


| Basic Information | |
|---|---|
| Family ID | F042561 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 158 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MAKKKTDKLWGGYKQYTLTDGTKFLARDDSDAKLYREKVGDKS |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 158 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 79.75 % |
| % of genes near scaffold ends (potentially truncated) | 21.52 % |
| % of genes from short scaffolds (< 2000 bps) | 84.18 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (75.949 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (34.810 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.013 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.671 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.49% β-sheet: 11.27% Coil/Unstructured: 73.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 158 Family Scaffolds |
|---|---|---|
| PF00565 | SNase | 17.09 |
| PF01327 | Pep_deformylase | 6.96 |
| PF02810 | SEC-C | 5.06 |
| PF00730 | HhH-GPD | 1.90 |
| PF01048 | PNP_UDP_1 | 1.90 |
| PF08406 | CbbQ_C | 1.27 |
| PF10262 | Rdx | 1.27 |
| PF05838 | Glyco_hydro_108 | 1.27 |
| PF02511 | Thy1 | 0.63 |
| PF00011 | HSP20 | 0.63 |
| PF04831 | Popeye | 0.63 |
| PF00156 | Pribosyltran | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 158 Family Scaffolds |
|---|---|---|---|
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 6.96 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.90 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 1.90 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 1.90 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 1.90 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.90 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 1.90 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 1.90 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 1.90 |
| COG0714 | MoxR-like ATPase | General function prediction only [R] | 1.27 |
| COG3926 | Lysozyme family protein | General function prediction only [R] | 1.27 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 75.95 % |
| All Organisms | root | All Organisms | 24.05 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 34.81% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 23.42% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 8.23% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.43% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.43% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.16% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.53% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 2.53% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.90% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.90% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.27% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 