


| Basic Information | |
|---|---|
| Family ID | F042483 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 158 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDELAAKGA |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 158 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.73 % |
| % of genes from short scaffolds (< 2000 bps) | 84.81 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.367 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.886 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.278 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.165 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 158 Family Scaffolds |
|---|---|---|
| PF13654 | AAA_32 | 79.75 |
| PF03551 | PadR | 2.53 |
| PF00106 | adh_short | 0.63 |
| PF01594 | AI-2E_transport | 0.63 |
| PF13091 | PLDc_2 | 0.63 |
| PF14489 | QueF | 0.63 |
| PF05362 | Lon_C | 0.63 |
| PF04397 | LytTR | 0.63 |
| PF13646 | HEAT_2 | 0.63 |
| PF12704 | MacB_PCD | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 158 Family Scaffolds |
|---|---|---|---|
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 2.53 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.53 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.53 |
| COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.63 |
| COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
| COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 0.63 |
| COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.37 % |
| Unclassified | root | N/A | 0.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004080|Ga0062385_10935131 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300004082|Ga0062384_100150553 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300004091|Ga0062387_100267398 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300004633|Ga0066395_10399489 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300004635|Ga0062388_100194170 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300004635|Ga0062388_100741312 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300005178|Ga0066688_10509099 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300005340|Ga0070689_101699530 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005434|Ga0070709_10985078 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005548|Ga0070665_102595748 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005574|Ga0066694_10420819 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005610|Ga0070763_10862940 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300006174|Ga0075014_100607238 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300006176|Ga0070765_100579490 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300006354|Ga0075021_10813546 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300006358|Ga0068871_102359078 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300006755|Ga0079222_11362726 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
| 3300006797|Ga0066659_11496906 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006804|Ga0079221_10067107 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300006854|Ga0075425_101234734 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300006893|Ga0073928_10120544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2162 | Open in IMG/M |
| 3300007076|Ga0075435_100235220 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300007265|Ga0099794_10078912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1622 | Open in IMG/M |
| 3300009038|Ga0099829_10954299 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300009090|Ga0099827_11484352 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300009101|Ga0105247_11011894 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300009162|Ga0075423_10157563 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
