


| Basic Information | |
|---|---|
| Family ID | F042304 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 158 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MTKLINAYRALPSPTNRAKLQKYLDKHMMAACMATPEEVAFLKAHEFKI |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 158 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 85.62 % |
| % of genes near scaffold ends (potentially truncated) | 14.56 % |
| % of genes from short scaffolds (< 2000 bps) | 59.49 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (49.367 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater (17.089 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.342 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (58.861 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.26% β-sheet: 0.00% Coil/Unstructured: 59.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 158 Family Scaffolds |
|---|---|---|
| PF03237 | Terminase_6N | 3.80 |
| PF13481 | AAA_25 | 1.90 |
| PF04606 | Ogr_Delta | 1.27 |
| PF00182 | Glyco_hydro_19 | 1.27 |
| PF10765 | Phage_P22_NinX | 1.27 |
| PF09374 | PG_binding_3 | 1.27 |
| PF11351 | GTA_holin_3TM | 1.27 |
| PF10263 | SprT-like | 1.27 |
| PF08774 | VRR_NUC | 1.27 |
| PF03592 | Terminase_2 | 1.27 |
| PF01555 | N6_N4_Mtase | 0.63 |
| PF05866 | RusA | 0.63 |
| PF16510 | P22_portal | 0.63 |
| PF10991 | DUF2815 | 0.63 |
| PF01832 | Glucosaminidase | 0.63 |
| PF08299 | Bac_DnaA_C | 0.63 |
| PF11195 | DUF2829 | 0.63 |
| PF05766 | NinG | 0.63 |
| PF13884 | Peptidase_S74 | 0.63 |
| PF11903 | ParD_like | 0.63 |
| PF10124 | Mu-like_gpT | 0.63 |
| PF07102 | YbcO | 0.63 |
| PF08291 | Peptidase_M15_3 | 0.63 |
| PF08241 | Methyltransf_11 | 0.63 |
| PF09588 | YqaJ | 0.63 |
| PF01464 | SLT | 0.63 |
| PF01844 | HNH | 0.63 |
| PF11651 | P22_CoatProtein | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 158 Family Scaffolds |
|---|---|---|---|
| COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 1.27 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 1.27 |
| COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 1.27 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.63 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.63 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.63 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.63 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.92 % |
| Unclassified | root | N/A | 36.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c009926 | Not Available | 1724 | Open in IMG/M |
| 3300000405|LV_Brine_h2_0102DRAFT_1003907 | Not Available | 3577 | Open in IMG/M |
| 3300000558|Draft_10045258 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1516 | Open in IMG/M |
| 3300001140|JGI12675J13321_100500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 970 | Open in IMG/M |
| 3300001605|Draft_10149240 | Not Available | 1513 | Open in IMG/M |
| 3300001605|Draft_10520671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300001851|RCM31_10226969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
| 3300002091|JGI24028J26656_1001315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5683 | Open in IMG/M |
| 3300002091|JGI24028J26656_1005828 | Not Available | 1818 | Open in IMG/M |
| 3300003277|JGI25908J49247_10013128 | All Organisms → Viruses → Predicted Viral | 2548 | Open in IMG/M |
| 3300003388|JGI25910J50241_10019072 | All Organisms → Viruses → Predicted Viral | 2418 | Open in IMG/M |
| 3300003787|Ga0007811_1000438 | Not Available | 6323 | Open in IMG/M |
| 3300004213|Ga0066648_10142611 | Not Available | 1336 | Open in IMG/M |
| 3300004481|Ga0069718_15200269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
| 3300004774|Ga0007794_10144626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300004774|Ga0007794_10195220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300005805|Ga0079957_1012406 | Not Available | 6337 | Open in IMG/M |
| 3300006030|Ga0075470_10009968 | Not Available | 2925 | Open in IMG/M |
| 3300006056|Ga0075163_10430694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1465 | Open in IMG/M |
| 3300006056|Ga0075163_11901588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300006100|Ga0007806_1073199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300006639|Ga0079301_1000051 | Not Available | 54386 | Open in IMG/M |
| 3300006641|Ga0075471_10043499 | Not Available | 2527 | Open in IMG/M |
| 3300006641|Ga0075471_10099270 | All Organisms → Viruses → Predicted Viral | 1564 | Open in IMG/M |
| 3300006802|Ga0070749_10350671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