1.27% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.27% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.27% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.27% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.63% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.63% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.63% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.63% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.63% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.63% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.63% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.63% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.63% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001960 | Marine microbial communities from South of Charleston, South Carolina, USA - GS014 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005510 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300014818 | Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0152 : 8 days incubation | Environmental | Open in IMG/M |
| 3300017705 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020258 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556061-ERR598949) | Environmental | Open in IMG/M |
| 3300020343 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555975-ERR599174) | Environmental | Open in IMG/M |
| 3300020358 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020422 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020446 | Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020466 | Marine microbial communities from Tara Oceans - TARA_B100001540 (ERX556059-ERR598968) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300026257 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_1000658810 | 3300000101 | Marine | MSKKKTDKIWGDYKQYTLTDGTRFLARDDNDAKLYREKVGDNTNV* |
| DelMOSum2011_102144621 | 3300000115 | Marine | KKTNKNWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDKS* |
| DelMOWin2010_102167172 | 3300000117 | Marine | MAKKKKTYWDGYKQYTLKDGTKFYARDDHDAKLYREKVGDE* |
| BBAY92_101068583 | 3300000947 | Macroalgal Surface | MSKKKKTYWDGYKQYTLKDGTKFYARDDHDAKLYREKVGDE* |
| BBAY93_101990602 | 3300000973 | Macroalgal Surface | MAKKKKTYWSGYKQYTLKDGTKFYARDDQDADLYRKKVGE*NKIYLEKK |
| JGI24006J15134_100452417 | 3300001450 | Marine | MAKKKTKGIWGGYNQYTLTDGTKFIARDDSDAELYRKKVGDVK* |
| JGI24006J15134_100649304 | 3300001450 | Marine | MSKKKTKGIWSGYKQYTLTDGTKFIARDDSDAELYRQKVGDVK* |
| JGI24005J15628_101396414 | 3300001589 | Marine | KKKIKSPWGGYTQYTLTDGTKFLARDDSDAKLYRQKIGDKS* |
| GOS2230_10241373 | 3300001960 | Marine | MPKKKNKEKFWGGYKQYTLEDGTKFLARDDNDAKLYRSKVETSN* |
| Ga0066224_12895713 | 3300004457 | Marine | MCKKKTDKIWGYYKQYTLTDGTRFLARDDNDAKLYREKVGDNTNV* |
| Ga0066222_13332492 | 3300004460 | Marine | MAKKKPKGIWGSYNQYTLTDGTKFIARDDSDAELYRKKVGDVK* |
