


| Basic Information | |
|---|---|
| Family ID | F042073 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VTTDMKWIDIKIKDLKKKINDQSVEDAKKGLLDIAS |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 29.01 % |
| % of genes near scaffold ends (potentially truncated) | 56.60 % |
| % of genes from short scaffolds (< 2000 bps) | 64.78 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.604 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (33.962 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.472 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.019 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF00476 | DNA_pol_A | 36.48 |
| PF01612 | DNA_pol_A_exo1 | 6.92 |
| PF16861 | Carbam_trans_C | 5.03 |
| PF11753 | DUF3310 | 4.40 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.89 |
| PF07883 | Cupin_2 | 1.26 |
| PF13759 | 2OG-FeII_Oxy_5 | 1.26 |
| PF00580 | UvrD-helicase | 0.63 |
| PF00271 | Helicase_C | 0.63 |
| PF02195 | ParBc | 0.63 |
| PF13361 | UvrD_C | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 36.48 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.63 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.63 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.60 % |
| All Organisms | root | All Organisms | 39.62 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 3.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10142891 | All Organisms → Viruses | 894 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10024787 | Not Available | 2867 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10110270 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10121099 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 944 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10001611 | All Organisms → cellular organisms → Bacteria | 14535 | Open in IMG/M |
| 3300000153|SI39nov09_135mDRAFT_c1022521 | Not Available | 1165 | Open in IMG/M |
| 3300001450|JGI24006J15134_10069887 | Not Available | 1351 | Open in IMG/M |
| 3300001450|JGI24006J15134_10163674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 715 | Open in IMG/M |
| 3300001472|JGI24004J15324_10017451 | All Organisms → cellular organisms → Bacteria | 2474 | Open in IMG/M |
| 3300001960|GOS2230_1037542 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
| 3300002488|JGI25128J35275_1081278 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300004457|Ga0066224_1063441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 667 | Open in IMG/M |
| 3300006025|Ga0075474_10036896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1696 | Open in IMG/M |
| 3300006026|Ga0075478_10130864 | Not Available | 789 | Open in IMG/M |
| 3300006027|Ga0075462_10239066 | Not Available | 540 | Open in IMG/M |
| 3300006637|Ga0075461_10245320 | Not Available | 526 | Open in IMG/M |
| 3300006735|Ga0098038_1047362 | Not Available | 1561 | Open in IMG/M |
| 3300006735|Ga0098038_1151917 | Not Available | 771 | Open in IMG/M |
| 3300006735|Ga0098038_1257906 | Not Available | 549 | Open in IMG/M |
| 3300006737|Ga0098037_1005804 | Not Available | 5054 | Open in IMG/M |
| 3300006749|Ga0098042_1036934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1364 | Open in IMG/M |
| 3300006749|Ga0098042_1045506 | Not Available | 1203 | Open in IMG/M |
| 3300006802|Ga0070749_10017202 | Not Available | 4610 | Open in IMG/M |
| 3300006802|Ga0070749_10109589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1627 | Open in IMG/M |
| 3300006802|Ga0070749_10360330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 807 | Open in IMG/M |
| 3300006802|Ga0070749_10397172 | Not Available | 761 | Open in IMG/M |
| 3300006802|Ga0070749_10704820 | Not Available | 539 | Open in IMG/M |