| 3300006802|Ga0070749_10695239 | Not Available | 544 | Open in IMG/M |
| 3300006805|Ga0075464_11072717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
| 3300006875|Ga0075473_10036141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1901 | Open in IMG/M |
| 3300007344|Ga0070745_1081132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1289 | Open in IMG/M |
| 3300007516|Ga0105050_10009301 | Not Available | 11045 | Open in IMG/M |
| 3300007516|Ga0105050_10011408 | Not Available | 9500 | Open in IMG/M |
| 3300007516|Ga0105050_10060663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2667 | Open in IMG/M |
| 3300007516|Ga0105050_10180392 | All Organisms → Viruses → Predicted Viral | 1333 | Open in IMG/M |
| 3300007516|Ga0105050_10486002 | Not Available | 730 | Open in IMG/M |
| 3300007516|Ga0105050_10608878 | Not Available | 636 | Open in IMG/M |
| 3300007516|Ga0105050_10647787 | Not Available | 612 | Open in IMG/M |
| 3300007516|Ga0105050_10766551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
| 3300007516|Ga0105050_10892750 | Not Available | 502 | Open in IMG/M |
| 3300007519|Ga0105055_10052229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4390 | Open in IMG/M |
| 3300007519|Ga0105055_10555853 | Not Available | 939 | Open in IMG/M |
| 3300007519|Ga0105055_11079800 | Not Available | 573 | Open in IMG/M |
| 3300007519|Ga0105055_11120473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300007520|Ga0105054_10963797 | Not Available | 597 | Open in IMG/M |
| 3300007522|Ga0105053_10877406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300007523|Ga0105052_10283162 | Not Available | 1103 | Open in IMG/M |
| 3300007540|Ga0099847_1156450 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300007544|Ga0102861_1011137 | Not Available | 2150 | Open in IMG/M |
| 3300007960|Ga0099850_1353822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300007974|Ga0105747_1013915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2131 | Open in IMG/M |
| 3300008267|Ga0114364_1017363 | All Organisms → Viruses → Predicted Viral | 4099 | Open in IMG/M |
| 3300008448|Ga0114876_1083975 | All Organisms → Viruses → Predicted Viral | 1314 | Open in IMG/M |
| 3300009082|Ga0105099_10448619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300009151|Ga0114962_10003174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13424 | Open in IMG/M |
| 3300009151|Ga0114962_10036896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3310 | Open in IMG/M |
| 3300009151|Ga0114962_10188117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1215 | Open in IMG/M |
| 3300009152|Ga0114980_10114356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1610 | Open in IMG/M |
| 3300009154|Ga0114963_10001156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18222 | Open in IMG/M |
| 3300009154|Ga0114963_10134392 | Not Available | 1481 | Open in IMG/M |
| 3300009155|Ga0114968_10215063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1107 | Open in IMG/M |
| 3300009164|Ga0114975_10633889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300009169|Ga0105097_10056242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2123 | Open in IMG/M |
| 3300009419|Ga0114982_1281728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300009506|Ga0118657_11675965 | Not Available | 744 | Open in IMG/M |
| 3300010354|Ga0129333_10006359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11178 | Open in IMG/M |
| 3300010885|Ga0133913_10685570 | Not Available | 2682 | Open in IMG/M |
| 3300010885|Ga0133913_13150919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1092 | Open in IMG/M |
| 3300011335|Ga0153698_1960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10116 | Open in IMG/M |
| 3300011442|Ga0137437_1097175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1009 | Open in IMG/M |
| 3300012348|Ga0157140_10003320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1769 | Open in IMG/M |
| 3300012956|Ga0154020_10955685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300014811|Ga0119960_1030559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300015050|Ga0181338_1005903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2070 | Open in IMG/M |
| 3300016776|Ga0182046_1265638 | Not Available | 606 | Open in IMG/M |
| 3300017716|Ga0181350_1034969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1374 | Open in IMG/M |
