


| Basic Information | |
|---|---|
| Family ID | F041949 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AADSPLLAEFSRLHRISVSLESGVLLAGLAAMYLMVRELGAGR |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.57 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.679 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (34.591 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.704 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.057 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF00730 | HhH-GPD | 20.13 |
| PF03965 | Penicillinase_R | 2.52 |
| PF01926 | MMR_HSR1 | 2.52 |
| PF01794 | Ferric_reduct | 1.89 |
| PF02371 | Transposase_20 | 1.26 |
| PF02687 | FtsX | 0.63 |
| PF12697 | Abhydrolase_6 | 0.63 |
| PF02535 | Zip | 0.63 |
| PF02518 | HATPase_c | 0.63 |
| PF02381 | MraZ | 0.63 |
| PF05598 | DUF772 | 0.63 |
| PF00578 | AhpC-TSA | 0.63 |
| PF00440 | TetR_N | 0.63 |
| PF01850 | PIN | 0.63 |
| PF12840 | HTH_20 | 0.63 |
| PF01933 | CofD | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 20.13 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 20.13 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 20.13 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 20.13 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 20.13 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.52 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 2.52 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.26 |
| COG0391 | Archaeal 2-phospho-L-lactate transferase/Bacterial gluconeogenesis factor, CofD/UPF0052 family | Carbohydrate transport and metabolism [G] | 0.63 |
| COG0428 | Zinc transporter ZupT | Inorganic ion transport and metabolism [P] | 0.63 |
| COG2001 | MraZ, DNA-binding transcriptional regulator and inhibitor of RsmH methyltransferase activity | Translation, ribosomal structure and biogenesis [J] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.68 % |
| Unclassified | root | N/A | 11.32 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001167|JGI12673J13574_1002671 | Not Available | 1006 | Open in IMG/M |
| 3300002914|JGI25617J43924_10141203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300005167|Ga0066672_10450960 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300005178|Ga0066688_10923657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300005179|Ga0066684_10203533 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300005180|Ga0066685_10798153 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005181|Ga0066678_10505182 | Not Available | 804 | Open in IMG/M |
| 3300005447|Ga0066689_10083555 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
| 3300005540|Ga0066697_10599068 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005542|Ga0070732_10934856 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005554|Ga0066661_10403111 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300005559|Ga0066700_11136208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300005560|Ga0066670_10363948 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300005576|Ga0066708_10461767 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300005576|Ga0066708_10679176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300005587|Ga0066654_10588105 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005921|Ga0070766_10597699 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300006046|Ga0066652_100185522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1778 | Open in IMG/M |
| 3300006162|Ga0075030_100430746 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300006173|Ga0070716_101288175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300006797|Ga0066659_10054316 | All Organisms → cellular organisms → Bacteria | 2544 | Open in IMG/M |
| 3300006800|Ga0066660_10019640 | All Organisms → cellular organisms → Bacteria | 3922 | Open in IMG/M |
| 3300006804|Ga0079221_10721671 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300006806|Ga0079220_10628874 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300006871|Ga0075434_100555314 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300007258|Ga0099793_10005032 | All Organisms → cellular organisms → Bacteria | 4745 | Open in IMG/M |
| 3300007258|Ga0099793_10013988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3181 | Open in IMG/M |
| 3300007258|Ga0099793_10158335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1075 | Open in IMG/M |
| 3300007258|Ga0099793_10232379 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300007258|Ga0099793_10513489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300007265|Ga0099794_10036306 | All Organisms → cellular organisms → Bacteria | 2329 | Open in IMG/M |
| 3300009038|Ga0099829_10887587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300009038|Ga0099829_11099549 | Not Available | 659 | Open in IMG/M |
| 3300009088|Ga0099830_10308924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium | 1264 | Open in IMG/M |
| 3300009088|Ga0099830_11117490 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300009088|Ga0099830_11399061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300009088|Ga0099830_11424539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300009162|Ga0075423_12223993 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300009176|Ga0105242_11718558 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300009545|Ga0105237_12013606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300010321|Ga0134067_10059528 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300010329|Ga0134111_10241272 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300010343|Ga0074044_10577627 | Not Available | 734 | Open in IMG/M |
| 3300010359|Ga0126376_11762618 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300010359|Ga0126376_12722255 | Not Available | 544 | Open in IMG/M |
| 3300010359|Ga0126376_12834510 | Not Available | 534 | Open in IMG/M |
| 3300010364|Ga0134066_10007385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2109 | Open in IMG/M |
| 3300010376|Ga0126381_102376082 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 761 | Open in IMG/M |
| 3300010396|Ga0134126_12964263 | Not Available | 513 | Open in IMG/M |