| 3300009174|Ga0105241_11821627 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300009174|Ga0105241_12546860 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300009545|Ga0105237_10980788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300010043|Ga0126380_10492600 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300010043|Ga0126380_11192644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300010360|Ga0126372_11956423 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300010361|Ga0126378_10153719 | All Organisms → cellular organisms → Bacteria | 2345 | Open in IMG/M |
| 3300010361|Ga0126378_13068959 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300010362|Ga0126377_13346676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300010376|Ga0126381_100061394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4648 | Open in IMG/M |
| 3300010376|Ga0126381_104465334 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300011120|Ga0150983_15728617 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
| 3300011269|Ga0137392_10406487 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300012205|Ga0137362_11038061 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012205|Ga0137362_11589728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300012207|Ga0137381_10048714 | All Organisms → cellular organisms → Bacteria | 3493 | Open in IMG/M |
| 3300012356|Ga0137371_11328448 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012685|Ga0137397_10022629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4433 | Open in IMG/M |
| 3300012917|Ga0137395_10021000 | All Organisms → cellular organisms → Bacteria | 3798 | Open in IMG/M |
| 3300012923|Ga0137359_10038191 | All Organisms → cellular organisms → Bacteria | 4148 | Open in IMG/M |
| 3300012927|Ga0137416_11888643 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012944|Ga0137410_11592778 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012948|Ga0126375_10767164 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300012971|Ga0126369_10560828 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300012971|Ga0126369_12174266 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300012971|Ga0126369_12921188 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300014159|Ga0181530_10031409 | All Organisms → cellular organisms → Bacteria | 3776 | Open in IMG/M |
| 3300014166|Ga0134079_10286434 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300014501|Ga0182024_12348799 | Not Available | 579 | Open in IMG/M |
| 3300015054|Ga0137420_1205251 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300015082|Ga0167662_1043779 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300015374|Ga0132255_100148428 | All Organisms → cellular organisms → Bacteria | 3265 | Open in IMG/M |
| 3300016270|Ga0182036_10468849 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300016294|Ga0182041_10913159 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300016319|Ga0182033_10487905 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300016357|Ga0182032_10665622 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300017972|Ga0187781_11160065 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300018033|Ga0187867_10079345 | All Organisms → cellular organisms → Bacteria | 1930 | Open in IMG/M |
| 3300018034|Ga0187863_10842396 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300019361|Ga0173482_10451391 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300020170|Ga0179594_10308785 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300020579|Ga0210407_10595642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300020579|Ga0210407_10708126 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300020579|Ga0210407_10719807 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300020580|Ga0210403_11328734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300020581|Ga0210399_10044241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3570 | Open in IMG/M |