| 3300017716|Ga0181350_1089031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300017722|Ga0181347_1063176 | Not Available | 1100 | Open in IMG/M |
| 3300017754|Ga0181344_1000108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34041 | Open in IMG/M |
| 3300017754|Ga0181344_1088779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 903 | Open in IMG/M |
| 3300017761|Ga0181356_1099792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
| 3300017777|Ga0181357_1274683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 579 | Open in IMG/M |
| 3300017780|Ga0181346_1087370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1222 | Open in IMG/M |
| 3300018083|Ga0184628_10036518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2461 | Open in IMG/M |
| 3300018410|Ga0181561_10556316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300018413|Ga0181560_10200259 | Not Available | 974 | Open in IMG/M |
| 3300018414|Ga0194135_10001519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13888 | Open in IMG/M |
| 3300018416|Ga0181553_10324972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
| 3300020160|Ga0211733_10187834 | Not Available | 33985 | Open in IMG/M |
| 3300020176|Ga0181556_1175184 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 849 | Open in IMG/M |
| 3300021961|Ga0222714_10000867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34378 | Open in IMG/M |
| 3300021963|Ga0222712_10015961 | Not Available | 6475 | Open in IMG/M |
| 3300022190|Ga0181354_1157744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300022407|Ga0181351_1009902 | All Organisms → Viruses → Predicted Viral | 3842 | Open in IMG/M |
| 3300022407|Ga0181351_1015017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3219 | Open in IMG/M |
| 3300022602|Ga0248169_136060 | All Organisms → cellular organisms → Bacteria | 2496 | Open in IMG/M |
| 3300023301|Ga0209414_1010351 | Not Available | 3449 | Open in IMG/M |
| 3300024545|Ga0256347_1025852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1408 | Open in IMG/M |
| 3300025379|Ga0208738_1000953 | Not Available | 6903 | Open in IMG/M |
| 3300025585|Ga0208546_1001290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7891 | Open in IMG/M |
| 3300025647|Ga0208160_1174584 | Not Available | 504 | Open in IMG/M |
| 3300025872|Ga0208783_10014387 | Not Available | 3991 | Open in IMG/M |
| 3300025872|Ga0208783_10068112 | All Organisms → Viruses → Predicted Viral | 1599 | Open in IMG/M |
| 3300025875|Ga0210040_10030041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5124 | Open in IMG/M |
| 3300025889|Ga0208644_1038282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2787 | Open in IMG/M |
| 3300025896|Ga0208916_10205738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
| 3300027205|Ga0208926_1004008 | Not Available | 2150 | Open in IMG/M |
| 3300027499|Ga0208788_1000452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20228 | Open in IMG/M |
| 3300027504|Ga0209114_1008815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1512 | Open in IMG/M |
| 3300027710|Ga0209599_10215935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300027721|Ga0209492_1013190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2782 | Open in IMG/M |
| 3300027741|Ga0209085_1000022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 104195 | Open in IMG/M |
| 3300027741|Ga0209085_1033868 | All Organisms → cellular organisms → Bacteria | 2411 | Open in IMG/M |
| 3300027749|Ga0209084_1015676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4279 | Open in IMG/M |
| 3300027754|Ga0209596_1107392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1306 | Open in IMG/M |
| 3300027763|Ga0209088_10000109 | Not Available | 59651 | Open in IMG/M |
| 3300027763|Ga0209088_10057608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1868 | Open in IMG/M |
| 3300027805|Ga0209229_10434999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300027832|Ga0209491_10018879 | All Organisms → Viruses | 7450 | Open in IMG/M |
| 3300027832|Ga0209491_10177346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1870 | Open in IMG/M |
| 3300027832|Ga0209491_10374771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1032 | Open in IMG/M |
| 3300027900|Ga0209253_10648495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 768 | Open in IMG/M |
| 3300027973|Ga0209298_10169769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
| 3300027976|Ga0209702_10002088 | All Organisms → cellular organisms → Bacteria | 35998 | Open in IMG/M |
| 3300027976|Ga0209702_10089008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1494 | Open in IMG/M |