| 3300006803|Ga0075467_10556927 | Not Available | 587 | Open in IMG/M |
| 3300006810|Ga0070754_10065892 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1864 | Open in IMG/M |
| 3300006810|Ga0070754_10267022 | All Organisms → Viruses | 777 | Open in IMG/M |
| 3300006810|Ga0070754_10273329 | unclassified Hyphomonas → Hyphomonas sp. | 765 | Open in IMG/M |
| 3300006810|Ga0070754_10290234 | Not Available | 736 | Open in IMG/M |
| 3300006867|Ga0075476_10269434 | Not Available | 603 | Open in IMG/M |
| 3300006867|Ga0075476_10285662 | Not Available | 581 | Open in IMG/M |
| 3300006916|Ga0070750_10290169 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 701 | Open in IMG/M |
| 3300006916|Ga0070750_10295041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 694 | Open in IMG/M |
| 3300006916|Ga0070750_10430395 | Not Available | 547 | Open in IMG/M |
| 3300006919|Ga0070746_10330306 | Not Available | 695 | Open in IMG/M |
| 3300006919|Ga0070746_10375838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 640 | Open in IMG/M |
| 3300006920|Ga0070748_1372109 | Not Available | 501 | Open in IMG/M |
| 3300006925|Ga0098050_1117492 | Not Available | 675 | Open in IMG/M |
| 3300007234|Ga0075460_10044320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1687 | Open in IMG/M |
| 3300007234|Ga0075460_10071968 | Not Available | 1270 | Open in IMG/M |
| 3300007234|Ga0075460_10119378 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 936 | Open in IMG/M |
| 3300007344|Ga0070745_1001151 | All Organisms → cellular organisms → Bacteria | 14923 | Open in IMG/M |
| 3300007344|Ga0070745_1173135 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 808 | Open in IMG/M |
| 3300007346|Ga0070753_1091088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 1200 | Open in IMG/M |
| 3300007346|Ga0070753_1346569 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300007539|Ga0099849_1019035 | All Organisms → cellular organisms → Bacteria | 2994 | Open in IMG/M |
| 3300007539|Ga0099849_1027441 | Not Available | 2448 | Open in IMG/M |
| 3300007539|Ga0099849_1122412 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300007539|Ga0099849_1159555 | Not Available | 868 | Open in IMG/M |
| 3300007540|Ga0099847_1172863 | Not Available | 637 | Open in IMG/M |
| 3300007540|Ga0099847_1238469 | Not Available | 525 | Open in IMG/M |
| 3300007778|Ga0102954_1003425 | All Organisms → Viruses → Predicted Viral | 4618 | Open in IMG/M |
| 3300007963|Ga0110931_1261242 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300009001|Ga0102963_1128212 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1028 | Open in IMG/M |
| 3300009001|Ga0102963_1157997 | unclassified Hyphomonas → Hyphomonas sp. | 912 | Open in IMG/M |
| 3300009071|Ga0115566_10124844 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300009076|Ga0115550_1150607 | Not Available | 813 | Open in IMG/M |
| 3300009124|Ga0118687_10225484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 689 | Open in IMG/M |
| 3300009149|Ga0114918_10091034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 1916 | Open in IMG/M |
| 3300009433|Ga0115545_1013300 | All Organisms → cellular organisms → Bacteria | 3532 | Open in IMG/M |
| 3300009476|Ga0115555_1450486 | Not Available | 511 | Open in IMG/M |
| 3300009529|Ga0114919_10907671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 594 | Open in IMG/M |
| 3300010299|Ga0129342_1026094 | Not Available | 2370 | Open in IMG/M |
| 3300010300|Ga0129351_1140946 | Not Available | 955 | Open in IMG/M |
| 3300010370|Ga0129336_10575808 | Not Available | 602 | Open in IMG/M |
