


| Basic Information | |
|---|---|
| Family ID | F042275 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 158 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRTAITLSLPEPAYLRCLRVLGAWWCLGSSALQPQVLMRYEARP |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 158 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 63.29 % |
| % of genes near scaffold ends (potentially truncated) | 32.28 % |
| % of genes from short scaffolds (< 2000 bps) | 60.13 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (32.911 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.266 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.329 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.06% β-sheet: 0.00% Coil/Unstructured: 56.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 158 Family Scaffolds |
|---|---|---|
| PF14833 | NAD_binding_11 | 12.66 |
| PF07732 | Cu-oxidase_3 | 12.03 |
| PF07690 | MFS_1 | 11.39 |
| PF00248 | Aldo_ket_red | 4.43 |
| PF02954 | HTH_8 | 2.53 |
| PF09678 | Caa3_CtaG | 1.90 |
| PF13590 | DUF4136 | 1.90 |
| PF00355 | Rieske | 1.27 |
| PF07995 | GSDH | 1.27 |
| PF02518 | HATPase_c | 1.27 |
| PF08447 | PAS_3 | 1.27 |
| PF13267 | DUF4058 | 0.63 |
| PF00582 | Usp | 0.63 |
| PF00873 | ACR_tran | 0.63 |
| PF00034 | Cytochrom_C | 0.63 |
| PF07681 | DoxX | 0.63 |
| PF03626 | COX4_pro | 0.63 |
| PF13354 | Beta-lactamase2 | 0.63 |
| PF06912 | DUF1275 | 0.63 |
| PF00115 | COX1 | 0.63 |
| PF07731 | Cu-oxidase_2 | 0.63 |
| PF12270 | Cyt_c_ox_IV | 0.63 |
| PF16955 | OFeT_1 | 0.63 |
| PF00069 | Pkinase | 0.63 |
| PF00510 | COX3 | 0.63 |
| PF13442 | Cytochrome_CBB3 | 0.63 |
| PF00116 | COX2 | 0.63 |
| PF08530 | PepX_C | 0.63 |
| PF01527 | HTH_Tnp_1 | 0.63 |
| PF01844 | HNH | 0.63 |
| PF07885 | Ion_trans_2 | 0.63 |
| PF08808 | RES | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 158 Family Scaffolds |
|---|---|---|---|
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 12.66 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.53 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 1.27 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.63 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 0.63 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.63 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.63 |
| COG3125 | Heme/copper-type cytochrome/quinol oxidase, subunit 4 | Energy production and conversion [C] | 0.63 |
| COG3619 | Uncharacterized membrane protein YoaK, UPF0700 family | Function unknown [S] | 0.63 |
| COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 0.63 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.63 |
| COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10058840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2139 | Open in IMG/M |
| 3300001661|JGI12053J15887_10167853 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300002557|JGI25381J37097_1008120 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300002558|JGI25385J37094_10066100 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1169 | Open in IMG/M |
| 3300002558|JGI25385J37094_10085424 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300002560|JGI25383J37093_10016417 | All Organisms → cellular organisms → Bacteria | 2463 | Open in IMG/M |
| 3300002560|JGI25383J37093_10057807 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300002561|JGI25384J37096_10004265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5158 | Open in IMG/M |
| 3300002562|JGI25382J37095_10003799 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5160 | Open in IMG/M |
| 3300002562|JGI25382J37095_10016240 | All Organisms → cellular organisms → Bacteria | 2850 | Open in IMG/M |
| 3300002907|JGI25613J43889_10072658 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 929 | Open in IMG/M |
| 3300002908|JGI25382J43887_10010909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4612 | Open in IMG/M |
| 3300002908|JGI25382J43887_10013063 | All Organisms → cellular organisms → Bacteria | 4288 | Open in IMG/M |
| 3300002908|JGI25382J43887_10077013 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
| 3300002908|JGI25382J43887_10432870 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300002908|JGI25382J43887_10448521 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 546 | Open in IMG/M |