| Ga0068511_10509952 | 3300005057 | Marine Water | MSKKKKTYWEGYKIYTLSDGTKFYARDDSDAKLYREKVGDKS* |
| Ga0068511_11036203 | 3300005057 | Marine Water | MSKKTKTYWEGYKIYTLSDGTKFYARDDSDAKLYREKVGDKS* |
| Ga0066849_100569093 | 3300005430 | Marine | MSKKKTNKNWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDVK* |
| Ga0066825_101391793 | 3300005510 | Marine | MAKKKTTYWEGYKIYTLSDGTKFYARDDSDAKLYREKVGDKS* |
| Ga0066862_102671003 | 3300005521 | Marine | MSKKKTNKNWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDKS* |
| Ga0066850_102964802 | 3300005605 | Marine | MAKKKTKKLWEGYKQYTLTDGTRFIARDDSDAELYRQKVGDVK*GLL* |
| Ga0078893_114482592 | 3300005837 | Marine Surface Water | MAMKKTDKLWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDVK* |
| Ga0066836_102319263 | 3300006166 | Marine | MSKKKTNKNWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDVK*GQY* |
| Ga0075511_16490124 | 3300006402 | Aqueous | MSKKTKTYWKGYKTYTLTDGTKFYARDDNDAKLYREKVGDKS* |
| Ga0070744_102051452 | 3300006484 | Estuarine | MSKKKTNKNWGGYKQYTLTDGTRFLARDDSDAELYRQKVGDVK*KILI* |
| Ga0098038_11241442 | 3300006735 | Marine | MSKKKTNKLWGGYKQYTLTDGTKFLARDDHDAKLYREKVGDNTNV* |
| Ga0098038_12750022 | 3300006735 | Marine | MSKKKTSKNWGGYKQYTLTDGTRFLARDDSDAELYRQKVGDKS* |
| Ga0098037_10062868 | 3300006737 | Marine | MSKKKTNKNWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDKS*NQ* |
| Ga0098042_10411855 | 3300006749 | Marine | MSKKKSKEKFWGGYKQYTLEDGTKFLARDDNDAKLYRSKVETSN* |
| Ga0098042_10810223 | 3300006749 | Marine | MSKKKTSKNWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDKS* |
| Ga0098040_10941552 | 3300006751 | Marine | MSKKKTKGFWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDVK* |
| Ga0098048_11726671 | 3300006752 | Marine | MAKKKTDKLWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDVK* |
| Ga0098044_10109857 | 3300006754 | Marine | MAKKKTKKLWEGYKQYTLTDGTRFIARDDSDAELYRQKVGDVK* |
| Ga0098044_13348091 | 3300006754 | Marine | IWGGYKRYTLTDGTRFIARDDSDAELYRQKVGDVK* |
| Ga0070750_103063892 | 3300006916 | Aqueous | MSKKNKTYWDGYKQYTLKDGTKFYARDDHDAKLYREKVGDE* |
| Ga0098060_10354895 | 3300006921 | Marine | GGYKQYTLTDGTKFIARDDSDAELYRKKVGDNTNV* |
| Ga0098051_10991623 | 3300006924 | Marine | MSKKKTSKNWGGYKQYTLTDGTKFLARDDSDAELYRQKVGEKS* |
| Ga0098050_11658773 | 3300006925 | Marine | MAKKKTDKLWGGYKQYTLTDGTKFLARDDSDAKLYREKVGDKS* |
| Ga0098034_10321521 | 3300006927 | Marine | MAKKKTDKIWGGYKRYTLTDGTRFIARDDSDAELYRQKVGDVK* |
| Ga0098041_10706051 | 3300006928 | Marine | MAKKKKKEHWGGYNQYTLEDGTKFLARDDHDADLYRI |
| Ga0098041_11889072 | 3300006928 | Marine | MAKKNKNKHWGAYKQYTLKDGTKFLARDDHDADLYRIKVGEKVASPYHGK* |
| Ga0098046_11246252 | 3300006990 | Marine | MAKKKTDKLWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDKS* |
| Ga0102817_10344024 | 3300007555 | Estuarine | MAKKKTKGIWGGYKQYTLTDGTKFIARDDSDAELYRQKVGDVK* |