| 3300011129|Ga0151672_125126 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300011253|Ga0151671_1005957 | unclassified Hyphomonas → Hyphomonas sp. | 2723 | Open in IMG/M |
| 3300012528|Ga0129352_10194078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 551 | Open in IMG/M |
| 3300012920|Ga0160423_10017289 | Not Available | 5455 | Open in IMG/M |
| 3300017697|Ga0180120_10068328 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1578 | Open in IMG/M |
| 3300017708|Ga0181369_1083832 | Not Available | 676 | Open in IMG/M |
| 3300017709|Ga0181387_1049824 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300017749|Ga0181392_1168830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 638 | Open in IMG/M |
| 3300017751|Ga0187219_1005332 | All Organisms → cellular organisms → Bacteria | 5374 | Open in IMG/M |
| 3300017753|Ga0181407_1109609 | Not Available | 692 | Open in IMG/M |
| 3300017765|Ga0181413_1225639 | Not Available | 556 | Open in IMG/M |
| 3300017963|Ga0180437_10175490 | Not Available | 1710 | Open in IMG/M |
| 3300017963|Ga0180437_10710736 | Not Available | 728 | Open in IMG/M |
| 3300017971|Ga0180438_10691111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 750 | Open in IMG/M |
| 3300017989|Ga0180432_11185679 | Not Available | 512 | Open in IMG/M |
| 3300018049|Ga0181572_10850140 | Not Available | 542 | Open in IMG/M |
| 3300018080|Ga0180433_10049807 | All Organisms → cellular organisms → Bacteria | 3916 | Open in IMG/M |
| 3300019751|Ga0194029_1018120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 1060 | Open in IMG/M |
| 3300019756|Ga0194023_1052281 | unclassified Hyphomonas → Hyphomonas sp. | 821 | Open in IMG/M |
| 3300021364|Ga0213859_10084880 | Not Available | 1503 | Open in IMG/M |
| 3300021389|Ga0213868_10591488 | Not Available | 582 | Open in IMG/M |
| 3300021957|Ga0222717_10155657 | Not Available | 1388 | Open in IMG/M |
| 3300021958|Ga0222718_10030736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3597 | Open in IMG/M |
| 3300021958|Ga0222718_10467458 | Not Available | 616 | Open in IMG/M |
| 3300021959|Ga0222716_10080497 | Not Available | 2238 | Open in IMG/M |
| 3300021962|Ga0222713_10368177 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300021964|Ga0222719_10568125 | Not Available | 666 | Open in IMG/M |
| 3300022050|Ga0196883_1006598 | Not Available | 1355 | Open in IMG/M |
| 3300022053|Ga0212030_1034104 | Not Available | 711 | Open in IMG/M |
| 3300022068|Ga0212021_1112248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
| 3300022074|Ga0224906_1107232 | Not Available | 819 | Open in IMG/M |
| 3300022158|Ga0196897_1009710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1196 | Open in IMG/M |
| 3300022843|Ga0222631_1006275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2257 | Open in IMG/M |
| 3300022929|Ga0255752_10358233 | Not Available | 592 | Open in IMG/M |
| 3300025070|Ga0208667_1001822 | All Organisms → Viruses | 7412 | Open in IMG/M |
| 3300025079|Ga0207890_1020213 | Not Available | 1293 | Open in IMG/M |
| 3300025086|Ga0208157_1057493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium TMED287 | 1025 | Open in IMG/M |
| 3300025099|Ga0208669_1108694 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300025101|Ga0208159_1048089 | Not Available | 894 | Open in IMG/M |
| 3300025120|Ga0209535_1051618 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300025120|Ga0209535_1069639 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
| 3300025127|Ga0209348_1011858 | Not Available | 3449 | Open in IMG/M |
| 3300025138|Ga0209634_1050697 | Not Available | 2051 | Open in IMG/M |
| 3300025168|Ga0209337_1007921 | All Organisms → cellular organisms → Bacteria | 6973 | Open in IMG/M |