| 3300027976|Ga0209702_10095941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1412 | Open in IMG/M |
| 3300027976|Ga0209702_10362886 | Not Available | 578 | Open in IMG/M |
| 3300027976|Ga0209702_10391373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300027983|Ga0209284_10039894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2646 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1169350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
| (restricted) 3300028581|Ga0247840_10214114 | Not Available | 1070 | Open in IMG/M |
| 3300031731|Ga0307405_10679438 | Not Available | 850 | Open in IMG/M |
| 3300031758|Ga0315907_11253983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300031857|Ga0315909_10027103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5633 | Open in IMG/M |
| 3300032092|Ga0315905_10003947 | Not Available | 15217 | Open in IMG/M |
| 3300032093|Ga0315902_10914637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300032435|Ga0335398_10490486 | Not Available | 906 | Open in IMG/M |
| 3300032435|Ga0335398_10901159 | Not Available | 517 | Open in IMG/M |
| 3300032782|Ga0335082_10895118 | Not Available | 750 | Open in IMG/M |
| 3300033981|Ga0334982_0496690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300033996|Ga0334979_0162286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1343 | Open in IMG/M |
| 3300034012|Ga0334986_0371119 | Not Available | 736 | Open in IMG/M |
| 3300034062|Ga0334995_0485277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
| 3300034073|Ga0310130_0031418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1634 | Open in IMG/M |
| 3300034102|Ga0335029_0626095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 598 | Open in IMG/M |
| 3300034106|Ga0335036_0161901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1583 | Open in IMG/M |
| 3300034106|Ga0335036_0406581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 17.09% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.03% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.13% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.49% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.16% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.16% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.16% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.53% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.90% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.90% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.27% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.27% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.27% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.27% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.27% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.27% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 1.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.27% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 1.27% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.63% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.63% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.63% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.63% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.63% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.63% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.63% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.63% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.63% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.63% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.63% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.63% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.63% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Contaminated → Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.63% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.63% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300001140 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 | Environmental | Open in IMG/M |
| 3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
| 3300004213 | Groundwater microbial communities from aquifer - Crystal Geyser CG19_WC_8/21/14_NA | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
| 3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
| 3300007519 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 | Environmental | Open in IMG/M |