| 3300020583|Ga0210401_11254723 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300021168|Ga0210406_10977841 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300021170|Ga0210400_10515044 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300021180|Ga0210396_11491720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300021403|Ga0210397_11566650 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300021405|Ga0210387_10820119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300021405|Ga0210387_11054460 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300021406|Ga0210386_10750016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300021406|Ga0210386_11611243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300021407|Ga0210383_10140522 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
| 3300021407|Ga0210383_10489495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300021433|Ga0210391_10098174 | All Organisms → cellular organisms → Bacteria | 2309 | Open in IMG/M |
| 3300021474|Ga0210390_10035279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4085 | Open in IMG/M |
| 3300021474|Ga0210390_10708259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300021475|Ga0210392_10108281 | All Organisms → cellular organisms → Bacteria | 1841 | Open in IMG/M |
| 3300021477|Ga0210398_10885016 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300021479|Ga0210410_10009037 | All Organisms → cellular organisms → Bacteria | 8599 | Open in IMG/M |
| 3300021560|Ga0126371_10062199 | All Organisms → cellular organisms → Bacteria | 3605 | Open in IMG/M |
| 3300024249|Ga0247676_1007923 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300024288|Ga0179589_10332026 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300025439|Ga0208323_1049282 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300025911|Ga0207654_11332979 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300025915|Ga0207693_10815792 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300026078|Ga0207702_11204119 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300026215|Ga0209849_1015055 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300026320|Ga0209131_1320209 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300026482|Ga0257172_1087012 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300026551|Ga0209648_10294931 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300026557|Ga0179587_10285234 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300026557|Ga0179587_10434959 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300026557|Ga0179587_10473649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
| 3300026557|Ga0179587_10873532 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300026557|Ga0179587_10916829 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300027035|Ga0207776_1022331 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300027071|Ga0209214_1002918 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300027629|Ga0209422_1063040 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300027671|Ga0209588_1204161 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300027725|Ga0209178_1392860 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300027775|Ga0209177_10172693 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300027812|Ga0209656_10107891 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300027812|Ga0209656_10187876 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300027842|Ga0209580_10595066 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300027846|Ga0209180_10242717 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300027874|Ga0209465_10332663 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300027908|Ga0209006_10975281 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300028536|Ga0137415_10040472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4558 | Open in IMG/M |
| 3300028536|Ga0137415_10080540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3116 | Open in IMG/M |