| Ga0115566_105474634 | 3300009071 | Pelagic Marine | MSKKKTNKNWGGYKQYTLTDGTRFLARDDSDAKLYREKVGDKS* |
| Ga0115566_107588782 | 3300009071 | Pelagic Marine | MSKKKTKGIWGGYKQYTLTDGTKFIARDDSDAELYRQKVGDKS* |
| Ga0115557_11813683 | 3300009443 | Pelagic Marine | MSKKKTDKIWGDYKQYTLTDGTRFLARDDNGAKLYREKVGDNTNV* |
| Ga0114932_100092677 | 3300009481 | Deep Subsurface | MAKKKKTYWDGYKQYTLKDGSKFYARDDHDAQLYKKKVGDEK* |
| Ga0114932_102974952 | 3300009481 | Deep Subsurface | MSKKKKTYWDGYKKYTLKDGTKFYARDDHDAKLYREKVGE* |
| Ga0114932_105672182 | 3300009481 | Deep Subsurface | MAKKKKTYWDGYKQYTLKDGSKFYARDDNDAKLYREKVGE* |
| Ga0114932_106058162 | 3300009481 | Deep Subsurface | MSKKKTKGIWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDVK* |
| Ga0115013_100497776 | 3300009550 | Marine | KTYWDGYKKYTLKDGTKFYARDDHDAKLYREKVGE* |
| Ga0115011_105740223 | 3300009593 | Marine | MSKKNKTYWKGYKQYTLKDGTKFYARDDSDAKLYRKKVGE* |
| Ga0115001_100724642 | 3300009785 | Marine | MAKKKTKDIWGGYNQYTLTDGTKFIARDDSDAELYRKKVGDVK* |
| Ga0115012_100826633 | 3300009790 | Marine | MAKKKTDKIWGGYKQYTLTDGTKFIARDDSDAELYRKKVGDEK* |
| Ga0098043_10319913 | 3300010148 | Marine | MSKKKTNKNWGGYKQYTLTDGTKFLARDDSDAELYRQKVGEKS* |
| Ga0098049_11976011 | 3300010149 | Marine | MSKKKKTYWDGYKQYTLKDGTKFYARDDYDADLYRKKVGE* |
| Ga0098049_12486092 | 3300010149 | Marine | MAKKKKKEHWGGYNQYTLEDGTKFLARDDHDADLYRIKVGEKVASPYHGK* |
| Ga0133547_105193672 | 3300010883 | Marine | MSKKKTDKIWGDYKQYTLTDGTKFLARDEKDAQLYREKVGDNTNV* |
| Ga0133547_111697423 | 3300010883 | Marine | MAKKKIKSPWGGYTQYTLTDGTKFLARDDSDAKLYRQKVGDKS* |
| Ga0160423_1000728612 | 3300012920 | Surface Seawater | MPKKKSKEKFWGGYKQYTLEDGTKFLARDDKDAKLYRSKVEKGN* |
| Ga0160423_1003165811 | 3300012920 | Surface Seawater | MAKKSKQEKFWGGYKQYTLEDGTKFLARDDKDAKLYREKVGG* |
| Ga0160423_101516011 | 3300012920 | Surface Seawater | MSKKKSKEKFWGGYKQYTLEDGTKFLARDDNDAKLYRSKVEKSN |
| Ga0160423_103841872 | 3300012920 | Surface Seawater | MSKKNKTYWDGYKQYTLKDGTKFYARDDHDAKLYRKKVGDE* |
| Ga0160423_109676841 | 3300012920 | Surface Seawater | KTYWEGYKIYTLSDGTKFYARDDSDAKLYREKVGDKS* |
| Ga0163110_100266804 | 3300012928 | Surface Seawater | MAKKSKKQKLWGGYKQYTLEDGTKFLARDDKDAKLYRDKVGG* |
| Ga0163110_100981581 | 3300012928 | Surface Seawater | MSKKKKTYWEGYKKYTLSDGTKFYARNDSDAKLYREKVGDKS* |
| Ga0163110_115112872 | 3300012928 | Surface Seawater | MSKKTKTYWEGYKIYTLSDGTKFYARDDSDAKLYREKVG |
| Ga0163110_115119311 | 3300012928 | Surface Seawater | MAKKKKSYWAGYKQYTLKVGSKFYARDDEDAKLYRMKVGDEK* |
| Ga0163110_116134333 | 3300012928 | Surface Seawater | MAKKKTTYWEGYKIYTLSDGTKFYARDDSDAKLYRERVGDKS* |
| Ga0163109_104567872 | 3300012936 | Surface Seawater | MSKKAKTYWEGYKIYTLSDGTKFYARDDSDAKLYREKVGDKS* |
| Ga0163109_105306783 | 3300012936 | Surface Seawater | MAKKSKQEKFWGGYKQYTLEDGTKFLARDDKDAKLY |
| Ga0163180_106322475 | 3300012952 | Seawater | MSKKKKTYWEGYKKYTLSDGTKFYARDDSDAKLYREKVGDKS* |