| 3300007520 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly) | Environmental | Open in IMG/M |
| 3300007522 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 | Environmental | Open in IMG/M |
| 3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300016776 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018414 | Freshwater sediment microbial communities in response to fracking from North America - Little Laurel Run_MetaG_LLRF_2013 | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
| 3300022745 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17_Aug_MG | Environmental | Open in IMG/M |
| 3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
| 3300024275 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK15 | Environmental | Open in IMG/M |
| 3300024545 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025379 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025875 | Groundwater microbial communities from aquifer - Crystal Geyser CG19_WC_8/21/14_NA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027832 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027983 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes) | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032435 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 (spades assembly) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033002 | Soil microbial community from agricultural field in Dibrughar, Assam, India - D1 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_0099265 | 3300000176 | Freshwater | AQFRKLPSSSNRCKLQAYLNKHMMAVCMATQEEIAFLRINGFSI* |
| LV_Brine_h2_0102DRAFT_10039078 | 3300000405 | Hypersaline | MTKLINAYRKMPSPTNRGKLARYLNRHMMATCMATAEEMGFLRAHGFVE* |
| Draft_100452581 | 3300000558 | Hydrocarbon Resource Environments | MNKLIETFRKCPTPSNRAKLQTYLQKHMMALCLATPEEIAFLKAHEFKI* |
| JGI12675J13321_1005001 | 3300001140 | Forest Soil | MTKLINAYRKLPSATNRAKLQNYLNKHMMAICVATPDEIEFLKTHEFRM* |
| Draft_101492402 | 3300001605 | Hydrocarbon Resource Environments | VSKLIDTYRKCPTPSNRAKLQAYLKKHMMAVCMATPDEIAFLKAHEFTI* |
| Draft_105206712 | 3300001605 | Hydrocarbon Resource Environments | MSKLINSYRATPTMTNRAKLQKYLATHMMAVCMASPDEVAFLKANEFKI* |
| RCM31_102269692 | 3300001851 | Marine Plankton | MTTLLNKYRAAPTPANRAKLQAYLDKHMMAVCLATPDQIAFLKAHGFSI* |
| JGI24028J26656_10013152 | 3300002091 | Lentic | MRKLLNAYKTLPSPTNRAKLQTYLNKHMMAVCLATPEEIAFLKAHDFTI* |
| JGI24028J26656_10058282 | 3300002091 | Lentic | MQRFITAYRKLPSPSNRAKLQAYIIKHPMSVCLLTPEDTHFLRANNFTL* |
| JGI25908J49247_100131286 | 3300003277 | Freshwater Lake | MHRLINAYRKLPSPSNRTKLQSYLNKHMMAVCLATPEDIAFLKAHNFNI* |
| JGI25910J50241_100190723 | 3300003388 | Freshwater Lake | MHRLINAYRKLPSPSNRTXLQSYLNKHMMAVCLATPEDIAFLKAHNFNI* |
| Ga0007811_100043813 | 3300003787 | Freshwater | MSKLIATYRKVPSPTNRKKLEVYLVKHMMALCLAAPEEVEFLKAHQFI* |
| Ga0066648_101426111 | 3300004213 | Groundwater | MIRLIVAYRKLPSPTNRRKLQAHMDKHPMAVIIASPEDLDFLRKNEFKV* |
| Ga0069718_152002691 | 3300004481 | Sediment | MQKLLNAYRKLPSPTNRAKLQAYLNKHMMAVCLALPEDIAFLKAHNFSI* |
| Ga0007794_101446261 | 3300004774 | Freshwater | MRKLIETYRKVPSPSNRDRLQKYLNKHLMAACMATPEEIAFLKTHQFTI* |
| Ga0007794_101952202 | 3300004774 | Freshwater | MRKLLNAYKALPSPTNRAKLQTYLNKHMMAVCLATPEEVAFLRAHEFNI* |
| Ga0079957_101240612 | 3300005805 | Lake | VSKLIDNYRKCPTPSNRARLQAYLKKHMMAVCMATPDEIAFLKAHEFTI* |
| Ga0075470_100099687 | 3300006030 | Aqueous | MNKLIETFKKAPTPSNRVRLQAYLNKHMMAICLATPEQVTFLKTHGFSI* |
| Ga0075163_104306942 | 3300006056 | Wastewater Effluent | MTKLINAYRKMPSPTNRAKLQAYLDKHMMAICMATPEDVAFLKVNEFKI* |
| Ga0075163_119015881 | 3300006056 | Wastewater Effluent | MSRLIAAYRKLPSPTNRAKLQAYINKHMMAIALATPEEQAFLRAHEFRI* |
| Ga0007806_10731994 | 3300006100 | Freshwater | MQKLINAYRKLPSPSNRTKLQNYINKHMMAVCLLLPDDVAFLRSNNFNGV* |
| Ga0079301_100005121 | 3300006639 | Deep Subsurface | MNRLLNAFRNLPSPSNRKRLQAYLLKHPFSVCLATPEDIAFLKAHEFTI* |
| Ga0075471_100434998 | 3300006641 | Aqueous | MSKLIDTYRKCPTPSNRAKLQAYLKKHMMAVCMATPEEIAFLKAHEFTI* |
| Ga0075471_100992701 | 3300006641 | Aqueous | VRSREMNKLIETFKKAPTPSNRVRLQAYLNKHMMAICLATPEQVTFLKTHGFSI* |
| Ga0070749_103506712 | 3300006802 | Aqueous | MNGSDSAANKQENIMSKLINAYRALPSPSNRAKLQKYLEKHLMALCMATPEEVAFLKANGFKI* |
| Ga0070749_106952392 | 3300006802 | Aqueous | MQRLLNAYRKVPSPTNRAKLSAYLIKHPMSVCLAQPEDYQFLKTHQFI* |
| Ga0075464_110727172 | 3300006805 | Aqueous | MNKLINAYRKMPSPTNRAKLQAYLDKHMMSICMATPEDVAFLKAHEFKI* |
| Ga0075473_100361416 | 3300006875 | Aqueous | MSKLINAYRKLPTMANRDKLQKYLDKHQMAVCMATAEEIAFLRANEFQGV* |
| Ga0070745_10811324 | 3300007344 | Aqueous | MPQFSGQLVRSREMNKLIETFKKAPTPSNRVRLQAYLNKHMMAICLATPEQVTFLKTHGFSI* |