| 3300010880|Ga0126350_10856667 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300011269|Ga0137392_11481687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300011270|Ga0137391_10646362 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300011271|Ga0137393_10798123 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300012096|Ga0137389_10408561 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300012189|Ga0137388_10938002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
| 3300012199|Ga0137383_11297162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300012202|Ga0137363_10313602 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300012202|Ga0137363_10320932 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300012202|Ga0137363_10909074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300012202|Ga0137363_11094316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300012203|Ga0137399_11181308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300012205|Ga0137362_10705722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300012205|Ga0137362_10895588 | Not Available | 758 | Open in IMG/M |
| 3300012208|Ga0137376_11771450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300012210|Ga0137378_10846398 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300012357|Ga0137384_10249949 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300012357|Ga0137384_11572532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300012361|Ga0137360_10797548 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300012361|Ga0137360_11791799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300012363|Ga0137390_10901148 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300012363|Ga0137390_11183972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
| 3300012582|Ga0137358_10397327 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300012683|Ga0137398_10847358 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300012917|Ga0137395_10453461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 921 | Open in IMG/M |
| 3300012918|Ga0137396_10350886 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300012922|Ga0137394_11278361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300012924|Ga0137413_11797074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300012925|Ga0137419_11045770 | Not Available | 678 | Open in IMG/M |
| 3300012925|Ga0137419_11049234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300012929|Ga0137404_12019606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300012930|Ga0137407_11704664 | Not Available | 600 | Open in IMG/M |
| 3300012960|Ga0164301_11343633 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300012971|Ga0126369_10768419 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300012971|Ga0126369_13152507 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300012976|Ga0134076_10497524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300012977|Ga0134087_10691376 | Not Available | 540 | Open in IMG/M |
| 3300013306|Ga0163162_11791544 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300014166|Ga0134079_10663926 | Not Available | 527 | Open in IMG/M |
| 3300015052|Ga0137411_1073654 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300015053|Ga0137405_1097603 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300015053|Ga0137405_1119390 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300015241|Ga0137418_10592992 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300015264|Ga0137403_10699855 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber | 873 | Open in IMG/M |
| 3300017823|Ga0187818_10045643 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
| 3300017930|Ga0187825_10309650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300019789|Ga0137408_1475357 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300020580|Ga0210403_10391477 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300020580|Ga0210403_10901678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300020581|Ga0210399_11569273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300020582|Ga0210395_11183980 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300021086|Ga0179596_10474769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300021088|Ga0210404_10010485 | All Organisms → cellular organisms → Bacteria | 3790 | Open in IMG/M |
| 3300021168|Ga0210406_10981419 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300021170|Ga0210400_10998758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300021170|Ga0210400_11240666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300021171|Ga0210405_10057304 | All Organisms → cellular organisms → Bacteria | 3078 | Open in IMG/M |
| 3300021178|Ga0210408_10807699 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300021401|Ga0210393_10101559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2290 | Open in IMG/M |
| 3300021407|Ga0210383_10158168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1928 | Open in IMG/M |
| 3300021420|Ga0210394_10011899 | All Organisms → cellular organisms → Bacteria | 8501 | Open in IMG/M |
| 3300021432|Ga0210384_10899701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
| 3300021474|Ga0210390_10382902 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300021474|Ga0210390_11498206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300021559|Ga0210409_10612621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300021560|Ga0126371_11778384 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300022840|Ga0224549_1017132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1014 | Open in IMG/M |
| 3300024179|Ga0247695_1019574 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300024287|Ga0247690_1045855 | Not Available | 518 | Open in IMG/M |
| 3300025320|Ga0209171_10345581 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300025941|Ga0207711_10861091 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300026301|Ga0209238_1157722 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300026307|Ga0209469_1144832 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300026312|Ga0209153_1164481 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300026548|Ga0209161_10275412 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300026551|Ga0209648_10592327 | Not Available | 612 | Open in IMG/M |
