0307470_114825502 | 3300032174 | Hardwood Forest Soil | MTWKRVATAAVLMPVVLGLVLLASTAWVALALAVVT |
| Ga0307471_1005246591 | 3300032180 | Hardwood Forest Soil | MTWKRVVTAAVLIPFVVGLVLWGSTAILALGVSLVVMLA |
| Ga0307471_1014528761 | 3300032180 | Hardwood Forest Soil | MTRKRVVTAAVLIPFVVGLVLRGSTAILALGVALVVMLAMFEY |
| Ga0307471_1034572802 | 3300032180 | Hardwood Forest Soil | MTWKRVATAMVLIPVVVGLVVWGSTAWVALALALVVVLALFE |
| ⦗Top⦘ |