| Ga0105050_1000930111 | 3300007516 | Freshwater | MTKLLNTYRALPSPANRAKLQTYLSRHMMAVCLATPDEIAFLKANSFTI* |
| Ga0105050_1001140810 | 3300007516 | Freshwater | MTKLLNAYRSIPSPSNRTKLQNYLHKHMMAVILATPE |
| Ga0105050_100606636 | 3300007516 | Freshwater | MTKLINAYRKMPSPTNRGKLVRYLNRHMMAVCMATAEEMGFLRAHGFVE* |
| Ga0105050_101803924 | 3300007516 | Freshwater | MTKLIQAYRLLPTPANRSRLQAYMDKHSMAVCMACIEEIAFLRANEFKGA* |
| Ga0105050_104860023 | 3300007516 | Freshwater | VTKLINTYRKMPSPTNRGKLVRYLNEHMMATCMATAEEMDFL |
| Ga0105050_106088783 | 3300007516 | Freshwater | MSKLIKAYRLLPTPANRSRLQAYMDKHSMAVCMADIEEIAFLRANEFKGA* |
| Ga0105050_106477872 | 3300007516 | Freshwater | MTKLINAYRKMPSPTNRGKLVRYLNWHMMATCMATAEEMGFLRAHGFVK* |
| Ga0105050_107665512 | 3300007516 | Freshwater | VTKLINAYRKMPSLTNRGKLVRYLNRHMMATCMATAEEMGFLRAYGFVE* |
| Ga0105050_108927501 | 3300007516 | Freshwater | MTKLINAYRKMPSPTNRGKLARYLNEHMMATCMATAEEMDFLRAYGFVK* |
| Ga0105055_100522294 | 3300007519 | Freshwater | MTKLLNAYRSIPSPSNRTKLQNYLHKHMMAVILATPEEVAFLKANEFTI* |
| Ga0105055_105558533 | 3300007519 | Freshwater | VTKLINAYRKMPSPTNRGKLARYLNGHMMAVCMATAEEMGFLRAYGFVE* |
| Ga0105055_110798002 | 3300007519 | Freshwater | MTKLINAYRKMPCLTNRGKLVRYLNEHMMATCMATAEEMDFLRAYGFVK* |
| Ga0105055_111204733 | 3300007519 | Freshwater | VRKNERRYPVTKLINAYRKMPSPTNRGNLARYLNRHMMATCMATAEEMDFLRAYGFVK* |
| Ga0105054_109637972 | 3300007520 | Freshwater | VTKLINAYRKMPSLTNRGKLVRYLNEHMMATCMATAEEMD |
| Ga0105053_108774062 | 3300007522 | Freshwater | MTKLINAYRKVPSPTNRGNLARYLNRHMMATCMATAEEMDFLRAYGFVK* |
| Ga0105052_102831623 | 3300007523 | Freshwater | VTKLINAYRKMPSLTNRGKLVRYLNEHMMATCMATAEEMDFLRAYGFVK* |
| Ga0099847_11564501 | 3300007540 | Aqueous | MTKLIATYRKLPSPTNRAKLQAYLHKHMMAVVLASADEIAFLKANDFKL* |
| Ga0102861_10111373 | 3300007544 | Estuarine | MNKLINTYRKCPSPANREKLQRYINRHMMAICLASKDDIAFLKTHEFKI* |
| Ga0099850_13538221 | 3300007960 | Aqueous | FRKCPTPSNRAKLQTYLQKHMMALCLATPEEIAFLKAHEFKI* |
| Ga0105747_10139151 | 3300007974 | Estuary Water | MNKLINTYRKCPSPANLEKVQRYIKRHMMAICLASKDDIAFLKTHEFKI* |
| Ga0114355_11446122 | 3300008120 | Freshwater, Plankton | MKKLLETYRKVPTPANRDKLQKYLDKHMMAICMAMPEDVAFLKENQFRI* |
| Ga0114363_10602402 | 3300008266 | Freshwater, Plankton | MKKLLEAFRNVPTQANRDKLQKYLDKHMMAICMAMPEDVAFLKENQFRI* |
| Ga0114364_10173639 | 3300008267 | Freshwater, Plankton | MNKLIETYRKCQTPSNRAKLQTYLQKHMMALCLATPEEVAFLKANEFKI* |
| Ga0114876_10839753 | 3300008448 | Freshwater Lake | MKKLLESYKKLPSPSNRTKLQNYLNKHMMAICMASQEDIAFLKDNEFKI* |
| Ga0105099_104486191 | 3300009082 | Freshwater Sediment | DTFRAAPTPANRKRLQTYIAKHMMALCLATPDEIAFLKTNDFTL* |
| Ga0114962_1000317417 | 3300009151 | Freshwater Lake | MKRLLEAYRKLPSPTNRNRLQTYLNKHMMAVCLATPEEITFLKTHEFKI* |
| Ga0114962_100368966 | 3300009151 | Freshwater Lake | MTKLINTYRAVPTAANRAKLQKYLDKHMMAACMASPEEMAFLKANQFAI* |
| Ga0114962_101881172 | 3300009151 | Freshwater Lake | MTRLIVTYRKLPSPTNRAKLQTYLNRHMMAVCMASPEEVAFLRAHQFTV* |
| Ga0114980_101143562 | 3300009152 | Freshwater Lake | MSKLINAYRKLPSPTNRAKLQTYLNKHMMAVCGATLEEVAFLRANEFNI* |
| Ga0114963_1000115615 | 3300009154 | Freshwater Lake | MTKLINTYRAVPTAANRAKLQKYLDKHMMAVCMASPEEMAFLKANQFAI* |
| Ga0114963_101343923 | 3300009154 | Freshwater Lake | MTKLINAYRALPSPTNRAKLQKYLDKHMMAACMATPEEVAFLKAHEFKI* |
| Ga0114968_102150632 | 3300009155 | Freshwater Lake | MSRLIAAYRKLPSPANRRKLEAYLARHMFASCLATTEERAFLLAHKFEA* |
| Ga0114975_106338892 | 3300009164 | Freshwater Lake | MEIDMTKLINAYRALPTPSNRNKLQTYLNKHMMAACMATAEEIAFLRANEFSI* |
| Ga0105097_100562425 | 3300009169 | Freshwater Sediment | MTKLINLYRAMPSPTNRAKLQKYMDRHMMAICMASPDEVAFLKGNGFSI* |
| Ga0114982_12817282 | 3300009419 | Deep Subsurface | MQKLLNTYRKLPSPSNRAKLQAYLNKHMMAICLATPADQAFLKAHAFTL* |
| Ga0118657_116759652 | 3300009506 | Mangrove Sediment | MNKLIETFRKCPTPANRAKLQTYLQKHMMAVCLATPEEIAFLKTHEFKI* |
| Ga0114960_103416571 | 3300010158 | Freshwater Lake | MTKLINTYRAVPTAANRANLQKYLDKHMMAACMASPEEMAFLKANQFAI* |
| Ga0129333_1000635922 | 3300010354 | Freshwater To Marine Saline Gradient | MKKLLESFRSAPTQANRDKLQKYLDKHMMAICMASPEDVTFLKNNQFRI* |
| Ga0133913_106855702 | 3300010885 | Freshwater Lake | MTRLIAAYTKLPSPTNRARLAAYLAKHQMAICMATPEERAFLLAHDFAL* |
| Ga0133913_131509192 | 3300010885 | Freshwater Lake | MKMTKLLNAYRALPTASNRNKLQNYLNKHMMAVCMATAEEVAFLRANEFSL* |
| Ga0153698_19607 | 3300011335 | Freshwater | MSIGVFIMQKLLNAYRKLPSPTNRAKLQAYLNKHMMAVCLALPEDIAFLKAHNFSI* |
| Ga0137437_10971752 | 3300011442 | Soil | MTRLINAYRKLPSPTNRAKLQAYLQKHMMAVCMATPEELQFLKANEFSI* |