| 3300025168|Ga0209337_1075462 | Not Available | 1652 | Open in IMG/M |
| 3300025543|Ga0208303_1008838 | Not Available | 3197 | Open in IMG/M |
| 3300025590|Ga0209195_1016322 | unclassified Hyphomonas → Hyphomonas sp. | 2466 | Open in IMG/M |
| 3300025647|Ga0208160_1115273 | Not Available | 683 | Open in IMG/M |
| 3300025759|Ga0208899_1053730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1709 | Open in IMG/M |
| 3300025769|Ga0208767_1060668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1699 | Open in IMG/M |
| 3300025897|Ga0209425_10059057 | Not Available | 2488 | Open in IMG/M |
| 3300026187|Ga0209929_1014294 | Not Available | 2541 | Open in IMG/M |
| 3300029318|Ga0185543_1054791 | Not Available | 840 | Open in IMG/M |
| 3300029448|Ga0183755_1002553 | All Organisms → cellular organisms → Bacteria | 9520 | Open in IMG/M |
| 3300031566|Ga0307378_10809250 | Not Available | 788 | Open in IMG/M |
| 3300031673|Ga0307377_10400226 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1020 | Open in IMG/M |
| 3300033742|Ga0314858_024164 | Not Available | 1360 | Open in IMG/M |
| 3300033742|Ga0314858_031662 | unclassified Hyphomonas → Hyphomonas sp. | 1223 | Open in IMG/M |
| 3300034374|Ga0348335_005613 | All Organisms → cellular organisms → Bacteria | 7737 | Open in IMG/M |
| 3300034374|Ga0348335_041152 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1889 | Open in IMG/M |
| 3300034374|Ga0348335_100667 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 910 | Open in IMG/M |
| 3300034375|Ga0348336_051376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1694 | Open in IMG/M |
| 3300034418|Ga0348337_044680 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1854 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 33.96% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 22.64% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.66% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.77% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.14% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.14% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 3.14% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.52% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.52% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.89% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.89% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.89% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.89% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.89% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.26% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.26% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.26% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.26% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.63% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.63% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.63% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.63% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.63% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000153 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 135m | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001960 | Marine microbial communities from South of Charleston, South Carolina, USA - GS014 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011129 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02 | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018080 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaG | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022158 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3) | Environmental | Open in IMG/M |