| 3300002909|JGI25388J43891_1010801 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300002912|JGI25386J43895_10009702 | All Organisms → cellular organisms → Bacteria | 2732 | Open in IMG/M |
| 3300002912|JGI25386J43895_10048674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1222 | Open in IMG/M |
| 3300005174|Ga0066680_10010761 | All Organisms → cellular organisms → Bacteria | 4691 | Open in IMG/M |
| 3300005174|Ga0066680_10221934 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300005176|Ga0066679_10174299 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300005176|Ga0066679_10177400 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300005176|Ga0066679_10303903 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300005181|Ga0066678_11082113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 516 | Open in IMG/M |
| 3300005187|Ga0066675_10561488 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300005406|Ga0070703_10317621 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005440|Ga0070705_100965433 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 689 | Open in IMG/M |
| 3300005444|Ga0070694_100011678 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5442 | Open in IMG/M |
| 3300005444|Ga0070694_100215870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1437 | Open in IMG/M |
| 3300005444|Ga0070694_100786620 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 779 | Open in IMG/M |
| 3300005446|Ga0066686_10014586 | All Organisms → cellular organisms → Bacteria | 4221 | Open in IMG/M |
| 3300005447|Ga0066689_10182487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1265 | Open in IMG/M |
| 3300005468|Ga0070707_100019966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6317 | Open in IMG/M |
| 3300005536|Ga0070697_100273836 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1447 | Open in IMG/M |
| 3300005549|Ga0070704_102286437 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005554|Ga0066661_10004464 | All Organisms → cellular organisms → Bacteria | 6398 | Open in IMG/M |
| 3300005554|Ga0066661_10395399 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300005555|Ga0066692_10618246 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005557|Ga0066704_10184800 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1406 | Open in IMG/M |
| 3300005557|Ga0066704_10677345 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 652 | Open in IMG/M |
| 3300005561|Ga0066699_10083297 | All Organisms → cellular organisms → Bacteria | 2068 | Open in IMG/M |
| 3300005568|Ga0066703_10364151 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300005586|Ga0066691_10365793 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300006032|Ga0066696_10606818 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 710 | Open in IMG/M |
| 3300006046|Ga0066652_100946341 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 820 | Open in IMG/M |
| 3300006755|Ga0079222_10088756 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300006797|Ga0066659_10148282 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1665 | Open in IMG/M |
| 3300006804|Ga0079221_11542125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 535 | Open in IMG/M |
| 3300006852|Ga0075433_10063793 | All Organisms → cellular organisms → Bacteria | 3228 | Open in IMG/M |
| 3300006904|Ga0075424_100663205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1114 | Open in IMG/M |
| 3300007255|Ga0099791_10111970 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1261 | Open in IMG/M |
| 3300007258|Ga0099793_10122918 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300007258|Ga0099793_10196645 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300007265|Ga0099794_10093202 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1497 | Open in IMG/M |
| 3300007265|Ga0099794_10595715 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 585 | Open in IMG/M |
| 3300009088|Ga0099830_10020252 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4317 | Open in IMG/M |
| 3300009088|Ga0099830_10126857 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300009088|Ga0099830_10290850 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1302 | Open in IMG/M |
| 3300009088|Ga0099830_11437209 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 574 | Open in IMG/M |
| 3300009089|Ga0099828_10085039 | All Organisms → cellular organisms → Bacteria | 2708 | Open in IMG/M |