| Ga0157140_100033203 | 3300012348 | Freshwater | MQKLINAYRKAPTPSNRTKLQAYLKKHMMAVCMATPDELAFLKTHEFI* |
| Ga0154020_109556851 | 3300012956 | Active Sludge | MNKLINAYRKMPSPTNRAKLQAYLDKHMMSICMATPEDVAFLKANEFKI* |
| Ga0119960_10305592 | 3300014811 | Aquatic | MTKLLNTYRTAPTASNRVKLQTYLNKHMMAICLATAEEVAFLRANEFSL* |
| Ga0181338_10059034 | 3300015050 | Freshwater Lake | MHKLINAYRKLPSPSNRTKLQTYLNKHMMAVCLATPEDIAFLRANNFSI* |
| Ga0182046_12656381 | 3300016776 | Salt Marsh | MNKLIETFRKCPTPSNRAKLQTYLQKHMMALCLATPEEIAFLKDHEFKI |
| Ga0181350_10349691 | 3300017716 | Freshwater Lake | MHKLINAYRKLPSPSNRTKLQTYLNKHIMAVCLATPEDIAFLRANNFSI |
| Ga0181350_10890311 | 3300017716 | Freshwater Lake | MTKLINAYRKLPSSSNRAKLAKYIDRHMMAVCMATPDECAFLIAHEFIAA |
| Ga0181347_10631765 | 3300017722 | Freshwater Lake | VSKLIETYRKCPTPSNRAKLQTYLQKHMMSACMATPEEIAFLKANEFKI |
| Ga0181344_100010827 | 3300017754 | Freshwater Lake | MTKLLNTYRAAPTAANRAKLQNYIAKHMMAVCMASPDEVAFLKANQFSI |
| Ga0181344_10887791 | 3300017754 | Freshwater Lake | MTKLLNAYRALPTPSNRAKLQTYLNRHTMAVCMATAEEVAFLRANEFTL |
| Ga0181344_11331554 | 3300017754 | Freshwater Lake | FRTNPTEANRTKLQNYLNKHMMAICLATPDDQAFLKANQFKI |
| Ga0181356_10997921 | 3300017761 | Freshwater Lake | MHKLINAYRKLPSPSNRTKLQTYLNKHMMAVCLATPEDIA |
| Ga0181357_12746832 | 3300017777 | Freshwater Lake | VRKLIETYRKCPTPSNRAKLQTYLQKHMMAACMATPEEIAFLKANEFKI |
| Ga0181346_10873701 | 3300017780 | Freshwater Lake | PMHKLINAYRKLPSPSNRTKLQTYLNKHMMAVCLATPEDIAFLRANNFSI |
| Ga0184628_100365183 | 3300018083 | Groundwater Sediment | MTRLINAYRKLPSPTNRAKLQAYLQKHMMAVCMATPEELQFLKANEFSI |
| Ga0181561_105563161 | 3300018410 | Salt Marsh | MNKLIETFRKCPTPFNRAKLQTYLQKHMMAVCLATPEEIAFLKAHEFKI |
| Ga0181560_102002593 | 3300018413 | Salt Marsh | MNKLIETFRKCPTPSNRAKLQTYLQKHMMALCLATPEEIAFLKANEFKI |
| Ga0194135_1000151929 | 3300018414 | Watersheds | MNKLLNAYRSNPCRANHAKLQAYLNKHMMAVCTATPEDIQFLKAHQFSI |
| Ga0181553_103249722 | 3300018416 | Salt Marsh | MNKLIETFRKCPTPSNRAKLQTYLQKHMMALCLATPEEIAFLKAHEFKI |
| Ga0211733_1018783417 | 3300020160 | Freshwater | VRKLIETYRKCPTPSNRAKLQTYLQKHMMAACMATPEEIAFLKANEFKV |
| Ga0181556_11751842 | 3300020176 | Salt Marsh | MTRHNTTVKDMTMERLINAFRKLPSPTNRHKIEIYLNKHMMALCLATPDQIAFFKANGFS |
| Ga0208359_10248391 | 3300020541 | Freshwater | MKKLLETFRNAPTDANRDKLQKYLDKHMMAVCMALPEDIAFLKANEFRI |
| Ga0222714_1000086740 | 3300021961 | Estuarine Water | VSRLIETYRKCPSPSNRAKLQAYLQKHMMSVCMATEQEIAFLKAHEFKI |
| Ga0222712_100159612 | 3300021963 | Estuarine Water | MNKLLTAYRKLPSPSNRAKLQAYLNKHMMAVCLASAEDIAFLKAHEFKV |
| Ga0181354_11577442 | 3300022190 | Freshwater Lake | MHKLINAYRKLPSPSNRTKLQTYLNKHMMAVCLATPEDIAFLRANNFSI |
| Ga0181351_10099025 | 3300022407 | Freshwater Lake | MHRLINAYRKLPSPSNRTKLQSYLNKHMMAVCLATPEDIAFLKAHNFNI |
| Ga0181351_10150176 | 3300022407 | Freshwater Lake | VSKLIETYRKCPTPSNRAKLQTYLQKHMMAACMATPEEIAFLKANEFKI |
| Ga0248169_1360602 | 3300022602 | Freshwater | MTKLIAAYRKLPSPSNRARLQAYLDKHMMAICTASAEETEFLKVHGFNI |
| Ga0228698_100025741 | 3300022745 | Freshwater | MEKLINTYRAAPTDANRTKLQKYLDKHMMAICMATPEELAFLKANGFSI |
| Ga0209414_10103513 | 3300023301 | Hypersaline | MTKLINAYRKMPSPTNRGKLARYLNRHMMATCMATAEEMGFLRAHGFVE |
| Ga0247674_10000677 | 3300024275 | Soil | MSRLIAAYRAEPTAANRAKLQKYLDKHMMAVCMASEDELAFLKANQFNV |
| Ga0247674_10006096 | 3300024275 | Soil | MSKLIAAFRAAPTAANRAKLQKYLNAHMMAVCMASEAELAFLKANQFNV |
| Ga0256347_10258526 | 3300024545 | Freshwater | LIETFRKCPTPSNRAKLQTYLQKHMMALCLATPEEIAFLKAHEFKI |
| Ga0208738_100095314 | 3300025379 | Freshwater | MSKLIATYRKVPSPTNRKKLEVYLVKHMMALCLAAPEEVEFLKAHQFI |
| Ga0208546_100129016 | 3300025585 | Aqueous | MNKLIETFKKAPTPSNRVRLQAYLNKHMMAICLATPEQVTFLKTHGFSI |
| Ga0208160_11745842 | 3300025647 | Aqueous | MTKLIATYRKLPSPTNRAKLQAYLHKHMMAVVLASADEIAFLKANDFK |
| Ga0208783_100143876 | 3300025872 | Aqueous | MSKLIDTYRKCPTPSNRAKLQAYLKKHMMAVCMATPEEIAFLKAHEFTI |
| Ga0208783_100681121 | 3300025872 | Aqueous | VRSREMNKLIETFKKAPTPSNRVRLQAYLNKHMMAICLATPEQVTFLKTHGFSI |
| Ga0210040_100300414 | 3300025875 | Groundwater | MIRLIVAYRKLPSPTNRRKLQAHMDKHPMAVIIASPEDLDFLRKNEFKV |
| Ga0208644_10382822 | 3300025889 | Aqueous | MQRLLNAYRKVPSPTNRAKLSAYLIKHPMSVCLAQPEDYQFLKTHQFI |
| Ga0208916_102057382 | 3300025896 | Aqueous | MNKLINAYRKMPSPTNRAKLQAYLDKHMMSICMATPEDVAFLKAHEFKI |
| Ga0208926_10040083 | 3300027205 | Estuarine | MNKLINTYRKCPSPANREKLQRYINRHMMAICLASKDDIAFLKTHEFKI |
| Ga0208788_100045221 | 3300027499 | Deep Subsurface | MNRLLNAFRNLPSPSNRKRLQAYLLKHPFSVCLATPEDIAFLKAHEFTI |
| Ga0209114_10088153 | 3300027504 | Forest Soil | MTKLINAYRKLPSATNRAKLQNYLNKHMMAICVATPDEIEFLKTHEFRM |