| 3300022843 | Saline water microbial communities from Ace Lake, Antarctica - #5 | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101428911 | 3300000101 | Marine | RVTTDMKWIDIKIKDLRKKINDQSVEDAKKGLLDIAS* |
| DelMOSpr2010_100247871 | 3300000116 | Marine | RVTTDMKWIDIKIKELRTKINDQSVEDAKAGLLDIAS* |
| DelMOSpr2010_101102701 | 3300000116 | Marine | MGQQALEQGRVTTDMKWIDIKIKELRTKINDQSVEDAKAGLLDIAS* |
| DelMOSpr2010_101210993 | 3300000116 | Marine | QQALEQGRVTTDMKWIDIKIKDLKTKINDQSVEDAKAGLYDIAS* |
| DelMOWin2010_1000161115 | 3300000117 | Marine | LESKWANQALEQGRVTTDMKWIDIKIKDLKVKIAEQSVEDAKKGLFDIAS* |
| SI39nov09_135mDRAFT_10225214 | 3300000153 | Marine | RVTTDMKWIDIKIKDLKKKINDQSVEDARLGLLDIAS* |
| JGI24006J15134_100698871 | 3300001450 | Marine | QGRVTTDMKWIDIKIKELRKQINDQSVVDAKQVLNLDIAS* |
| JGI24006J15134_101636742 | 3300001450 | Marine | LESKWAGQALQQGRVTTDMKWIDIKIKELRKQINDQSVVDAKQTLNLDIAS* |
| JGI24004J15324_100174512 | 3300001472 | Marine | LESKWATQALEQGRVTTDMKWIDIKIKEIRVKINDQSVEDARKGLLDIAS* |
| GOS2230_10375423 | 3300001960 | Marine | LESKWANQALSQGRVTTDMKWIDIKIKDLKKQINDQSVEDAKKGLLDIAS* |
| JGI25128J35275_10812782 | 3300002488 | Marine | LESKWASQALTQGRVTTDMKWIDIKIKSLRKKINDQSVEDAKKGLFDIAS* |
| Ga0066224_10634411 | 3300004457 | Marine | LEQGRVTTDMKWIDIKIKEIRVKINDQSVEDARKGLLDIAS* |
| Ga0075474_100368961 | 3300006025 | Aqueous | RVTTDMKWIDIKIKDLKTKINDQSVEDAKAGLYDIAS* |
| Ga0075478_101308644 | 3300006026 | Aqueous | RVTTDMKWIDIKIKDLKKKINDQSVEDAKKGLYDIAS* |
| Ga0075462_102390662 | 3300006027 | Aqueous | QGRVTTDMKWIDIKIKDLKVKIAAQSVEDAKKGLFDIASDEATA* |
| Ga0075461_102453201 | 3300006637 | Aqueous | RVTTDMKWIDIKIKDLKVKINEQSEIDARAGLLDIASDEVKP* |
| Ga0098038_10473623 | 3300006735 | Marine | AQGRVTTDMKWMDIEIKELRTKINDQSVEDAKKGLLDIAS* |
| Ga0098038_11519172 | 3300006735 | Marine | VTPDMKWIDIKIKELRVKINDQSVEDAQKGLLDIAS* |
| Ga0098038_12579062 | 3300006735 | Marine | TPDMKWIDIEIKDLRKKINDQSVEDAQKGLFDIAS* |
| Ga0098037_10058041 | 3300006737 | Marine | VTTDMKWIDIKIKDLKKRINEQSVIDASDGLLINS* |
| Ga0098042_10369342 | 3300006749 | Marine | TPDMKWMDIKIKDLRTKINDQSVEDAKKGLLDIAS* |
| Ga0098042_10455061 | 3300006749 | Marine | RVTPDMKWIDIKIKNLKTKINDQSVEDAQKGLFDIAS* |
| Ga0070749_100172021 | 3300006802 | Aqueous | QGRVTTDMKWIDIKIKDLKKKINDQSVEDAKKGLYDIAS* |
| Ga0070749_101095892 | 3300006802 | Aqueous | GRVTTDMKWIDIKIKDLKTKINDQSVEDAKAGLYDIAS* |
| Ga0070749_103603302 | 3300006802 | Aqueous | LSQGRVTTDMKWIDIEIKDLKIKIIDQSVRDAKLGLLDIAS* |
| Ga0070749_103971721 | 3300006802 | Aqueous | AQGRVTTDMKWIDIKIKELKTKINDQSVEDAKKGLLDIAS* |
| Ga0070749_107048204 | 3300006802 | Aqueous | RVTTDMKWIDIKIKDLKVKINEQSEIDARAGLLDIASDEVKA* |
| Ga0075467_105569272 | 3300006803 | Aqueous | TTDMKWMDIKIKDLRKKINDQSVEDAKKGLLDIAS* |
| Ga0070754_100658921 | 3300006810 | Aqueous | QGRVTTDMKWIDIKIKDLKVKIAEQSVEDAKKGLFDIAS* |
| Ga0070754_102670224 | 3300006810 | Aqueous | PDMKWIDIQIKELKTKINEQSVEDAKMGLYDIAS* |
| Ga0070754_102733292 | 3300006810 | Aqueous | RVTTDMKWIDIKIKELKTKINDQSVEDAKKGLLDIAS* |
| Ga0070754_102902344 | 3300006810 | Aqueous | QQALEQGRVTTDMKWIDIKIKELRTKINDQSVEDAKAGLLDIAS* |
| Ga0070754_102947301 | 3300006810 | Aqueous | MKWIDIKIKDLKVKINEQSEIDARAGLLDIASDEAKV* |
| Ga0075476_102694344 | 3300006867 | Aqueous | VTTDMKWIDIKIKDLKVKINEQSEIDARAGLLDIASDEVKA* |
| Ga0075476_102856622 | 3300006867 | Aqueous | ALEQGRVTTDMKWIDIKIKDLKTKINDQSVEDAKAGLYDIAS* |
| Ga0075477_100368204 | 3300006869 | Aqueous | IDIKIKDLKVKINEQSEIDARAGLLDIASDEVKP* |
| Ga0075479_100920894 | 3300006870 | Aqueous | MKWIDIKIKDLKVKINEQSEIDARAGLLDIASDEVKP* |
| Ga0070750_102901692 | 3300006916 | Aqueous | TDMKWMDIEIKELRTKINDQSVEDAKKGLLDIAS* |
| Ga0070750_102950413 | 3300006916 | Aqueous | TTDMKWIDIEIKDLKIKIMDQSVRDAKLGLLDIAS* |