| 3300028746|Ga0302233_10034070 | All Organisms → cellular organisms → Bacteria | 2152 | Open in IMG/M |
| 3300028789|Ga0302232_10492141 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300028906|Ga0308309_10676121 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300029636|Ga0222749_10154272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
| 3300031057|Ga0170834_112256373 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1062242 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300031446|Ga0170820_12816346 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031469|Ga0170819_15725543 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300031546|Ga0318538_10391305 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300031564|Ga0318573_10595287 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300031679|Ga0318561_10430101 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300031708|Ga0310686_117896322 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300031718|Ga0307474_10943940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300031719|Ga0306917_11023509 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300031740|Ga0307468_102382278 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031744|Ga0306918_10835216 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300031753|Ga0307477_10345546 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300031754|Ga0307475_10180507 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300031754|Ga0307475_10387803 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300031754|Ga0307475_11184025 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300031768|Ga0318509_10442852 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300031799|Ga0318565_10110565 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300031820|Ga0307473_10191597 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300031820|Ga0307473_10386804 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300031890|Ga0306925_10090858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3242 | Open in IMG/M |
| 3300031910|Ga0306923_10148464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2675 | Open in IMG/M |
| 3300031910|Ga0306923_11002247 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300031910|Ga0306923_12262624 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031962|Ga0307479_11831504 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300032001|Ga0306922_10031222 | All Organisms → cellular organisms → Bacteria | 5419 | Open in IMG/M |
| 3300032009|Ga0318563_10711633 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300032025|Ga0318507_10157016 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300032059|Ga0318533_10321617 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300032180|Ga0307471_101692851 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300032180|Ga0307471_102159342 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300032205|Ga0307472_100066957 | All Organisms → cellular organisms → Bacteria | 2324 | Open in IMG/M |
| 3300032782|Ga0335082_10831548 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300032955|Ga0335076_10159158 | All Organisms → cellular organisms → Bacteria | 2171 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.89% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.27% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.27% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.27% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.27% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.63% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.63% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.63% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.63% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.63% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.63% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015082 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062385_109351311 | 3300004080 | Bog Forest Soil | GLEVFGLLGLVAGPTIVAAAMGVFRVYQDRRDEMTAQEL* |