| Ga0163111_106865132 | 3300012954 | Surface Seawater | MSKKKTNKFWGGYKQYTLTDGTKFLARDDHDAKLYREKVGDNTNV* |
| Ga0134300_10899851 | 3300014818 | Marine | MAKKKTKKLWEGYKQYTLTDGTRFLARDDNDAKLYREKVGDNTNV* |
| Ga0181372_10537341 | 3300017705 | Marine | GGYMSKKKTNKNWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDVK |
| Ga0181369_10909853 | 3300017708 | Marine | MAKKKTDKLWGGYKQYTLTDGTKFLARDDSDAELYRQKVG |
| Ga0181369_10915901 | 3300017708 | Marine | TDKLWGGYKQYTLTDGTKFLARDDSDAKLYREKVGDKS |
| Ga0181403_10013921 | 3300017710 | Seawater | MAKKKTKGIWGGYKQYTLTDGTKFIARDDSDAKLYREKVGD |
| Ga0181373_10756542 | 3300017721 | Marine | MAKKKTDKIWGGYKQYTLTDGTKFIARDDSDAELYRKKVGDNTNV |
| Ga0181416_11676262 | 3300017731 | Seawater | MSKKKTDKIWGDYKQYTLTDGTKFLARDDNDAKLYREKVGDNTNV |
| Ga0181415_11565071 | 3300017732 | Seawater | MAKKKTKGIWGGYKQYTLTDGTKFIARDDSDAKLYREKVGDKS |
| Ga0181389_10227921 | 3300017746 | Seawater | MAKKKTDKIWGGYKQYTLTDGTRFLARDDNDAKLYREKVGDNTNV |
| Ga0181406_12555472 | 3300017767 | Seawater | MSKKKTNKNWGGYKQYTLTDGTRFLARDDSDAKLYREKVG |
| Ga0181386_10799304 | 3300017773 | Seawater | MSKKKTSKNWGGYKQYTLTDGTRFLARDDSDAKLYREKVGDKS |
| Ga0181577_100559908 | 3300017951 | Salt Marsh | MSKKKSKEKFWGGYKQYTLEDGTKFLARDDNDAKLYRSKVETSN |
| Ga0181583_103588702 | 3300017952 | Salt Marsh | MSKKKKTYWDGYKQYTLKDGTKFYARDDHDAKLYREKVGDE |
| Ga0181580_106915943 | 3300017956 | Salt Marsh | YMSKKTKTYWEGYKIYTLSDGTKFYARDDSDAKLYREKVGDKS |
| Ga0181590_103416601 | 3300017967 | Salt Marsh | KTYWEGYKIYTLSDGTKFYARDDSDAKLYREKVGDKS |
| Ga0181585_102211226 | 3300017969 | Salt Marsh | MSKKTKTYWEGYKIYTLSDGTKIYARDDSDAKLYREKVGDKS |
| Ga0181566_104141612 | 3300018426 | Salt Marsh | MSKKKKTYWEGYKIYTLSDGTKFYARDDSDAKLYREKVGDKS |
| Ga0206125_100148403 | 3300020165 | Seawater | MSKKKTDKIWGDYKQYTLTDGTRFLARDDNDAKLYREKVGDNTNV |
| Ga0206124_103682402 | 3300020175 | Seawater | MSKKKTKGIWGGYKQYTLTDGTKFIARDDSDAELYRQKVGDKS |
| Ga0211529_10652033 | 3300020258 | Marine | MSKKTKTYWEGYKIYTLSDGTKFYARDDSDAKLYREKVGDKS |
| Ga0211626_10883441 | 3300020343 | Marine | MAKKKKTYWDGYKQYTLKDGTKFYARDDSDATLYRKKVGE |
| Ga0211689_12079473 | 3300020358 | Marine | MSKKKTKGIWSGYKQYTLTDGTKFIARDDSDAELYRQKVGDVK |
| Ga0211647_101280552 | 3300020377 | Marine | MSKKKTSKNWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDKSXNQ |
| Ga0211527_101647583 | 3300020378 | Marine | MAKKKNKTYWDGYKQYTLKDGTKFYARDDHDANLYRKKVGE |
| Ga0211652_100257532 | 3300020379 | Marine | MSKKKTSKNWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDKS |
| Ga0211476_100909594 | 3300020381 | Marine | MAKKKKTYWDGYKQYTLKDGSKFYARDDHDAQLYKKKVGDEK |
| Ga0211699_100117705 | 3300020410 | Marine | MSKKKKTYWKGYKKYTLSDGTKFYARDDSDAKLYREKVGDKS |
| Ga0211587_100911103 | 3300020411 | Marine | MSKKKTNKIWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDVK |
| Ga0211587_103269243 | 3300020411 | Marine | KKKKTYWDGYKQYTLKDGTKFYARDDHDANLYRKKVGE |