| Ga0070750_104303951 | 3300006916 | Aqueous | TDMKWIDIKIKELKTKINDQSVEDAKKGLLDIAS* |
| Ga0070746_103303062 | 3300006919 | Aqueous | TPDMKWIDIEIKDLRKKINDQSVEDAKLGLLDIAS* |
| Ga0070746_103758381 | 3300006919 | Aqueous | VTTDMKWIDIKIKDLKTKINDQSVEDAKLGLYDIAG* |
| Ga0070748_13721091 | 3300006920 | Aqueous | TTDMKWIDIKIKDLKVKIAEQSVEDAKKGLFDIAS* |
| Ga0098060_11714753 | 3300006921 | Marine | WIDIKIKNIRVKINEQSEIDARLGLLDIDKDEEKTDT* |
| Ga0098050_11174921 | 3300006925 | Marine | KWATQALSQGRVTTDMKWIDIKIKEIRNKINDQSVEDAKKGLLDIAS* |
| Ga0098041_11383703 | 3300006928 | Marine | MKWIDIKIKNIRVKINEQSEIDARLGLLDIDKDEEKTDT* |
| Ga0075460_100443202 | 3300007234 | Aqueous | LEQGRVTTDMKWIDIRIKDLKTKINDQSVEDAKLGLYDIAG* |
| Ga0075460_100719681 | 3300007234 | Aqueous | TTDMKWIDIKIKELRNKINDQSVEDAKKGLFDIAS* |
| Ga0075460_101193781 | 3300007234 | Aqueous | VTTDMKWIDIKIKDLKTKINDQSVEDAKAGLYDIAS* |
| Ga0070747_11730063 | 3300007276 | Aqueous | MKWIDIKIKDLKVKINEQSEIDARAGLLDIASDEVKA* |
| Ga0070745_10011517 | 3300007344 | Aqueous | VTTDMKWMDIKIKDLRKKINDQSVEDAKKGLLDVAS* |
| Ga0070745_11731353 | 3300007344 | Aqueous | MKWIDIKIKDLKVKIAAQSVEDAKKGLFDIASDEATA* |
| Ga0070753_10910881 | 3300007346 | Aqueous | AQQALEQGRVTTDMKWIDIKIKDLKTKINDQSVEDAKLGLYDIAG* |
| Ga0070753_13465692 | 3300007346 | Aqueous | VTTDMKWIDIKIKDLKKKINDQSVEDAKKGLLDIAS* |
| Ga0099849_10190355 | 3300007539 | Aqueous | VTTDMKWIDIKIKELRKKINDQSVEDAKAGLLDIAS* |
| Ga0099849_10274414 | 3300007539 | Aqueous | RVTTDMKWIDIKIKDLKVKINEQSEIDARAGLLDIASDEVTA* |
| Ga0099849_11224122 | 3300007539 | Aqueous | LEQGRVTTDMKWIDIKIKELRTKINDQSVEDAKAGLLDIAS* |
| Ga0099849_11595553 | 3300007539 | Aqueous | TTDMKWIDIKIKDLKVKINEQSEIDARAGLLDIASDEVKA* |
| Ga0099847_11728631 | 3300007540 | Aqueous | QALEQGRVTTDMKWIDIKIKELRTKINDQSVEDAKKGLLDIAS* |
| Ga0099847_12384691 | 3300007540 | Aqueous | MKWIDIKIKELKNKINDQSVEDAKRGLFDIASDEVRA* |
| Ga0099848_12783562 | 3300007541 | Aqueous | MKWIDIKIKDLKVKINEQSEIDARAGLLDIASDEVTA* |
| Ga0102954_10034254 | 3300007778 | Water | MKWIDIKIKDLKVKIAAQSVEDAKKGLFDIASDEVQA* |
| Ga0110931_10149193 | 3300007963 | Marine | VTTDMKWIDIKIKNLRVKINEQSEIDARLGLLDVDKDEDKTDT* |
| Ga0110931_12612421 | 3300007963 | Marine | VTPDMKWMDIKIKDLRTKINDQSVEDAKKGLLDIAS* |
| Ga0102963_11282121 | 3300009001 | Pond Water | TTDMKWIDIKIKDLKVKIAEQSVEDAKKGLYDIAS* |
| Ga0102963_11579971 | 3300009001 | Pond Water | TTDMKWIDIKIKELKTKINDQSVEDAKKGLLDIAS* |
| Ga0115566_101248442 | 3300009071 | Pelagic Marine | VTTDMKWMDIEIKELKTKINDQSVEDAKKGLLDIAS* |
| Ga0115550_11506073 | 3300009076 | Pelagic Marine | ESKWAGQALQQGRVTTDMKWIDIKIKDLKKQINDQSVVDASAGLYDIAG* |
| Ga0118687_102254841 | 3300009124 | Sediment | MKWIDIKIKDLKVKIANQSVEDAKKGLFDIDSDEVK |
| Ga0114918_100910343 | 3300009149 | Deep Subsurface | LEQGRVTTDMKWIDIKIKDLKTKINDQSVEDAKLGLYDIAG* |
| Ga0115545_10133002 | 3300009433 | Pelagic Marine | VTTDMKWIDIKIKDLRKKINDQSVEDAKKGLLDVAS* |
| Ga0115555_14504861 | 3300009476 | Pelagic Marine | GRVTTDMKLIDIKIKEIRVKINDQSVEDAKKGLLDIAS* |
| Ga0114932_100652883 | 3300009481 | Deep Subsurface | MKWIDIKIKNIRVKINEQSEIDARAGLLDIDKDEEKTET* |
| Ga0114919_109076712 | 3300009529 | Deep Subsurface | MKWIDIKIKDLKVKIANQSVEDAKKGLFDIASDEIKV* |
| Ga0098043_10889912 | 3300010148 | Marine | MKWIDIKIKRLRVKINEQSEIDAKAGLLDIDKDEEKTDT* |
| Ga0098043_11372411 | 3300010148 | Marine | MKWIDIKIKNIRVKINEQSEIDARAGLLDVDKDEDKTDT* |
| Ga0098049_10273385 | 3300010149 | Marine | MKWIDIKIKNIKVKINEQSEIDARLGLLDIDKDEEKTDT* |
| Ga0098056_10872804 | 3300010150 | Marine | MKWIDIKIKNLRVKINEQSEIDAKAGLLDIDKDEEKTDT* |
| Ga0098059_100370410 | 3300010153 | Marine | MKWIDIKIKNLRVKINEQSEIDARLGLLDVDKDEDKTDT* |
| Ga0129342_10260941 | 3300010299 | Freshwater To Marine Saline Gradient | ALEQGRVTTDMKWIDIKIKDLKKKINDQSVEDAKAGLLDIAS* |