| 3300009089|Ga0099828_10127801 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2228 | Open in IMG/M |
| 3300009090|Ga0099827_10002885 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9664 | Open in IMG/M |
| 3300009090|Ga0099827_10014340 | All Organisms → cellular organisms → Bacteria | 5267 | Open in IMG/M |
| 3300009090|Ga0099827_10044380 | All Organisms → cellular organisms → Bacteria | 3307 | Open in IMG/M |
| 3300009090|Ga0099827_10078700 | All Organisms → cellular organisms → Bacteria | 2567 | Open in IMG/M |
| 3300009090|Ga0099827_10740041 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300009137|Ga0066709_100311638 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
| 3300009137|Ga0066709_100332418 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
| 3300009137|Ga0066709_101646209 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300010303|Ga0134082_10148885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
| 3300010304|Ga0134088_10062754 | All Organisms → cellular organisms → Bacteria | 1718 | Open in IMG/M |
| 3300010336|Ga0134071_10400490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 699 | Open in IMG/M |
| 3300010396|Ga0134126_10521905 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300011269|Ga0137392_10088970 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
| 3300011271|Ga0137393_10005680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 8250 | Open in IMG/M |
| 3300011271|Ga0137393_10019407 | All Organisms → cellular organisms → Bacteria | 4933 | Open in IMG/M |
| 3300012096|Ga0137389_10003126 | All Organisms → cellular organisms → Bacteria | 10212 | Open in IMG/M |
| 3300012200|Ga0137382_10721449 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300012202|Ga0137363_10011734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5621 | Open in IMG/M |
| 3300012203|Ga0137399_10027578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3854 | Open in IMG/M |
| 3300012203|Ga0137399_10383451 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300012203|Ga0137399_10580294 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300012209|Ga0137379_11269665 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300012351|Ga0137386_10649538 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 759 | Open in IMG/M |
| 3300012351|Ga0137386_10849197 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300012362|Ga0137361_10011001 | All Organisms → cellular organisms → Bacteria | 6481 | Open in IMG/M |
| 3300012396|Ga0134057_1169835 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 681 | Open in IMG/M |
| 3300012922|Ga0137394_10059989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3152 | Open in IMG/M |
| 3300012922|Ga0137394_10839882 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 768 | Open in IMG/M |
| 3300012925|Ga0137419_10003433 | All Organisms → cellular organisms → Bacteria | 7541 | Open in IMG/M |
| 3300012925|Ga0137419_10357460 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300012927|Ga0137416_10248505 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_4_65_7 | 1452 | Open in IMG/M |
| 3300012929|Ga0137404_10250514 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1520 | Open in IMG/M |
| 3300012930|Ga0137407_10127673 | All Organisms → cellular organisms → Bacteria | 2217 | Open in IMG/M |
| 3300012976|Ga0134076_10289765 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300012976|Ga0134076_10441784 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300015241|Ga0137418_10012439 | All Organisms → cellular organisms → Bacteria | 7854 | Open in IMG/M |
| 3300017659|Ga0134083_10516840 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300018431|Ga0066655_10002624 | All Organisms → cellular organisms → Bacteria | 6851 | Open in IMG/M |
| 3300018431|Ga0066655_10430931 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 870 | Open in IMG/M |
| 3300018433|Ga0066667_10418478 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300018468|Ga0066662_10289175 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300018468|Ga0066662_10933740 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300018468|Ga0066662_12955524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 505 | Open in IMG/M |