| Ga0209599_102159352 | 3300027710 | Deep Subsurface | MQKLLNTYRKLPSPSNRAKLQAYLNKHMMAICLATPADQAFLKAHAFTL |
| Ga0209492_10131904 | 3300027721 | Freshwater Sediment | VSRLIETYRKCPSPSNRAKLQAYLQKHMMAVCMATEQEIAFLKAHEFKI |
| Ga0209085_1000022108 | 3300027741 | Freshwater Lake | MTKLINTYRAVPTAANRAKLQKYLDKHMMAVCMASPEEMAFLKANQFAI |
| Ga0209085_10338683 | 3300027741 | Freshwater Lake | MTKLINAYRALPSPTNRAKLQKYLDKHMMAACMATPEEVAFLKAHEFKI |
| Ga0209084_10156767 | 3300027749 | Freshwater Lake | MKRLLEAYRKLPSPTNRNRLQTYLNKHMMAVCLATPEEITFLKTHEFKI |
| Ga0209084_10597625 | 3300027749 | Freshwater Lake | MTKLINTYRAVPTAANRAKLQKYLDKHMMAACMASPEEMAFLKANQFAI |
| Ga0209596_11073923 | 3300027754 | Freshwater Lake | MSRLIAAYRKLPSPANRRKLEAYLARHMFASCLATTEERAFLLAHKFEA |
| Ga0209088_1000010913 | 3300027763 | Freshwater Lake | MTKLLNAYRALPTPSNRAKLQTYLNRHMMAICLATAEEVAFLRANEFSL |
| Ga0209088_100576083 | 3300027763 | Freshwater Lake | MSKLINAYRKLPSPTNRAKLQTYLNKHMMAVCGATLEEVAFLRANEFNI |
| Ga0209229_104349991 | 3300027805 | Freshwater And Sediment | MTKLINAYRNLPSPANRAKLQAYLNKHMMAVCMAKPE |
| Ga0209491_100188791 | 3300027832 | Freshwater | VTKLINAYRKMPSPTNRGKLARYLNGHMMAVCMATAEEMGFLRAYGFVE |
| Ga0209491_101773463 | 3300027832 | Freshwater | MTKLLNAYRSIPSPSNRTKLQNYLHKHMMAVILATPEEVAFLKANEFTI |
| Ga0209491_103747713 | 3300027832 | Freshwater | VTKLINAYRKMPSLTNRGKLVRYLNRHMMATCMATAEEMGFLRAYGFVE |
| Ga0209253_106484952 | 3300027900 | Freshwater Lake Sediment | MSKLINAYRKLPSPTNRAKLQKYIDKHMMAICLATPEELAFLKTHEFRV |
| Ga0209298_101697691 | 3300027973 | Freshwater Lake | MSKLINAYRKLPSPTNRAKLQTYLNKHMMAVCGATLEEVAF |
| Ga0209702_1000208843 | 3300027976 | Freshwater | MTKLINAYRKMPSPTNRGKLVRYLNRHMMATCMATAEEMEFLRAHGFVE |
| Ga0209702_100890083 | 3300027976 | Freshwater | MTKLINAYRKMPSPTNRGKLVRYLNEHMMATCMATAEEMDFLRAYGFVK |
| Ga0209702_100959413 | 3300027976 | Freshwater | MTKLLNTYRALPSPANRAKLQTYLSRHMMAVCLATPDEIAFLKANSFTI |
| Ga0209702_103628862 | 3300027976 | Freshwater | MTKLINAYRKMPSPTNRGKLVRYLNWHMMATCMATAEEMGFLRAHGFVK |
| Ga0209702_103913731 | 3300027976 | Freshwater | MTKLLNAYRSIPSPSNRTKLQNYLHKHMMAVILAT |
| Ga0209284_100398942 | 3300027983 | Freshwater | MTKLINAYRKMPSPTNRGKLVRYLNRHMMAVCMATAEEMGFLRAHGFVE |
| (restricted) Ga0247843_11693504 | 3300028569 | Freshwater | VSKLIETYRKCPTPSNRAKLQNYLQKHMMAACMATPEEIAFLKANEFKV |
| (restricted) Ga0247840_102141141 | 3300028581 | Freshwater | YRKCPTPSNRAKLQTYLQKHMMAACMATPEEIAFLKANEFKV |
| Ga0307405_106794381 | 3300031731 | Rhizosphere | MTKLIKKYKALPSPTNRAKLEAYLRKHPMAVCMATAWELEFLRANEFSY |
| Ga0315907_112539832 | 3300031758 | Freshwater | KENTMSKLINAYRKLPSPTNRAKLQAYLNKHMMAVCTASIEDIAFLRANEFNI |
| Ga0315900_101417272 | 3300031787 | Freshwater | MKKLLEAFRNVPTQANRDKLQKYLDKHMMAICMAMPEDVAFLKENQFRI |
| Ga0315909_1002710315 | 3300031857 | Freshwater | MNKLINTFRKCPSPANREKLQRYINRHMMAICIASADDIAFLKTHEFKI |
| Ga0315905_100039478 | 3300032092 | Freshwater | MTKLLNAYRALPTPSNRAKLQTYLNRHTMAVCMATAEEVAFLRANEFTF |
| Ga0315902_109146372 | 3300032093 | Freshwater | MHKLINAYRKLPSPSNRTKLQAYLNKHMMAVCLATPEDIAFLRANNFSI |
| Ga0335398_104904862 | 3300032435 | Freshwater | VTKLINAYRKMPSLTNRGKLVRYLNEHMMATCMATAEEMGFLRAHGFVK |
| Ga0335398_109011592 | 3300032435 | Freshwater | VTKLINAYRKMPSLTNRGKLVRYLNEHMMATCMATAEEMDFLRAYGFVK |
| Ga0335082_108951181 | 3300032782 | Soil | MDRLIKMYRKLPSPTNRAKLARYLDQHMMAVCLASADDVAFLKAHGFIA |
| Ga0346503_11709792 | 3300033002 | Soil | LIAVFRAAPTPANRAKLQKYLDKRMMAVCMASEDELAFLKANQFNV |
| Ga0334982_0496690_397_540 | 3300033981 | Freshwater | RLIEIYRKCPSPSNRAKLQAYLQKHMMAVCMATEQEIAFLKAHEFKI |
| Ga0334979_0162286_3_137 | 3300033996 | Freshwater | ETYRKCPSPSNRAKLQAYLQKHMMAVCMATEQEIAFLKAHEFKI |
| Ga0334986_0371119_586_735 | 3300034012 | Freshwater | MTKLINLYRAMPSPTNRAKLQKYLDRHMMAICMASPDEVAFLKGNGFSI |
| Ga0335002_0520637_251_400 | 3300034020 | Freshwater | MKKLLETFRNAHTQANRDKLQKYLDKHMMAICMAMPEDVAFLKDNQFRI |
| Ga0334995_0485277_581_730 | 3300034062 | Freshwater | MSKLIIAYRSRPSIQNRAKLQAYLNKHMMAVCMASPEELVFLKIKGFSL |
| Ga0335019_0703470_297_446 | 3300034066 | Freshwater | MSKLIALFKTAPTDANRAKLNIYMNRHMMAVCMLSAEETAFLRANGFKL |
| Ga0310130_0031418_1212_1358 | 3300034073 | Fracking Water | MQKLLNAYRKVPSPTNRAKLQQYLNKHMMAVCLASPEDLAFLKAHSLI |
| Ga0335029_0626095_79_228 | 3300034102 | Freshwater | VSKLIEIYRKCPTLSNRAKLQNYLSKHMMAACMATAEEIAFLKANEFKV |
| Ga0335036_0161901_1439_1582 | 3300034106 | Freshwater | RLIETYRKCPSPSNRAKLQAYLQKHMMAVCMATEQEIAFLKAHEFKI |
| Ga0335036_0406581_68_217 | 3300034106 | Freshwater | MSKLINAYRKLPSPTNRAKLQAYLNKHMMAVCTASIEDIAFLRANEFNI |
| ⦗Top⦘ |