| Ga0129351_11409461 | 3300010300 | Freshwater To Marine Saline Gradient | VTTDMKWIDIKIKELRNKINDQSVEDAKKGLFDIAS* |
| Ga0129336_105758083 | 3300010370 | Freshwater To Marine Saline Gradient | GRVTTDMKWIDIKIKELRNKINDQSVEDAKRGLFDIASDEVRA* |
| Ga0151672_1251261 | 3300011129 | Marine | MKWIDIKIKELKVKINDQSVKDAQKGLLDIARSEE |
| Ga0151671_10059577 | 3300011253 | Marine | VTTDMKWMDIKIKDLRKKINDQSVEDAKKGLLDIAS* |
| Ga0129352_101940782 | 3300012528 | Aqueous | GQALQQGSVTTNMKWIDLKIKVLKKRINEQSVVDASAGLLDNS* |
| Ga0160423_100172893 | 3300012920 | Surface Seawater | MKWIDIKIKRLRVKINEQSEIDAKAGLLDIDKDEEKIET* |
| Ga0160423_105354532 | 3300012920 | Surface Seawater | MKWIDIKIKRLRVKINEQSEIDAKAGLLDIDKDEEQTDT* |
| Ga0180120_100683281 | 3300017697 | Freshwater To Marine Saline Gradient | TTDMKWIDIKIKDLKKKINDQSVEDAKKGLYDIAS |
| Ga0181369_10576683 | 3300017708 | Marine | MKWIDIKIKNLRVKINEQSEIDARLGLLDVDKDEDKTDT |
| Ga0181369_10838321 | 3300017708 | Marine | KALQHGLVTPDMQCVVLKIKNLRTKINDQSVEDAKKGLYDIAC |
| Ga0181387_10498244 | 3300017709 | Seawater | VTTDMKWIDIKIKELKVKINDQSVKDAQNGLLDIA |
| Ga0181401_11277382 | 3300017727 | Seawater | KWIDIKIKNIRVKINEQSEIDARAGLLDVDKDEDKTDT |
| Ga0181392_11688301 | 3300017749 | Seawater | QALQQGRVTTDMKWIDIKIKELRKQINDQSVVDAKQTLNLDIAS |
| Ga0187219_10053327 | 3300017751 | Seawater | VTTDMKWMDIKIKDLRKKINDQSVEDAKKGLLDIAS |
| Ga0181400_11919301 | 3300017752 | Seawater | DMKWIDIKIKNIRVKINEQSEIDARAGLLDVDKDEDKTDT |
| Ga0181407_11096094 | 3300017753 | Seawater | TDMKWIDIKIKELRKQINDQSVVDAKQTLNLDIAS |
| Ga0181413_12256392 | 3300017765 | Seawater | VTPDMKWIDIEIKDLRKKINDQSVEDAKLGLLDIAS |
| Ga0180437_101754904 | 3300017963 | Hypersaline Lake Sediment | MKWIDIKIKDLKVKIAAQSVEDAKKGLFDIASDEATA |
| Ga0180437_107107361 | 3300017963 | Hypersaline Lake Sediment | RVTTDMKWIDIKIKDLKVKIAAQSVEDAKKGLFDIASDEVQA |
| Ga0180438_106911113 | 3300017971 | Hypersaline Lake Sediment | MKWIDIKIKDLKVKIAAQSVEDAKKGLFDIASDEVQA |
| Ga0180432_111856791 | 3300017989 | Hypersaline Lake Sediment | RVTTDMKWIDIKIKDLKKKINDQSVEDAKAGLLDIAS |
| Ga0181572_108501402 | 3300018049 | Salt Marsh | QGRVTTDMKWIDIKIKELKTKINDQSVEDAKKGLLDIAS |
| Ga0180433_100498074 | 3300018080 | Hypersaline Lake Sediment | VTTDMKWIDIKIKDLKKKINDQSVEDAKKGLLDIAS |
| Ga0181553_105357961 | 3300018416 | Salt Marsh | DIKIKRLRVKINEQSEIDAKAGLLDIDKDEEQTDT |
| Ga0181563_104724631 | 3300018420 | Salt Marsh | MKWIDIKIKDLKVKINEQSEIDARAGLLDIASDEVKV |
| Ga0194029_10181201 | 3300019751 | Freshwater | LEQGRVTTDMKWIDIRIKDLKTKINDQSVEDAKLGLYDIAG |
| Ga0194023_10032514 | 3300019756 | Freshwater | MKWIDIKIKDLKVKINEQSEIDARAGLLDIASDEVKP |
| Ga0194023_10522812 | 3300019756 | Freshwater | GRVTTDMKWIDIKIKELKTKINDQSVEDAKKGLLDIAS |
| Ga0211521_102697841 | 3300020428 | Marine | VTTDMKWIDIKIKNIRVKINEQSEIDARAGLLDIDKDEEKTET |
| Ga0213858_102786364 | 3300021356 | Seawater | MKWIDIKIKDLKVKINEQSEIDARAGLLDIASDEVKA |
| Ga0213859_100848802 | 3300021364 | Seawater | AQGRVTTDMKWIDIKIKELKTKINDQSVEDAKKGLLDIAS |
| Ga0213868_105914881 | 3300021389 | Seawater | AQGRVTTDMKWIDIKIKDLKKKINDQSVEDAKKGLYDIAS |
| Ga0222717_101556571 | 3300021957 | Estuarine Water | QGRVTTDMKWIDIKIKDLKKKINDQSVEDAKKGLLDIAS |
| Ga0222718_100307362 | 3300021958 | Estuarine Water | LEQGRVTTDMKWIDIKIKDLKTKINDQSVEDAKLGLYDIAG |
| Ga0222718_104674581 | 3300021958 | Estuarine Water | LQQGRVTTDMKWIDIKIKDLKVKIAEQSVEDAKKGLYDIAS |
| Ga0222716_100804971 | 3300021959 | Estuarine Water | RVTTDMKWIDIKIKDLKKKINDQSVEDAKKGLYDIAS |
| Ga0222713_103681773 | 3300021962 | Estuarine Water | VTTDMKWMDIKIKDLRKKINDQSVEDAKKGLLDVAS |
| Ga0222719_105681251 | 3300021964 | Estuarine Water | QGRVTTDMKWIDIKIKDLKVKIAEQSVEDAKKGLYDIAS |
| Ga0196883_10065981 | 3300022050 | Aqueous | FTTDMKWIDIKIKDLKVKIAQQSVEDAKKGLFDIAS |