| 3300020004|Ga0193755_1114902 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300021046|Ga0215015_10101283 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2561 | Open in IMG/M |
| 3300021086|Ga0179596_10010041 | All Organisms → cellular organisms → Bacteria | 3067 | Open in IMG/M |
| 3300021307|Ga0179585_1158541 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 689 | Open in IMG/M |
| 3300024330|Ga0137417_1133574 | All Organisms → cellular organisms → Bacteria | 4023 | Open in IMG/M |
| 3300025910|Ga0207684_10904072 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 742 | Open in IMG/M |
| 3300025910|Ga0207684_11295308 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300025922|Ga0207646_10004965 | All Organisms → cellular organisms → Bacteria | 14213 | Open in IMG/M |
| 3300026277|Ga0209350_1079202 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 889 | Open in IMG/M |
| 3300026295|Ga0209234_1032298 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
| 3300026296|Ga0209235_1000321 | All Organisms → cellular organisms → Bacteria | 23395 | Open in IMG/M |
| 3300026296|Ga0209235_1004634 | All Organisms → cellular organisms → Bacteria | 7686 | Open in IMG/M |
| 3300026296|Ga0209235_1047224 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300026297|Ga0209237_1011984 | All Organisms → cellular organisms → Bacteria | 5138 | Open in IMG/M |
| 3300026297|Ga0209237_1027130 | All Organisms → cellular organisms → Bacteria | 3175 | Open in IMG/M |
| 3300026297|Ga0209237_1038209 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2539 | Open in IMG/M |
| 3300026297|Ga0209237_1040014 | All Organisms → cellular organisms → Bacteria | 2461 | Open in IMG/M |
| 3300026298|Ga0209236_1284899 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 534 | Open in IMG/M |
| 3300026301|Ga0209238_1088207 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1068 | Open in IMG/M |
| 3300026309|Ga0209055_1012757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4316 | Open in IMG/M |
| 3300026309|Ga0209055_1037286 | All Organisms → cellular organisms → Bacteria | 2175 | Open in IMG/M |
| 3300026313|Ga0209761_1295853 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 567 | Open in IMG/M |
| 3300026317|Ga0209154_1108664 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300026318|Ga0209471_1007100 | All Organisms → cellular organisms → Bacteria | 6014 | Open in IMG/M |
| 3300026325|Ga0209152_10170273 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 819 | Open in IMG/M |
| 3300026328|Ga0209802_1063266 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1774 | Open in IMG/M |
| 3300026328|Ga0209802_1257779 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300026332|Ga0209803_1075324 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
| 3300026334|Ga0209377_1029142 | All Organisms → cellular organisms → Bacteria | 2668 | Open in IMG/M |
| 3300026334|Ga0209377_1052185 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1824 | Open in IMG/M |
| 3300026335|Ga0209804_1243422 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300026524|Ga0209690_1017040 | All Organisms → cellular organisms → Bacteria | 3739 | Open in IMG/M |
| 3300026532|Ga0209160_1273455 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 573 | Open in IMG/M |
| 3300026551|Ga0209648_10099019 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2392 | Open in IMG/M |
| 3300026551|Ga0209648_10447863 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 804 | Open in IMG/M |
| 3300027383|Ga0209213_1097299 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 545 | Open in IMG/M |
| 3300027655|Ga0209388_1001331 | All Organisms → cellular organisms → Bacteria | 5786 | Open in IMG/M |
| 3300027748|Ga0209689_1378463 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300027787|Ga0209074_10374497 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 590 | Open in IMG/M |
| 3300027862|Ga0209701_10009283 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 6408 | Open in IMG/M |
| 3300027862|Ga0209701_10071009 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2204 | Open in IMG/M |
| 3300027862|Ga0209701_10180317 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300027875|Ga0209283_10012329 | All Organisms → cellular organisms → Bacteria | 5096 | Open in IMG/M |
| 3300027882|Ga0209590_10000571 | All Organisms → cellular organisms → Bacteria | 12392 | Open in IMG/M |