| Ga0211644_100487642 | 3300020416 | Marine | MAKKKTTYWEGYKIYTLSDGTKFYARDDSDAKLYREKVGDKS |
| Ga0211528_103550964 | 3300020417 | Marine | TYWEGYKIYTLSDGTKFYARDDSDAKLYREKVGDKS |
| Ga0211702_101776644 | 3300020422 | Marine | MSKKKKTYWEGYKKYTLSDGTKFYARDDSDAKLYREKVGDKS |
| Ga0211521_102199035 | 3300020428 | Marine | MSKKTKTYWEGYKKYTLSDGTKFYARDDSDAKLYREKVGDKS |
| Ga0211521_102787421 | 3300020428 | Marine | MAKKKKTYWDGYKQYTLKDGSKFYARDDNDAKLYREKVGE |
| Ga0211708_102946902 | 3300020436 | Marine | MAKKKNKTYWDGYKQYTLKDGTKFYARDDHDAKLYREKVGE |
| Ga0211708_103848922 | 3300020436 | Marine | MSKKKKTYWEGYKKYTLSDGTKFYARNDSDAKLYREKVGDKS |
| Ga0211576_1005536410 | 3300020438 | Marine | MSKKKTNKNWGGYKQYTLTDGTRFLARDDSDAKLYREKVGDKS |
| Ga0211576_101100274 | 3300020438 | Marine | MSKKKTNELWGGYKQYTLTDGTKFLARDDHDAKLYREKVGDNTNV |
| Ga0211576_101205302 | 3300020438 | Marine | MSKKNKTYWKGYKQYTLKDGTKFYARDDSDAKLYREKVGE |
| Ga0211558_105454012 | 3300020439 | Marine | MPKKKSKEKFWGGYKQYTLEDGTKFLARDDNDAKLYRSKVEASN |
| Ga0211574_103745352 | 3300020446 | Marine | MAKKKTDKIWGGYKQYTLTDGTKFIARDDSDAKLYRKKVGDEK |
| Ga0211473_100150687 | 3300020451 | Marine | MSKKKKTYWDGYKKYTLKDGTKFYARDDHDAKLYREKVGE |
| Ga0211473_104571844 | 3300020451 | Marine | MSKKTKTYWKGYKKYTLSDGTKFYARDDSDAKLYREKVGDKS |
| Ga0211473_105671643 | 3300020451 | Marine | MSKKKKTYWEGYKKYTLSDGTKFYARDDSDAELYRQKVGDVK |
| Ga0211514_102307684 | 3300020459 | Marine | MAKKKTDKLWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDVK |
| Ga0211676_106108852 | 3300020463 | Marine | MSKKKTNKLWGGYKQYTLTDGTKFLARDDHDAKLYREKVGDNTNV |
| Ga0211714_101134281 | 3300020466 | Marine | MSKKKKTYWEGYKKYTLSDGTKFYARDDSDAKLYREKVGDVK |
| Ga0211543_1000760911 | 3300020470 | Marine | MSKKKNKEKFWGGYKQYTLEDGTKFLARDDKDAKLYREKVGV |
| Ga0211543_102933503 | 3300020470 | Marine | MSKKKTNKIWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDVKXGR |
| Ga0211543_103487562 | 3300020470 | Marine | MAKKKKTYWDGYKQYTLKDGTKFYARDDHDANLYRKKVGE |
| Ga0211614_102736682 | 3300020471 | Marine | MSKKKKTYWEGYKKYTLSDGTKFYARNDSDAKLYREKVGDKSXSL |
| Ga0211614_103874731 | 3300020471 | Marine | MSKKKTNKNWGGYKQYTLTDGTRFLARDDSDAELYRQKVGDMK |
| Ga0213858_100236145 | 3300021356 | Seawater | MSKKTKTYWKGYKTYTLTDGTKFYARDDNDAKLYREKVGDKS |
| Ga0222716_101505411 | 3300021959 | Estuarine Water | NLEITNMSKKKTNELWGGYKQYTLTDGTKFLARDDHDAKLYREKVGDNTNV |
| Ga0224906_10836884 | 3300022074 | Seawater | YMSKKKTNKNWGGYKQYTLTDGTRFLARDDSDAKLYREKVGDKS |
| Ga0255761_102680413 | 3300023170 | Salt Marsh | MSKKTKTYWEGYKIYTLSDGTKFYARDDSDAKLYREKVGDKSXNQL |
| (restricted) Ga0233438_101403072 | 3300024255 | Seawater | MSKKKTDKIWGDYKQYTLTDGTRFFARDDNDAKLYREKVGDNTNV |
| Ga0208667_10377443 | 3300025070 | Marine | MAKKKTDKLWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDKS |
| Ga0207890_10747331 | 3300025079 | Marine | MSKKKTDKIWGDYKQYTLTDGTRFLARDDNDAKLYREKVGDN |