| Ga0212030_10341041 | 3300022053 | Aqueous | EQGRVTTDMKWIDIKIKDLKTKINDQSVEDAKAGLYDIAS |
| Ga0212021_11122481 | 3300022068 | Aqueous | VTTDMKWIDIKIKELKTKINDQSVEDAKKGLLDIAS |
| Ga0224906_10315702 | 3300022074 | Seawater | VTTDMKWIDIKIKNIRVKINEQSEIDARAGLLDVDKDEDKTDT |
| Ga0224906_11072324 | 3300022074 | Seawater | GRVTTDMKWIDIKIKELRKQINDQSVVDAKQVLNLDIAS |
| Ga0196897_10097101 | 3300022158 | Aqueous | LEQGRVTTDMKWIDIRIKDLKTKINDQSVEDAKLGLYDIAR |
| Ga0222631_10062754 | 3300022843 | Saline Water | QGRVTTEMKWIDIQIKDLKVKINNQSVEDARKGLLDIAS |
| Ga0255752_103582331 | 3300022929 | Salt Marsh | ALQQGRVTTDMKWMDIKIKDLKKKINDQSVEDAKKGLLDIAS |
| Ga0209986_102027434 | 3300024433 | Deep Subsurface | MKWIDIKIKDLKVKINEQSEIDARAGLLDIASDEVQA |
| Ga0208667_10018229 | 3300025070 | Marine | TPDMKWIDIEIKDLRKKINDQSVEDAQKGLFDIAS |
| Ga0207890_10202132 | 3300025079 | Marine | LESKWATQALSQGRVTTDMKWIDIKIKDLRTKINDQSVEDAKKGLLDIAS |
| Ga0208157_10574933 | 3300025086 | Marine | TPDMKWIDIKIKNLRTKINDQSVEDAQKGLFDIAS |
| Ga0208669_11086942 | 3300025099 | Marine | LESKWATQALSQGRVTTDMKWIDIKIKEIRNKINDQSVEDAKKGLLDIAS |
| Ga0208159_10480892 | 3300025101 | Marine | VTTDMKWMDIEIKELRTKINDQSVEDAKKGLLDIAS |
| Ga0209535_10516182 | 3300025120 | Marine | VTTDMKWMDIKIKELKTKINDQSVEDAKKGLLDIAS |
| Ga0209535_10696393 | 3300025120 | Marine | VTTDMKWIDIKIKELRVKINDQSVEDAKKGLLDIAS |
| Ga0209535_10754762 | 3300025120 | Marine | MKWIDIKIKNIRVKINEQSEIDARAGLLDVDKDEDKTDT |
| Ga0209348_10118588 | 3300025127 | Marine | MKWIDIKIKRLRVKINEQSEIDAKAGLLDIDKDEEKIET |
| Ga0209634_10506971 | 3300025138 | Marine | LESKWAGQALQQGRVTTDMKWIDIKIKELRKQINDQSVVDAKQTINFNIAS |
| Ga0209645_11480071 | 3300025151 | Marine | DIKIKRLRVKINEQSEIDAKAGLLDIDKDEEKIDT |
| Ga0209645_11480081 | 3300025151 | Marine | DIKIKRLRVKINEQSEIDAKAGLLDIDKDEEKTDT |
| Ga0209337_100792121 | 3300025168 | Marine | LESKWATQALSQGRVTTDMKWIDIEIKNLRKKINDQSVEDAKKGLLDI |
| Ga0209337_10754621 | 3300025168 | Marine | TQALSQGRVTTDMKWIDIEIKNLRKKINDQSVEDAKKGLLDIAS |
| Ga0208303_10088384 | 3300025543 | Aqueous | MKWIDIKIKELKNKINDQSVEDAKRGLFDIASDEVRA |
| Ga0209195_10163221 | 3300025590 | Pelagic Marine | VTTDMKWMDIEIKELKTKINDQSVEDAKKGLLDIAS |
| Ga0208160_11152731 | 3300025647 | Aqueous | QGRVTTDMKWIDIKIKDLKKKINDQSVEDAKKGLYDIAS |
| Ga0208899_10537303 | 3300025759 | Aqueous | QGRVTTDMKWIDIKIKDLKTKINDQSVEDAKAGLYDIAS |
| Ga0208767_10606681 | 3300025769 | Aqueous | VTTDMKWIDIKIKDLKTKINDQSVEDAKAGLYDIAS |
| Ga0209425_100590571 | 3300025897 | Pelagic Marine | SKWAGQALQQGRVTTDMKWIDIKIKDLKKQINDQSVVDASAGLYDIAG |
| Ga0209929_10142941 | 3300026187 | Pond Water | TTDMKWIDIKIKDLKVKIAEQSVEDAKKGLYDIAS |
| Ga0185543_10547911 | 3300029318 | Marine | TPDMKWMDIKIKDLRTKINDQSVEDAKKGLYDIAS |
| Ga0183755_100255311 | 3300029448 | Marine | MKWIDIKIKNIRVKINEQSEIDARAGLLDIDKDEEKTET |
| Ga0307378_108092501 | 3300031566 | Soil | GRVTTDMKWIDIKIKELRTKINDQSVEDAKAGLLDIAS |
| Ga0307377_104002261 | 3300031673 | Soil | QGRVTTDMKWIDIKIKDLKTKINDQSVEDAKLGLYDIAG |
| Ga0314858_024164_996_1106 | 3300033742 | Sea-Ice Brine | VTTDMKWIDIKIKNLRTAINNQSVEDAKKGLLDIAS |
| Ga0314858_031662_1101_1223 | 3300033742 | Sea-Ice Brine | AQGRVTTDMKWIDIKIKEIRVKINDQSVEDAKKGLLDIAS |
| Ga0348335_005613_3453_3578 | 3300034374 | Aqueous | LEQGRVTTDMKWIDIKIKELRNKINDQSVEDARKGLLDIAS |
| Ga0348335_041152_1_147 | 3300034374 | Aqueous | SKWANQALEQGRVTTDMKWIDIKIKDLKVKIAEQSVEDAKKGLFDIAS |
| Ga0348335_100667_2_109 | 3300034374 | Aqueous | TTDMKWIDIKIKDLKTKINDQSVEDAKAGLYDIAS |
| Ga0348336_051376_3_131 | 3300034375 | Aqueous | ALEQGRVTTDMKWIDIKIKDLKTKINDQSVEDAKAGLYDIAS |
| Ga0348337_044680_31_183 | 3300034418 | Aqueous | LESKWANQALEQGRVTTDMKWIDIKIKDLKVKIAEQSVEDAKKGLFDIAS |
| ⦗Top⦘ |