| 3300027882|Ga0209590_10005069 | All Organisms → cellular organisms → Bacteria | 5672 | Open in IMG/M |
| 3300027882|Ga0209590_10058672 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2175 | Open in IMG/M |
| 3300027882|Ga0209590_10116054 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_4_65_7 | 1621 | Open in IMG/M |
| 3300028536|Ga0137415_10025974 | All Organisms → cellular organisms → Bacteria | 5779 | Open in IMG/M |
| 3300028536|Ga0137415_10029947 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5360 | Open in IMG/M |
| 3300028536|Ga0137415_10202876 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300031962|Ga0307479_10114064 | All Organisms → cellular organisms → Bacteria | 2631 | Open in IMG/M |
| 3300032180|Ga0307471_104266175 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 505 | Open in IMG/M |
| 3300032205|Ga0307472_100775865 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 872 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 32.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 25.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.27% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.27% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012396 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_100588404 | 3300001661 | Forest Soil | MLQPATITLSVQLPQSVYLLRLRVLGAWWRLGSSAIEPRLLAEY |
| JGI12053J15887_101678531 | 3300001661 | Forest Soil | MRTAITLCLPEPAYLRCLRVLGAWWCLGSSGLEPQVLMRYEVRP* |
| JGI25381J37097_10081202 | 3300002557 | Grasslands Soil | MRTTITVSLPETAYLRCLRVLAAWWCLGSSALQPQVLMRYGAHP* |
| JGI25385J37094_100661002 | 3300002558 | Grasslands Soil | MNTTITLRVPEPTYLRCLRVLGAWWCLGSSTLQPQVLTQYGGRP* |
| JGI25385J37094_100854242 | 3300002558 | Grasslands Soil | MRATITLSLPEPIYLRCLRVLGAWWCLGSSALQPSVLTRYEARP* |
| JGI25383J37093_100164173 | 3300002560 | Grasslands Soil | MRATITVNLHEPAYLRCLRVLGAWWCLGSSALQPQLLTQYEARP* |
| JGI25383J37093_100578072 | 3300002560 | Grasslands Soil | MRTTITVSLPETAYLRCLRVLAAWWCLGSSALQPVVLMRYEGRP* |
| JGI25384J37096_100042655 | 3300002561 | Grasslands Soil | MTTALTLTLPELAYLRCLRVLAAWWCLGSSAVQPQLLMRYEVRP* |
| JGI25382J37095_100037992 | 3300002562 | Grasslands Soil | MNTTITLRVPEPTYLRCLRVLGAWWCLGSSTLQPQVLTQYGGRS* |
| JGI25382J37095_100162404 | 3300002562 | Grasslands Soil | MTTAMTLTMPEPEYLRCLRVLAAWWCLGSXAVQPRVLVRYKVRP* |
| JGI25613J43889_100726583 | 3300002907 | Grasslands Soil | NTTITLSVPEPTYLRCLRVLGAWWCLGSSTLQPQVLTPYGGRS* |
| JGI25382J43887_100109094 | 3300002908 | Grasslands Soil | MNTTITLRXPEPTYLRCLRVLGAWWCLGSSTLQPQVLTQYGGRS* |
| JGI25382J43887_100130636 | 3300002908 | Grasslands Soil | MRTTITLSLPETAYLRCLRVLAAWWCLGSSALQPQLLMRYGAQP* |
| JGI25382J43887_100770132 | 3300002908 | Grasslands Soil | MRTTIALSLPETAYLRCLRVLAAWWCLGSSALQPQLLMRYG |
| JGI25382J43887_104328703 | 3300002908 | Grasslands Soil | METAITLTLPELAYLRCLRVLAAWWNLGSSGVQPRMLVQY |
| JGI25382J43887_104485211 | 3300002908 | Grasslands Soil | TAITLTLPEFAYLRCLRVLAAWWNLGSSGVQPRMLVQYEVRP* |
| JGI25388J43891_10108011 | 3300002909 | Grasslands Soil | MTTVIALSLPEPAYLRCLRVLAAWWCLGSSGVQPQVLMRSGVGS* |
| JGI25386J43895_100097021 | 3300002912 | Grasslands Soil | MNTTITLRMPEPTYLRCLRVLGAWWCLGSSTLQPQVLTQYGGRP* |
| JGI25386J43895_100486742 | 3300002912 | Grasslands Soil | MTLTMPEPEYLRCLRVLAAWWCLGSSAVQPRVLVRYKVRP* |
| Ga0066680_100107616 | 3300005174 | Soil | MRTTITVSLPETAYLRCLRVLAAWWCLGSSALQPQVLMRYGAQP* |
| Ga0066680_102219342 | 3300005174 | Soil | MTTAMTLTLPEPAYLRCLRVLAAWWCLGSSAVQPQVLMRYEVRP* |
| Ga0066679_101742992 | 3300005176 | Soil | MTTALTLTLPEPAYLRYLRVLAAWWCLGSSAVQPQLLIRYEVRP* |
| Ga0066679_101774001 | 3300005176 | Soil | MRTTITVSLPETAYLRCLRVLAAWWCLGSSALQPQVLMRYGA |
| Ga0066679_103039032 | 3300005176 | Soil | MTTAIALTLPEPAYLRRLRVLAAWWCLGSSVLEPQLLMRYEVHR* |
| Ga0066678_110821131 | 3300005181 | Soil | METAITLTLPELAYLRCLRVLAAWWNLGSSGVQPRMLVQYEVRP* |
| Ga0066675_105614882 | 3300005187 | Soil | MRTTITLSLPETAYLRCLRVLAAWWCLGSSALQPQVLMRYGAQGAQP* |
| Ga0070703_103176212 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTALTFSVPEATYLRCLRVLAAWWCLGSSKLEPQVLTRYEVQP* |
| Ga0070705_1009654332 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTTLALSLPELAYLRCLRVLGAWWCLGSSRLEPHVLTQYEARP* |
| Ga0070694_1000116786 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTTITLSLPEPAYLRCLRVLGAWWCLGSSMLQPQVLMWYEERP* |
| Ga0070694_1002158701 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LTFSVPEATYLRCLRVLAAWWCLGSSKLEPQVLTRYEVQP* |