| Ga0062384_1001505531 | 3300004082 | Bog Forest Soil | FIGVLGGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDELAARAS* |
| Ga0062387_1002673981 | 3300004091 | Bog Forest Soil | GGLEVFGLLGLVAGPTILAAALGVFRVYTEHRDEIEREAA* |
| Ga0066395_103994891 | 3300004633 | Tropical Forest Soil | GGIKIFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEVASA* |
| Ga0062388_1001941701 | 3300004635 | Bog Forest Soil | GVLGGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDELAATEP* |
| Ga0062388_1007413121 | 3300004635 | Bog Forest Soil | GLEVFGLLGLVAGPTIVAAAMGVFRVYQDRRDEMTAQES* |
| Ga0066688_105090991 | 3300005178 | Soil | LLFVSVLGGIEVFGLLGLVAGPTIVAAAMGVFRVYMQHRDDLETARV* |
| Ga0070689_1016995302 | 3300005340 | Switchgrass Rhizosphere | VLGGIKVFGLLGIVAGPTIVAAAMGVFRVYMDHRDRVEASQA* |
| Ga0070709_109850781 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VLGGLEVFGLLGLVAGPTIIAAAMAVFRVYMDHRDQVAARET* |
| Ga0070665_1025957482 | 3300005548 | Switchgrass Rhizosphere | FGLLGIVAGPTIVAAAMGVFRVYMDHRDRVEASQA* |
| Ga0066694_104208192 | 3300005574 | Soil | GIEVFGLLGLVAGPTILAAAMGVFRVYMQHRDELEAAQV* |
| Ga0070763_108629402 | 3300005610 | Soil | QVFGLLGLVAGPTIVAAALGVFRVYMQHRDELEGANA* |
| Ga0075014_1006072381 | 3300006174 | Watersheds | SILGGLDVFGLLGLILGPTIVAAALGVLRVHMEHQEELQREQA* |
| Ga0070765_1005794903 | 3300006176 | Soil | GGLEVFGLLGLVAGPTIVAAAMGVFRVYMDRRDAMETREA* |
| Ga0075021_108135462 | 3300006354 | Watersheds | LGLVAGPTIVAAAMGVFRVYMDHRDEIAASSAAKTG* |
| Ga0068871_1023590782 | 3300006358 | Miscanthus Rhizosphere | GLDAFGLLGLVVGPTIVAAALGVFRVYMEHRERLERATA* |
| Ga0079222_113627262 | 3300006755 | Agricultural Soil | VSVLGGLHLFGLLGLVIGPTIIAAALAVYRVYMERRDQLQDLAA* |
| Ga0066659_114969061 | 3300006797 | Soil | VFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEAQA* |
| Ga0079221_100671072 | 3300006804 | Agricultural Soil | QVFGLLGLVIGPTIIAAALAVYRVYMERRDQLEDSAA* |
| Ga0075425_1012347342 | 3300006854 | Populus Rhizosphere | FISVLGGIEVFGLLGLVAGPTILAAAMGVFRVYMEHRDKVEAAQA* |
| Ga0073928_101205445 | 3300006893 | Iron-Sulfur Acid Spring | EVFGLLGLVAGPTIIAAAMGIFRVYMDRRDAMVAPEA* |
| Ga0075435_1002352202 | 3300007076 | Populus Rhizosphere | FVSVLGGIEVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEAQA* |
| Ga0099794_100789121 | 3300007265 | Vadose Zone Soil | GLLGLVIGPTIVAAAMGVFRVYVEHRDGMPAAVA* |
| Ga0099829_109542992 | 3300009038 | Vadose Zone Soil | LGGLQTFGLLGLVIGPTIVAAAMGVFRVYAEHRDRQAALPA* |
| Ga0099827_114843522 | 3300009090 | Vadose Zone Soil | GGISLFGLLGLVAGPAIIAAAMGIFRVYMEHREPQAATSA* |
| Ga0105247_110118941 | 3300009101 | Switchgrass Rhizosphere | LLFISVLGGIEVFGLLGLVAGPTILAAAMGVFRVYMDHRDRVEAAQA* |
| Ga0075423_101575631 | 3300009162 | Populus Rhizosphere | IEVFGLLGLVAGPTILAAAMGVFRVYMDHRDKVEAAQA* |
| Ga0105241_118216272 | 3300009174 | Corn Rhizosphere | FISVLGGIEVFGLLGLVAGPTILAAAMGVFRVYMDHRDRVEAAQA* |
| Ga0105241_125468601 | 3300009174 | Corn Rhizosphere | IEVFGLLGIVAGPTVVAAAMGVFRVYMDHRDRAEASQA* |
| Ga0105237_109807882 | 3300009545 | Corn Rhizosphere | GLLGLVAGPTIVAAAMGVFRVYMDRRDAVTTQEA* |
| Ga0126380_104926001 | 3300010043 | Tropical Forest Soil | IEVFGLLGLVAGPTVLAAAMGVFRVYMEHRDRIEQARA* |
| Ga0126380_111926442 | 3300010043 | Tropical Forest Soil | FISVLGGLEVFGLLGLVAGPTIVAAAMGIFRVYMDHRDEIAASEPVKSG* |
| Ga0126372_119564232 | 3300010360 | Tropical Forest Soil | GGIEVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEGAGA* |
| Ga0126378_101537191 | 3300010361 | Tropical Forest Soil | VFGLLGIVAGPTIVAAAMGVFRVYMDHRDRMVEASQA* |
| Ga0126378_130689591 | 3300010361 | Tropical Forest Soil | GIEVFGLLGLVAGPTVVAAAMGVFRVYMEHRDRLEESSA* |
| Ga0126377_133466762 | 3300010362 | Tropical Forest Soil | FIGVLGGLEVFGLLGLVAGPTIIAAAMAVFRVYMDHRDQIARREA* |
| Ga0126381_1000613941 | 3300010376 | Tropical Forest Soil | GIAVFGLLGLVAGPTILAAAMGVFRIYMEHRDQMEASQA* |
| Ga0126381_1044653341 | 3300010376 | Tropical Forest Soil | FGLLGLVAGPTIVAAAMGIFRVYTEHRDRLEEIRA* |