| Ga0208157_10273525 | 3300025086 | Marine | MSKKKTNKNWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDKS |
| Ga0208011_10137378 | 3300025096 | Marine | MAKKKKKGHWGGYNQYTLKDGTKFLARDDHDADLYREKVGD |
| Ga0208666_11435822 | 3300025102 | Marine | MAKKKTDKLWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDKL |
| Ga0209348_10967704 | 3300025127 | Marine | MAKKKKSYWAGYKQYTLKDGSKFYARDDEDAKLYRLKVGDEK |
| Ga0208919_12338532 | 3300025128 | Marine | MSKKKTNKNWGGYKQYTLTDGTKFLARDDSDAKLYRQKVGDVK |
| Ga0209232_10567294 | 3300025132 | Marine | MSKKKKTYWDGYKQYTLKDGTKFYARDDYDADLYRKKVGE |
| Ga0209232_11114632 | 3300025132 | Marine | MSKKNKTYWDGYKQYTLKDGSKFYARDDEDAKLYRLKVGDEK |
| Ga0209232_12373103 | 3300025132 | Marine | NSGGYMSKKTKTYWEGYKIYTLSDGTKFYARDDSDAKLYREKVGDKS |
| Ga0209336_100539822 | 3300025137 | Marine | MSKKKTKGIWSGYKQYTLTDGTKFIARDDSDAELYRQKVGDVKXKILI |
| Ga0209634_10338371 | 3300025138 | Marine | TNSEKTKMAKKKIKSPWGGYTQYTLTDGTKFLARDDSDAKLYRQKVGDKS |
| Ga0209634_10440815 | 3300025138 | Marine | MAKKKTKGIWGGYNQYTLTDGTKFIARDDSDAELYRKKVGDVK |
| Ga0209634_11823144 | 3300025138 | Marine | MAKKKIKSPWGGYTQYTLTDGTKFLARDDSDAKLYRQKIGDKS |
| Ga0209756_10406716 | 3300025141 | Marine | MAKKKTNKIWGGYKRYTLTDGTRFIARDDSDAELYRQKVGDVK |
| Ga0209337_11760844 | 3300025168 | Marine | KIWGDYKQYTLTDGTRFLARDDNDAKLYREKVGDNTNV |
| Ga0208162_10157348 | 3300025674 | Aqueous | MSKKTKTYWKGYKTYTLTDGTKFYARDDNDAKLYREKVGDES |
| Ga0208162_11416955 | 3300025674 | Aqueous | GYMSKKTKTYWKGYKTYTLTDGTKFYARDDNDAKLYREKVGDKS |
| Ga0208899_12513702 | 3300025759 | Aqueous | MSKKNKTYWDGYKQYTLKDGTKFYARDDHDAKLYREKVGDE |
| Ga0209308_100331271 | 3300025869 | Pelagic Marine | NKNWGGYKQYTLTDGTRFLARDDSDAKLYREKVGDKS |
| Ga0209223_100937236 | 3300025876 | Pelagic Marine | MSKKKTKGIWGGYKQYTLTDGTKFIARDDSDAELYRQKVGDVK |
| Ga0208407_10430093 | 3300026257 | Marine | MSKKKTNKNWGGYKQYTLTDGTKFLARDDSDAELYRQKVGDVK |
| Ga0209711_101312712 | 3300027788 | Marine | MAKKKTKDIWGGYNQYTLTDGTKFIARDDSDAELYRKKVGDVK |
| Ga0257107_10749453 | 3300028192 | Marine | MSKKKTKSIWGDYNKYTLKDGTKFIARDDSDAELYRQKVGDVKXGLL |
| Ga0257106_12145441 | 3300028194 | Marine | KTKGIWGGYNQYTLTDGTKFIARDDSDAELYRQKVGDVK |
| Ga0185543_10411242 | 3300029318 | Marine | MSRKKKTYWDGYKQYTLKDGTKFYARDDHDAKLYRKKVGDE |
| Ga0185543_10608833 | 3300029318 | Marine | MAKKKKTYWDGYKQYTLKDGSKFYARDDSDAKLYRKKVGDE |
| Ga0183748_10645873 | 3300029319 | Marine | MAKKKKTYWDGYKQYTLKDGTKFYARDDEDAKLYRMKVGDEK |
| Ga0183755_10653892 | 3300029448 | Marine | MSKKKKTYWKGYKQYTLKDGSKFYARDDSDAELYRKKVGE |
| Ga0307488_108049532 | 3300031519 | Sackhole Brine | MAKKKTKGIWGGYNQYTLTDGTKFIARDDSDAELYRKKVGDVKXKILI |
| Ga0315331_104766422 | 3300031774 | Seawater | MSKKKKTYWNGYKQYTLKDGSKFYARDDHDADLYRKKVGE |
| Ga0315315_110518661 | 3300032073 | Seawater | MSKKKTNKNWGGYKQYTLTDGTRFLARDDSDAKLYRQKVGDKS |
| ⦗Top⦘ |