| Ga0070694_1007866202 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VNSMSTTLALSLPELAYLRCLRVLGAWWCLGSSRLEPHVLTQYEARP* |
| Ga0066686_100145862 | 3300005446 | Soil | MTTAITLTLPELAYLRCLRVLAAWWNLGSSGVQPRMLVQYEVRP* |
| Ga0066689_101824872 | 3300005447 | Soil | MTTAMTLTLPEPAYLRCLRVLAAWWCLGSSAVQPQVLMRYEVGP* |
| Ga0070707_1000199666 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GSARGSPPVNSMSTTLALSLPELAYLRCLRVLGAWWCLGSSRLEPHVLTQYEARP* |
| Ga0070697_1002738363 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | PVNSMSTTLALSLPELAYLRCLRVLGAWWCLGSSRLEPHVLTQYEARP* |
| Ga0070704_1022864372 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | RTTITLSLPEPAYLRCLRVLGAWWCLGSSMLQPQVLMWYEERP* |
| Ga0066661_100044646 | 3300005554 | Soil | MTTAMTLTLPEPAYLRCLRVLAAWWCLGSSAVQPQLLMRYEVRP* |
| Ga0066661_103953991 | 3300005554 | Soil | AMTTAMTLTLPEPAYLRCLRVLAAWWCLGSSAVQPQVLMRYEVRP* |
| Ga0066692_106182462 | 3300005555 | Soil | TAITLTLPELAYLRCLRVLAAWWNLGSSGVQPRMLVQYEVRP* |
| Ga0066704_101848001 | 3300005557 | Soil | VWHAECKGNRAMTTAMTLTLPEPAYLRCLRVLAAWWCLGSSAVQPQVLMRYEVRP* |
| Ga0066704_106773451 | 3300005557 | Soil | MTTAITLTLPELAYLRCLRVLAAWWNLGSSGVQPRMLVQYEV |
| Ga0066699_100832971 | 3300005561 | Soil | MTTAMTLTLPEPAYLRCLRILAAWWCLGSSAVQPQLLMRYEVRP* |
| Ga0066703_103641511 | 3300005568 | Soil | SVMRTTITVSLPETAYLRCLRVLAAWWCLGSSALQPQVLMRYGAHP* |
| Ga0066691_103657931 | 3300005586 | Soil | KGNRAMTTAMTLTLPEPAYLRCLRVLAAWWCLGSSAVQPQVLMRYEVRP* |
| Ga0066696_106068181 | 3300006032 | Soil | VMTTALTLTLPEPAYLRYLRVLAAWWCLGSSAVQPQLLIRYEVRP* |
| Ga0066652_1009463412 | 3300006046 | Soil | MTTALTLTLPEPAYLRYLRVLAAWWCLGSSAVQPQLLIRYKVRP* |
| Ga0079222_100887562 | 3300006755 | Agricultural Soil | MNSVIALSLPESAYLRCLRVLAAWWCLGSSQLQPQVLMRYEAHP* |
| Ga0066659_101482825 | 3300006797 | Soil | ITVSLPETAYLRCLRVLAAWWCLGSSALQPQVLMRYGAHP* |
| Ga0079221_115421252 | 3300006804 | Agricultural Soil | MITVIALSFPEPAYLRCLRVLAAWWCLGSSSLQPQLIMRYGARP* |
| Ga0075433_100637932 | 3300006852 | Populus Rhizosphere | MTTALTFSVPEATYLRCLRVLGAWWCLGSSKLQPQVLTRYEVQP* |
| Ga0075424_1006632051 | 3300006904 | Populus Rhizosphere | TALTFSVPEATYLRCLRVLGAWWCLGSSKLQPQVLTRYEVQP* |
| Ga0099791_101119704 | 3300007255 | Vadose Zone Soil | VPEPTYLRCLRVLGAWWCLGSSTLQPQLLTQYGERS* |
| Ga0099793_101229181 | 3300007258 | Vadose Zone Soil | MRITITLSLAEPAYLRCLRVLGAWWWLGSSSVQPRLLAEYGVRS* |
| Ga0099793_101966452 | 3300007258 | Vadose Zone Soil | MNTTITLSVPEPTYLRCLRVLGAWWCLGSSALQPQVLTQYGGRS* |
| Ga0099794_100932022 | 3300007265 | Vadose Zone Soil | MRTATTLTLPEPAYLRYLRVLGAWWCLGSSAVGPRVLMAYVARS* |
| Ga0099794_105957151 | 3300007265 | Vadose Zone Soil | THNSMNTTITLRVPEPTYLRCLRVLGAWWCLGSSTLQPQVLTQYGGRP* |
| Ga0099830_100202521 | 3300009088 | Vadose Zone Soil | MRTAITLTLPEPAYLRCLRVLGAWWCLGSSGLQPPVL |
| Ga0099830_101268571 | 3300009088 | Vadose Zone Soil | RGSAPVTVTLSLPELAYPRCLRVLGAWWCLGSSGLQPYLLTQYEARP* |
| Ga0099830_102908501 | 3300009088 | Vadose Zone Soil | TGRRGDHAMRTAITLTLPEPAYLRCLRVLGAWWCLGSSGLQPRVLMPYVARP* |
| Ga0099830_114372092 | 3300009088 | Vadose Zone Soil | MTTAITLSLPEPAYLRCLRVLAAWWCLGSSALQPQVLMRYEAQP* |
| Ga0099828_100850393 | 3300009089 | Vadose Zone Soil | MTTAITLSLPEPAYLRYLRVLAAWWCLGSSALEPQVLMRYEAQP* |
| Ga0099828_101278014 | 3300009089 | Vadose Zone Soil | VTVTLSLPELAYLRCLRVLGAWWCLGSSGLQPYLLTQYEARP* |
| Ga0099827_100028858 | 3300009090 | Vadose Zone Soil | MITVSLPETAYLRCLRVLAAWWCLGSSALQPQVLMRYGAHP* |
| Ga0099827_100143407 | 3300009090 | Vadose Zone Soil | MTTAITLSLPEPAYLRYLRVLAAWWCLGSSALQPQVLMRYEAQP* |
| Ga0099827_100443804 | 3300009090 | Vadose Zone Soil | MSTTITLSLPEPAYLRCLRVLGAWWCLGSSTLQPQLLTQYGARP* |
| Ga0099827_100787002 | 3300009090 | Vadose Zone Soil | MRTAITLSLPEPAYLRCLRVLGAWWCLGSSALQPQVLMRYEARP* |
| Ga0099827_107400411 | 3300009090 | Vadose Zone Soil | TTVITLSLPEPAYLRRLRVLAAWWCLGSSALQPQVLVRYGANR* |
| Ga0066709_1003116383 | 3300009137 | Grasslands Soil | MTTAMTLTLPELAYLRCLRVLAAWWCLGSSAVQPQVLMRYEVRP* |
| Ga0066709_1003324183 | 3300009137 | Grasslands Soil | MTAAITLRLPEPSYLRCLRVLAAWWCLGSSALEPQVLMRYKAQP* |
| Ga0066709_1016462092 | 3300009137 | Grasslands Soil | MRTTITVSLPETAYLRCLRVLAAWWCLGSSVLQPVVLMRYEGRP* |
| Ga0134082_101488852 | 3300010303 | Grasslands Soil | MTTALTLTLPEPAYLRYLRVLAAWWCLGSSAVQPQVLMRYEVRP* |
| Ga0134088_100627544 | 3300010304 | Grasslands Soil | VPEPTYLRCLRVLGAWWCLGSSTLQPQVLTQYGGRP* |