| Ga0150983_157286172 | 3300011120 | Forest Soil | AFGLLGLVAGPTIVAAAMGVFRVYMEHRDELATKGA* |
| Ga0137392_104064872 | 3300011269 | Vadose Zone Soil | LGGIEVFGLLGLVAGPTILAAAMGIFRVYTHHREHLEAVRA* |
| Ga0137362_110380612 | 3300012205 | Vadose Zone Soil | FGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEAQA* |
| Ga0137362_115897282 | 3300012205 | Vadose Zone Soil | GLQAFGLLGLVAGPTIVAAAMGVFRVYMEHRDEMSAKGA* |
| Ga0137381_100487143 | 3300012207 | Vadose Zone Soil | LFVSVLGGISLFGLLGLVAGPAIVAAAMGIFRVYMEHREPQAATSA* |
| Ga0137371_113284482 | 3300012356 | Vadose Zone Soil | EVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEVRA* |
| Ga0137397_100226294 | 3300012685 | Vadose Zone Soil | NELLLFISVLGGIEVFGLLGLVAGPTIVAAAMGVFRVYMQHRDELEAAQL* |
| Ga0137395_100210004 | 3300012917 | Vadose Zone Soil | VFGLMGIVAGPTIMAAAMGVFRVYMEHRDELEEARA* |
| Ga0137359_100381914 | 3300012923 | Vadose Zone Soil | GGLEVFGLLGLVIGPTILAAAMGVFRVYVEHRDRVAATVT* |
| Ga0137416_118886431 | 3300012927 | Vadose Zone Soil | GLEVFGLLGLVIGPPILAAAMGVFRVYVEHRDRVAATAT* |
| Ga0137410_115927782 | 3300012944 | Vadose Zone Soil | GGLQTFGLLGLVIGPTIVAAAMGVFRVYAEHRDRQAALAA* |
| Ga0126375_107671642 | 3300012948 | Tropical Forest Soil | ISVVGGIAVFGLLGLVAGPTILAAAMGVFRIYMEHRDQMEASQA* |
| Ga0126369_105608281 | 3300012971 | Tropical Forest Soil | GIQVFGLLGLVAGPTILAAAMGVFRIYMEHRDQMEASQA* |
| Ga0126369_121742662 | 3300012971 | Tropical Forest Soil | FISVLGGIQVFGLLGLVAGPTILAAAMGVFRIYMEHRDQIEATEA* |
| Ga0126369_129211882 | 3300012971 | Tropical Forest Soil | GGIQVFGLLGLVAGPTIVAAAMGVFRVYMEHRDQVEASQA* |
| Ga0181530_100314091 | 3300014159 | Bog | SILGGLDVFGLLGLVAGPTIMAAALGVFRVYMVHREKMEKELRN* |
| Ga0134079_102864342 | 3300014166 | Grasslands Soil | EVFGLLGLVAGPTIVAAAMGVFRVYMQHRDDLETARV* |
| Ga0182024_123487992 | 3300014501 | Permafrost | LEVFGLLGLVAGPTIVAAAMGIFRVYMDRRDAMTAQES* |
| Ga0137420_12052511 | 3300015054 | Vadose Zone Soil | FGLLGLVIGPTIVAAAMGVFRVYMDHRDREAALPA* |
| Ga0167662_10437792 | 3300015082 | Glacier Forefield Soil | SVLGGIEVFGLLGLVAGPTILAAAMGVFRVYTQHRDELEAASG* |
| Ga0132255_1001484283 | 3300015374 | Arabidopsis Rhizosphere | LLLFISVLGGIQVFGLLGLVAGPTILAAAMGVFRVYMDHRDKVEAAQG* |
| Ga0182036_104688491 | 3300016270 | Soil | LNDLLLFISILGGLDAFGLLGLVVGPTIVAAALGVFRVYMEHRERLEQATA |
| Ga0182041_109131592 | 3300016294 | Soil | QVFGLLGLVVGPTIVAAALGVFRVYTEHREELEGVNV |
| Ga0182033_104879051 | 3300016319 | Soil | GGLQVFGLLGLVIGPTVVAAALGVFRVYMESRERLETEQA |
| Ga0182032_106656221 | 3300016357 | Soil | GGIEVFGLLGLVAGPTIVAAAMGIFRVYMEHRDRLGEIGA |
| Ga0187781_111600651 | 3300017972 | Tropical Peatland | GGLGAFGLLGLVAGPTILAAALAVFRVHMEHRDRLEKESA |
| Ga0187867_100793452 | 3300018033 | Peatland | LFISILGGLDVFGLLGLVAGPTIMAAALGVFRVYMVHREKMEKELRN |
| Ga0187863_108423961 | 3300018034 | Peatland | EMFGLLGLVAGPTIVAAALGVFRVYMANRDELASGPKVGG |
| Ga0173482_104513912 | 3300019361 | Soil | VLGGIEVFGLLGIVAGPTVVAAAMGVFRVYMDRRDRAETSQA |
| Ga0179594_103087851 | 3300020170 | Vadose Zone Soil | GLEVFGLLGLVAGPTIVAAAMGVFRVYMDRRDAMTMPEA |
| Ga0210407_105956421 | 3300020579 | Soil | LFIGVLGGLEVFGLLGIVAGPTIVAAAMGVFRVYMDRRDAMVTPEA |
| Ga0210407_107081262 | 3300020579 | Soil | ELLLFISVLGGLEVFGLLGLVAGPTIVAAAMGVFRVYMDHRDEIAAKEA |
| Ga0210407_107198071 | 3300020579 | Soil | FISILGGLQVFGLLGLVAGPTIVAAALGVFRVYMEHRDELDGADA |
| Ga0210403_113287341 | 3300020580 | Soil | FIGVLGGLEVFGLLGLVAGPTIVAAAMGIFRVYMDRRDAMATAQA |
| Ga0210399_100442413 | 3300020581 | Soil | ILGGLQVFGLLGLVAGPTIIAAALGVFRVYMEHRDELDGAKA |
| Ga0210401_112547232 | 3300020583 | Soil | FISILGGLEVFGLLGLVAGPIIVAAALGVFRVYMEHRDELDGADA |
| Ga0210406_109778411 | 3300021168 | Soil | GGLEVFGLLGLVIGPTILAAAMGVFRVYVEHRDRQAALSA |
| Ga0210400_105150441 | 3300021170 | Soil | DFGLLGLVAGPTIVAAALGVFRVYMEHRDELDAANA |
| Ga0210396_114917202 | 3300021180 | Soil | LGGLEVFGLLGLVAGPTIVAAAMGVFRVYMDRRDAMAAPAA |
| Ga0210397_115666502 | 3300021403 | Soil | NDLLLFISILGGLDVFGLLGLVAGPTIVAAALGVFQVYMNSRDETERKREPVEGKA |
| Ga0210387_108201191 | 3300021405 | Soil | IGVLGGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDELAAKDA |
| Ga0210387_110544602 | 3300021405 | Soil | LGGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDGLASKNA |
| Ga0210386_107500162 | 3300021406 | Soil | VLGGLEVFGLLGLVAGPTIVAAAMGVFRVYMDRRDAMETREA |
| Ga0210386_116112432 | 3300021406 | Soil | GLEVFGLLGLVAGPTIVAAAMGVFRVYMDRRDAMETREA |
| Ga0210383_101405222 | 3300021407 | Soil | LGGLEVFGLLGLVAGPTILAAALGVFRVYTEHRDEIEREAA |
| Ga0210383_104894953 | 3300021407 | Soil | NELLLFIGVLGGLEAFGLLGLVAGPTIVAAAMGVFRVYMDRRDAVATQE |
| Ga0210391_100981741 | 3300021433 | Soil | VLGGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDALAAKGT |
| Ga0210390_100352794 | 3300021474 | Soil | LQVFGLLGLVAGPTIIAAALGVFRVYMEHRDELDGAKA |
| Ga0210390_107082591 | 3300021474 | Soil | VLGGLEVFGLLGLVAGPTIIAAAMGIFRVYMERRDAMVAPDA |
| Ga0210392_101082812 | 3300021475 | Soil | NDLLLFIGVIGGLEVFGLVGLVAGPTIVAAAVGVFRVHMERREGLAAPPA |
| Ga0210398_108850162 | 3300021477 | Soil | GGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDELAAKGA |
| Ga0210410_100090371 | 3300021479 | Soil | ISILGGLQVFGLLGLVAGPTIIAAALGVFRVYMEHRDELDGAKA |
| Ga0126371_100621993 | 3300021560 | Tropical Forest Soil | LLLFISILGGLDAFGLLGLVVGPTVVAAALGVFRVYMERREQQAVVENQVA |
| Ga0247676_10079232 | 3300024249 | Soil | RGLQVFGLLGLVAGPTIVAAALGVFRVYTEHRGELEESNA |
| Ga0179589_103320261 | 3300024288 | Vadose Zone Soil | SILGGLQVFGLLGLVAGPTIVAAALGVFRVYTQHRDERDEANA |
| Ga0208323_10492821 | 3300025439 | Peatland | DLLLFISILGGLEAFGLLGLVAGPTILAAAMGVFRVYMEHREQMEKEAA |
| Ga0207654_113329791 | 3300025911 | Corn Rhizosphere | SVLGGIEVFGLLGLVAGPTILAAAMGVFRVYMDHRDRVEAAQA |
| Ga0207693_108157922 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | IEVFGLLGLVAGPTILAAAMGIFRVYTQHRDNLEAARA |
| Ga0207702_112041191 | 3300026078 | Corn Rhizosphere | ELLLFIGVLGGLEVFGLLGLVAGPTIIAAAMAVFRVYMEHRDRIAREA |
| Ga0209849_10150551 | 3300026215 | Soil | FGLLGLVVGPAIVAAAMGVFRVHMLHREDVAAARMSPGASI |
| Ga0209131_13202091 | 3300026320 | Grasslands Soil | GGLQVFGLLGLVAGPTIVAAALGVFRVYTEHRDELDGAGA |
| Ga0257172_10870121 | 3300026482 | Soil | FISVLGGIEVFGLLGLVAGPTIVAAAMGVFRVYMERRDELAPTSA |
| Ga0209648_102949311 | 3300026551 | Grasslands Soil | LFISILGGLQVFGLLGLVAGPTIVAAALGVFRVYTEHRDELDGAGA |
| Ga0179587_102852341 | 3300026557 | Vadose Zone Soil | NELLLFIGVLGGLEVFGLLGLVAGPTIVAAAMGVFRVYMDRRDAMTMPEA |
| Ga0179587_104349592 | 3300026557 | Vadose Zone Soil | QVFGLLGLVAGPTIVAAALGVFQVYMEHRDELEGAKA |
| Ga0179587_104736491 | 3300026557 | Vadose Zone Soil | GGIEVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEVGA |
| Ga0179587_108735321 | 3300026557 | Vadose Zone Soil | GVIGGLEAFGLLGLVAGPTIVAAAMGVFRVYMDRNEGRTSRAAPA |
| Ga0179587_109168292 | 3300026557 | Vadose Zone Soil | LGGIEVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEVRA |
| Ga0207776_10223312 | 3300027035 | Tropical Forest Soil | FGLLGLVIGPTVVAAALGVFRVYMESRERLETEQA |
| Ga0209214_10029182 | 3300027071 | Forest Soil | LKVFGLLGLVIGPTVVAAALGVFRVYMESRERQETEQA |
| Ga0209422_10630402 | 3300027629 | Forest Soil | QVFGLLGLVAGPTIVAAALGVFRVYMEHRDELDVANV |
| Ga0209588_12041611 | 3300027671 | Vadose Zone Soil | VFGLLGLVAGPTIVAAALGVFRVYTEHRDELDGADA |
| Ga0209178_13928602 | 3300027725 | Agricultural Soil | FGLLGLVIGPTIVAAAMGVFRVYVDHRDRQAAVAA |
| Ga0209177_101726932 | 3300027775 | Agricultural Soil | VLGGLQVFGLLGLVIGPTIIAAALAVYRVYMERRDQLEDSAA |
| Ga0209656_101078912 | 3300027812 | Bog Forest Soil | VFGLLGLVAGPTILAAALGVFRVYMQHREKLEARERLLELKA |
| Ga0209656_101878761 | 3300027812 | Bog Forest Soil | EVFGLLGLVAGPTILAAAMGVFRVYMDRRDEMLASGP |
| Ga0209580_105950662 | 3300027842 | Surface Soil | VLGGLGAFGLLGLVAGPTIIAAAMGVFRVYMDHRDALVIRKA |
| Ga0209180_102427171 | 3300027846 | Vadose Zone Soil | NELLLFISVVGGIEVFGLLGLVAGPTIVAAAMGVFRVYMEHRDELASTSAVPTI |
| Ga0209465_103326631 | 3300027874 | Tropical Forest Soil | TFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEVASA |
| Ga0209006_109752811 | 3300027908 | Forest Soil | LGGLQVFGLLGLVAGPIIVAAALGVFRVYMEHRDELDGANA |
| Ga0137415_100404724 | 3300028536 | Vadose Zone Soil | LFLGVLGGLEVFGLLGLVIGPTILAAAMGVFRVYVEHRDTQAALPT |
| Ga0137415_100805403 | 3300028536 | Vadose Zone Soil | LFLGVLGGLEVFGLLGLVIGPTILAAAMGVFRVYVEHRDRVAATVT |
| Ga0302233_100340702 | 3300028746 | Palsa | GGIEVFGLLGLVAGPTILAAAMGVFRVYMDRRDELLAAAPDDP |
| Ga0302232_104921412 | 3300028789 | Palsa | GIEVFGLLGLVAGPTILAAAMGVFRVYMDRRDELLAAAPDDP |
| Ga0308309_106761211 | 3300028906 | Soil | EVFGLVGLVAGPTIVAAAVGVFRVHMERREGLAAPPA |
| Ga0222749_101542723 | 3300029636 | Soil | GVLGGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDELAGKGA |
| Ga0170834_1122563731 | 3300031057 | Forest Soil | VFGLLGLVAGPTIVAAAMGVFRVYMQHRDELEAAQS |
| (restricted) Ga0255311_10622421 | 3300031150 | Sandy Soil | LLFISILGGLQAFGLLGLVVGPTVVAAALGVFRVYMEHREAVEEGAA |
| Ga0170820_128163462 | 3300031446 | Forest Soil | FISVLGGIEVFGLLGLVAGPTIVAAAMGVFRVYMQHRDEIENARV |
| Ga0170819_157255431 | 3300031469 | Forest Soil | LLFISILGGLDAFGLLGLVAGPTIVAAALAVFRVYMERRERLERATA |
| Ga0318538_103913051 | 3300031546 | Soil | FISVLGGIQVFGLLGLVAGPTIVAGAMAIFRVYMERRDRLEETGA |
| Ga0318573_105952872 | 3300031564 | Soil | FGLLGLVIGPTVVAAALGVFRVYMESRERLGTEQA |
| Ga0318561_104301011 | 3300031679 | Soil | LGGLQVFGLLGLVIGPTVVAAALGVFRVYMESRERLETEQA |
| Ga0310686_1178963222 | 3300031708 | Soil | GVLGGLEAFGLLGLVAGPTIVAAAMGVFRVYMEHRDELAAKEA |
| Ga0307474_109439402 | 3300031718 | Hardwood Forest Soil | GGLEVFGLLGLVAGPTIVAAAMGVFRVYMDRRDAVATQEA |
| Ga0306917_110235091 | 3300031719 | Soil | LSILGGLQVFGLLGLVIGPTVVAAALGVFRVYMESRERLGTEQA |
| Ga0307468_1023822782 | 3300031740 | Hardwood Forest Soil | AFGLLGLVAGPTIVAAALAVFRVYMERRERLERATA |
| Ga0306918_108352162 | 3300031744 | Soil | ISVLGGIQVFGLLGLVAGPTIVAGAMAIFRVYMERRDRLEETGA |
| Ga0307477_103455461 | 3300031753 | Hardwood Forest Soil | QVFGLLGLVIGPTIVAAAMGVFRVYVEHRDREAALPT |
| Ga0307475_101805071 | 3300031754 | Hardwood Forest Soil | VFGLLGLVAGPTIVAAAMGVFRVYMERRDELAAPG |
| Ga0307475_103878032 | 3300031754 | Hardwood Forest Soil | GVLGGLEVFGLLGLVIGPAILAAAMGVFRVYAGHRDRQAALPA |
| Ga0307475_111840251 | 3300031754 | Hardwood Forest Soil | FGLLGLVIGPTIVAAAMGVFRVYVEHRDTEAALPT |
| Ga0318509_104428521 | 3300031768 | Soil | IQVFGLLGLVAGPTIVAAGMGIFRVYMEHRDRLEEIGG |
| Ga0318565_101105651 | 3300031799 | Soil | LGGLQVFGLLGLVIGPTVVAAALGVFRVYMESRERLGTEQA |
| Ga0307473_101915973 | 3300031820 | Hardwood Forest Soil | GGIEVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEAEA |
| Ga0307473_103868041 | 3300031820 | Hardwood Forest Soil | FGLLGLVAGPTIVAAALGVFRVYMEHRDELDAAKA |
| Ga0306925_100908583 | 3300031890 | Soil | ISVLGGIAFFGLLGLVAGPTILAAAMGVFRIYMEHRDQMEASQA |
| Ga0306923_101484641 | 3300031910 | Soil | SVLGGIQVFGLLGLVAGPTIVAAGMGIFRVYMEHRDRLEEIGG |
| Ga0306923_110022472 | 3300031910 | Soil | GIEVFGLLGLVAGPTIVAAAMGIFRVYMEHRDRLGEIGA |
| Ga0306923_122626242 | 3300031910 | Soil | LGGLGAFGLLGLVAGPTITAAALAVFRVYMERRERLERATA |
| Ga0307479_118315041 | 3300031962 | Hardwood Forest Soil | FISVLGGIEVFGLLGLVAGPTIVAAAMGVFRVYMLHRDELEAAQS |
| Ga0306922_100312225 | 3300032001 | Soil | FGLLGLVAGPTVLAAALGVLRVHMEHREQLERGTA |
| Ga0318563_107116331 | 3300032009 | Soil | LFISVLGGIAFFGLLGLVAGPTILAAAMGVFRIYMEHRDQMEASQA |
| Ga0318507_101570162 | 3300032025 | Soil | QVFGLLGLVIGPTVVAAALGVFRVYMESRERLGTEQA |
| Ga0318533_103216172 | 3300032059 | Soil | FGLLGLVIGPTVVAAALGVFRVYMESRERLGTEPA |
| Ga0307471_1016928512 | 3300032180 | Hardwood Forest Soil | SVLGGIEVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEAEA |
| Ga0307471_1021593421 | 3300032180 | Hardwood Forest Soil | LLFISVLGGIEVFGLLGIVAGPTIMAAAMGVFRVYMEHRDELEEAKV |
| Ga0307472_1000669572 | 3300032205 | Hardwood Forest Soil | ILGGLNAFGLLGLVAGPTIVAAALAVFRVYMERRERLERATA |
| Ga0335082_108315482 | 3300032782 | Soil | LLFLSILGGLDVFGLLGLVAGPIIVAAGLGVFRVYTQRMDEVEAAES |
| Ga0335076_101591583 | 3300032955 | Soil | GVLGGLGAFGLLGLVMGPTVIAAAMGVFRVYMDHRDALAARKA |
| ⦗Top⦘ |