| Ga0134071_104004901 | 3300010336 | Grasslands Soil | MTTAITFTLPEPAYLRRLRVLAAWWCLGSSALQPQVLMRYEVHS* |
| Ga0134126_105219053 | 3300010396 | Terrestrial Soil | MTTALTFSVPEATYLRCLRVLAAWWCLGSSKLQPQVLTRYGAHP* |
| Ga0137392_100889702 | 3300011269 | Vadose Zone Soil | MTTAITLSLPEPAYLRCLRVLAAWWCLGSSTLQPQVLMRYEAQP* |
| Ga0137393_100056808 | 3300011271 | Vadose Zone Soil | MRTAITLTLPEPAYLRCLRVLGVWWCLGSSGLQPLVLMPYVARP* |
| Ga0137393_100194074 | 3300011271 | Vadose Zone Soil | MRTAITLTLPEPAYLRCLRVLGAWWCLGSSGLQPRVLMPYVARP* |
| Ga0137389_100031268 | 3300012096 | Vadose Zone Soil | MRTAITLTLPEPAYLRCLRVLGAWWCLGSSGLQPLVLMPYVARP* |
| Ga0137382_107214491 | 3300012200 | Vadose Zone Soil | MTTVIALSLPEPAYLRCLRVLAAWWCLGSSGVQPQVLMRSGVG |
| Ga0137363_100117341 | 3300012202 | Vadose Zone Soil | VPEPTYLRCLRVLGAWWCLGSSTLQPQVLTPYGGRS* |
| Ga0137399_100275786 | 3300012203 | Vadose Zone Soil | MTTAMTSTLPEPAYLRCLRVLAAWWCLGSSAVQPQVLMRYEVRP* |
| Ga0137399_103834512 | 3300012203 | Vadose Zone Soil | MRTTITVSLPETTYLRCLRVLGAWWCLGSSALQPQVLMRYEAQP* |
| Ga0137399_105802942 | 3300012203 | Vadose Zone Soil | METAITLTLPERAYLRCLRVLAAWWNLGSSGVQPRMLVQYEVRP* |
| Ga0137379_112696652 | 3300012209 | Vadose Zone Soil | MRTTITLSLPETAYLRCLRVLAAWWCLGSSALQPQVLMRYGAQP* |
| Ga0137386_106495382 | 3300012351 | Vadose Zone Soil | MRAAITLSLPECGYLRCLRVLGAWWCLGSSALQPRLLLQYEARP* |
| Ga0137386_108491971 | 3300012351 | Vadose Zone Soil | HGAMRAAITLSLPEPAYLRCLRVLGAWWCLGSSALQPRLLMQYEARP* |
| Ga0137361_100110015 | 3300012362 | Vadose Zone Soil | MNTTITLSVPEPTYLRCLRVLGAWWCLGSSTLQPQVLTPYGGRS* |
| Ga0134057_11698352 | 3300012396 | Grasslands Soil | LPELAYLRCLRVLAAWWNLGSSGVQPRMLVQYEVRP* |
| Ga0137394_100599897 | 3300012922 | Vadose Zone Soil | AMRTTITVSLPETTYLRCLRVLGAWWCLGSSALQPQVLMRYEAQP* |
| Ga0137394_108398821 | 3300012922 | Vadose Zone Soil | RVPEPTYLRCLRVLGAWWCLGSSTLQPQVLTQYGGRS* |
| Ga0137419_100034334 | 3300012925 | Vadose Zone Soil | MNTTITLRVPERTYLRCLRVLGAWWCLGSSTLQPQVLTQYGGRS* |
| Ga0137419_103574602 | 3300012925 | Vadose Zone Soil | MRTTITLSLPEAAYLRCLRVLGAWWCLGSSVLQPQVLMRYEERP* |
| Ga0137416_102485051 | 3300012927 | Vadose Zone Soil | MNTTITLRVPEPTYLRCLRVLGAWWCLGSSTLQPQVLTQYGGR |
| Ga0137404_102505142 | 3300012929 | Vadose Zone Soil | MSTTIALSLPELAYLRCLRVLGAWWCLGSSRLEPHLLTQYEARP* |
| Ga0137407_101276734 | 3300012930 | Vadose Zone Soil | AMRTTITLSLSEPAYLRCLRILGAWWCLGSSALQPQVLMRYEARP* |
| Ga0134076_102897651 | 3300012976 | Grasslands Soil | MTTAITFTLPEPAYLRCLRVLAAWWCLGSSALQPVVLMRYEGRP* |
| Ga0134076_104417842 | 3300012976 | Grasslands Soil | METAITLTLPELAYLRCLRVLAAWWNLGSSGVQPRMLVQYEVR |
| Ga0137418_100124399 | 3300015241 | Vadose Zone Soil | MRTTITLSLPEPAYLRCLRVLGAWWCLGSSMLQPQVLMRYEARP* |
| Ga0134083_105168401 | 3300017659 | Grasslands Soil | TITLSLPEPIYLRCLRVLGAWLCLGSSALQPSVLTRYEARP |
| Ga0066655_100026248 | 3300018431 | Grasslands Soil | MTTAITLTLPELAYLRCLRVLAAWWNLGSSGVQPRMLVQYEVRP |
| Ga0066655_104309311 | 3300018431 | Grasslands Soil | GAMRTAITLSLPECGYLRCLRVLGAWWCLGSSALQPRLLLQYEARP |
| Ga0066667_104184781 | 3300018433 | Grasslands Soil | MTAAITLRLPEPSYLRCLRVLAAWWCLGSSALEPQVLMRYKAQP |
| Ga0066662_102891752 | 3300018468 | Grasslands Soil | MTTALTLTLPEPAYLRYLRVLAAWWCLGSSAVQPQLLIRYEVRP |
| Ga0066662_109337402 | 3300018468 | Grasslands Soil | MRTTITVSLPETAYLRCLRVLAAWWCLGSSALQPQVLMRYGAHP |
| Ga0066662_129555242 | 3300018468 | Grasslands Soil | MRTTITLSLPETAYLRCLRVLAAWWCLGSSALQPQVLMRYGAQGAQP |
| Ga0193755_11149022 | 3300020004 | Soil | MRTTITLSLPEPAYLRCLRVLGAWWCLGSSMLQPQVLMRYEEHP |
| Ga0215015_101012832 | 3300021046 | Soil | MRTATTLTLPEPAYLRYLRVLGAWWCLGSSAVGPRVLMAYVVRS |
| Ga0179596_100100414 | 3300021086 | Vadose Zone Soil | MNTTITLSVPEPTYLRCLRVLGAWWCLGSSTLQPQVLTPYGGRS |
| Ga0179585_11585411 | 3300021307 | Vadose Zone Soil | ITLCLPEPAYLRCLRVLGAWWCLGSSGLEPQVLMRYEVRP |
| Ga0137417_11335745 | 3300024330 | Vadose Zone Soil | MNTTITLSVPEPTYLRCLRVLGAWWCLGSSALQPQVLTQYGGRS |
| Ga0207684_109040722 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTTLALSLPELAYLRCLRVLGAWWCLGSSRLEPHVLTQYEARP |
| Ga0207684_112953082 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | TFSVPEATYLRCLRVLAAWWCLGSSKLEPQVLTRYEVQP |
| Ga0207646_1000496512 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VNSMSTTLALSLPELAYLRCLRVLGAWWCLGSSRLEPHVLTQYEARP |
| Ga0209350_10792022 | 3300026277 | Grasslands Soil | MTTVIALSLPEPAYLRCLRVLAAWWCLGSSGVQPQVLMRSGVGS |
| Ga0209234_10322982 | 3300026295 | Grasslands Soil | MTTVIALRLPEPAYLRCLRVLAAWWCLGSSGVQPQVLMRSGVDS |
| Ga0209235_100032114 | 3300026296 | Grasslands Soil | MTTALTLTLPELAYLRCLRVLAAWWCLGSSAVQPQLLMRYEVRP |
| Ga0209235_10046344 | 3300026296 | Grasslands Soil | MNTTITLRMPEPTYLRCLRVLGAWWCLGSSTLQPQVLTQYGGRP |
| Ga0209235_10472242 | 3300026296 | Grasslands Soil | MRTTITVSLPETAYLRCLRVLAAWWCLGSSALQPVVLMRYEGRP |
| Ga0209237_10119841 | 3300026297 | Grasslands Soil | METAITLTLPEFAYLRCLRVLAAWWNLGSSGVQPRMLVQYEVRP |
| Ga0209237_10271305 | 3300026297 | Grasslands Soil | MTTAMTLTMPEPEYLRCLRVLAAWWCLGSSAVQPRVLVRYKVRP |
| Ga0209237_10382092 | 3300026297 | Grasslands Soil | METAITLTLPELAYLRCLRVLAAWWNLGSSGVQPRMLVQYEVRP |
| Ga0209237_10400142 | 3300026297 | Grasslands Soil | MRATITLSLPEPIYLRCLRVLGAWWCLGSSALQPSVLTRYEARP |
| Ga0209236_12848991 | 3300026298 | Grasslands Soil | PEPAYLRCLRVLAAWWCLGSSAVQPQVLMRYEVRP |
| Ga0209238_10882071 | 3300026301 | Grasslands Soil | MTTAMTLTLPEPAYLRCLRVLAAWWCLGSSAVQPQVLMRYEVRP |
| Ga0209055_10127575 | 3300026309 | Soil | MTTAIALTLPEPAYLRRLRVLAAWWCLGSSVLEPQLLMRYEVHR |
| Ga0209055_10372862 | 3300026309 | Soil | MTTAMTLTLPEPAYLRCLRILAAWWCLGSSAVQPQLLMRYEVRP |
| Ga0209761_12958531 | 3300026313 | Grasslands Soil | MTTAMTLTLPEPAYLRCLRVLAAWWCLGSSAEQPQVLMR |
| Ga0209154_11086643 | 3300026317 | Soil | TTITVSLPETAYLRCLRVLAAWWCLGSSALQPQVLMRYGAQP |
| Ga0209471_10071002 | 3300026318 | Soil | MRTTITVSLPETAYLRCLRVLAAWWCLGSSALQPQVLMRYGAQP |
| Ga0209152_101702731 | 3300026325 | Soil | MTTAMTLTLPEPAYLRCLRVLAAWWCLGSSAVQPQLLMRYEVRP |
| Ga0209802_10632663 | 3300026328 | Soil | RTTITVSLPETAYLRCLRVLAAWWCLGSSALQPQVLMRYGAQGAQP |
| Ga0209802_12577792 | 3300026328 | Soil | AMTTAMTLTLPEPAYLRCLRILAAWWCLGSSAVQPQLLMRYEVRP |
| Ga0209803_10753242 | 3300026332 | Soil | MRATITLSVPEPIYLRCLRVLGAWWCLGSSALQLSLLT |
| Ga0209377_10291425 | 3300026334 | Soil | MTTAITLTLPELAYLRCLRVLAAWWNLGSSGVQPRMLVQYEVR |
| Ga0209377_10521852 | 3300026334 | Soil | MTTAMTLTLPEPAYLRCLRVLAAWWCLGSSAVQPQVLMRYEVGP |
| Ga0209804_12434222 | 3300026335 | Soil | MTTVIALRLPEPAYLRCLRVLAAWWCLGSSGVQPQVLMR |
| Ga0209690_10170403 | 3300026524 | Soil | MRATITVNLHEPAYLRCLRVLGAWWCLGSSALQPQLLTQYEARP |
| Ga0209160_12734552 | 3300026532 | Soil | LSGDAMKATVTLSLPERVYLRCLRVLGAWWCLGSSALQPSLLTRYEARP |
| Ga0209648_100990191 | 3300026551 | Grasslands Soil | MRTATTLTLPEPAYLRYLRVLGAWWCLGSSAVGPRVLIAYVARS |
| Ga0209648_104478632 | 3300026551 | Grasslands Soil | MRTATTLTLPEPAYLRYLRVLGAWWCLGSSAVGPRVLMAYVARS |
| Ga0209213_10972992 | 3300027383 | Forest Soil | MKTAIKLSLTADAYERCLRVLGAWWCLGSSGLEPQVLMRYEVRP |
| Ga0209388_10013315 | 3300027655 | Vadose Zone Soil | MNTTITLRVPEPTYLRCLRVLGAWWCLGSSTLQPQLLTQYGERS |
| Ga0209689_13784631 | 3300027748 | Soil | VWHAECKGNRAMTTAMTLTLPEPAYLRCLRVLAAWWCLGSSAVQPQVLMRYEVRP |
| Ga0209074_103744972 | 3300027787 | Agricultural Soil | MNSVIALSLPESAYLRCLRVLAAWWCLGSSQLQPQVLMRYEAHP |
| Ga0209701_100092834 | 3300027862 | Vadose Zone Soil | MRTAITLTLPEPAYLRCLRVLGAWWCLGSSGLQPRVLMPYVARP |
| Ga0209701_100710093 | 3300027862 | Vadose Zone Soil | MNTTITLRVPEPTYLRCLRVLGAWWCLGSSTLQPQVLTQYGGRP |
| Ga0209701_101803173 | 3300027862 | Vadose Zone Soil | MTTAITLSLPEPAYLRCLRVLAAWWCLGSSALQPQVLMRYEAQP |
| Ga0209283_100123295 | 3300027875 | Vadose Zone Soil | MRTAITLTLPEPAYLRCLRVLGAWWCLGSSGLQPLVLMPYVARP |
| Ga0209590_1000057111 | 3300027882 | Vadose Zone Soil | MRTMITVSLPETAYLRCLRVLAAWWCLGSSALQPQVLMRYGAHP |
| Ga0209590_100050697 | 3300027882 | Vadose Zone Soil | MTTAITLSLPEPAYLRYLRVLAAWWCLGSSALQPQVLMRYEAQP |
| Ga0209590_100586723 | 3300027882 | Vadose Zone Soil | MNTPITLSLPEPVYLRCLRVLGAWWCLGSSALQPRLLTQYEARP |
| Ga0209590_101160541 | 3300027882 | Vadose Zone Soil | MNTTITLRVPEPTYLRCLRVLGAWWCLGSSTLQPQVLTQYGGRS |
| Ga0137415_100259742 | 3300028536 | Vadose Zone Soil | MNTTITLRVPERTYLRCLRVLGAWWCLGSSTLQPQVLTQYGGRS |
| Ga0137415_100299477 | 3300028536 | Vadose Zone Soil | MRTTITVSLPETTYLRCLRVLGAWWCLGSSALQPQVLMRYEAQP |
| Ga0137415_102028763 | 3300028536 | Vadose Zone Soil | MRTTITLSLPEAAYLRCLRVLGAWWCLGSSVLQPQVLMRYEERP |
| Ga0307479_101140642 | 3300031962 | Hardwood Forest Soil | MRTTIALSLPEPAYLRCLRVLGAWWCLGSSALPPQVLMRYEVQP |
| Ga0307471_1042661751 | 3300032180 | Hardwood Forest Soil | VNSMSTTLALSLPELAYLRCLRVLGAWWCLGSSRLEPHLLTQYEARP |
| Ga0307472_1007758652 | 3300032205 | Hardwood Forest Soil | MTTALTFSVPEATYLRCLRVLAAWWCLGSSKLEPQVLTRYEVQP |
| ⦗Top⦘ |