| 3300027095|Ga0208606_107579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300027109|Ga0208603_1067557 | Not Available | 533 | Open in IMG/M |
| 3300027603|Ga0209331_1084614 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300027655|Ga0209388_1153028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300027655|Ga0209388_1209943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300027671|Ga0209588_1191543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300027674|Ga0209118_1135105 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300027674|Ga0209118_1149431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300027765|Ga0209073_10267821 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300027767|Ga0209655_10245358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300027773|Ga0209810_1039088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2655 | Open in IMG/M |
| 3300027795|Ga0209139_10026519 | All Organisms → cellular organisms → Bacteria | 2068 | Open in IMG/M |
| 3300027875|Ga0209283_10031940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3290 | Open in IMG/M |
| 3300027875|Ga0209283_10891575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300027898|Ga0209067_10626310 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300028138|Ga0247684_1023943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum | 965 | Open in IMG/M |
| 3300028138|Ga0247684_1050414 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300028906|Ga0308309_11454244 | Not Available | 586 | Open in IMG/M |
| 3300030013|Ga0302178_10143979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1187 | Open in IMG/M |
| 3300030580|Ga0311355_10898545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
| 3300030813|Ga0265750_1000425 | All Organisms → cellular organisms → Bacteria | 3435 | Open in IMG/M |
| 3300030991|Ga0073994_10047988 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300031057|Ga0170834_100586202 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031090|Ga0265760_10336621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300031753|Ga0307477_10152466 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300031754|Ga0307475_11168285 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300031820|Ga0307473_10706593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300031945|Ga0310913_10971268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300031962|Ga0307479_11804379 | Not Available | 563 | Open in IMG/M |
| 3300032076|Ga0306924_11154165 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300032180|Ga0307471_100001776 | All Organisms → cellular organisms → Bacteria | 12072 | Open in IMG/M |
| 3300032180|Ga0307471_101336079 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300032180|Ga0307471_102663525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300032892|Ga0335081_10423012 | Not Available | 1704 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 34.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.40% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.89% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.89% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.26% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.26% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.26% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.26% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.26% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.26% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.63% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.63% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.63% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.63% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001167 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027095 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF020 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12673J13574_10026712 | 3300001167 | Forest Soil | QATNADNPLLSEFSRLHSISVSLESVVLLAGVAAMFSLVREAA* |
| JGI25617J43924_101412031 | 3300002914 | Grasslands Soil | QAAAADSPLLAEFGRLHRISVSLESGVLLAGLAAIYLMVKDLSAVGK* |
| Ga0066672_104509602 | 3300005167 | Soil | NPLLSEFSKLHRVSVMLESGVLLAGLAATYLLVRESALAR* |
| Ga0066688_109236571 | 3300005178 | Soil | PLLVEFGKLHRISVSLESGVLLAGLAGMYLMVKELTVAGH* |
| Ga0066684_102035331 | 3300005179 | Soil | GSIQATAADSPLLAAFARLHAISVSMESAVLLAGLAAIYLLVRELALKIS* |
| Ga0066685_107981532 | 3300005180 | Soil | DNPLLVEFGKLHRISVSLESGVLLAGFACIYLMVKELVTVG* |
| Ga0066678_105051822 | 3300005181 | Soil | LLAEFGRLHQISVSLESGVLLAGMACMFLMVRESFRAGN* |
| Ga0066689_100835552 | 3300005447 | Soil | DSPLLAEFSRLHRISVSLESGVLLAGMAAMYLMVKDLVAIGK* |
| Ga0066697_105990681 | 3300005540 | Soil | MLAEFSRLHRISVSLESGVLLAGIAAMYLMARELTTWT* |
| Ga0070732_109348561 | 3300005542 | Surface Soil | LLAEFNRLHRMSVMLESGVLLAGFAAMFLMVKELGTGH* |
| Ga0066661_104031112 | 3300005554 | Soil | ATAADSPLLVEFGKLHRISVSLESGVLLAGLAGMYLMVKELTVAGH* |
| Ga0066700_111362081 | 3300005559 | Soil | PLLVEFGKLHRISVSLESGVLLAGLACIYLMVKELVTVG* |
| Ga0066670_103639481 | 3300005560 | Soil | AADSPMLLEFGRLHRISVSLESGVLLAGIAAMYLMVRELAFRSS* |
| Ga0066708_104617671 | 3300005576 | Soil | LLAEFSRLHRASVSLESGVLLAGLAAMYLMAKDLGAGH* |
| Ga0066708_106791762 | 3300005576 | Soil | EFSKLHRISVSLESGVLLAGLAGMYLVVKELVSVGSKF* |
| Ga0066654_105881052 | 3300005587 | Soil | TAADSSLLAEFSRLHGISVSLESGVLLAGIAAMYLMVRELALKPS* |
| Ga0070766_105976991 | 3300005921 | Soil | ADSPLLAEFSRLHRISVSLESGVLLAGIAAMFLMVKELPAVR* |
| Ga0066652_1001855222 | 3300006046 | Soil | GKLHRISVSLESGVLLAGFACIYLMVKELVSMGQ* |
| Ga0075030_1004307461 | 3300006162 | Watersheds | EFSRLHRISVSLESGVLLAGMAAMFLMVRELALRP* |
| Ga0070716_1012881752 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | IEATAEANPLLAEFARLHRLSVSLESGVLLAGLLGMYFMVSELGESR* |
| Ga0066659_100543161 | 3300006797 | Soil | DSPLLAEFSRLHRISVSLESGVLLAGLAAMYLMVKDLGAIGK* |
| Ga0066660_100196401 | 3300006800 | Soil | IQATAADSPLLAAFARLHAISVSMESAVLLAGLAAIYLLVRELALKIS* |
| Ga0079221_107216712 | 3300006804 | Agricultural Soil | PLLAEFGKLHRVSVSLESGVLLAGIAAVYFLVREITAG* |
| Ga0079220_106288742 | 3300006806 | Agricultural Soil | EFTRLHAISVSLESGVLLAGIAAIYLMARELAIRPS* |
| Ga0075434_1005553141 | 3300006871 | Populus Rhizosphere | SAADSPYLAEFSRLHHFSVALETGVLLAGLAALYLLVRETCLKA* |
| Ga0099793_100050321 | 3300007258 | Vadose Zone Soil | ARVADSPLLAEFGRLHRISVSLESGVLLAGLVVLYLMVKE* |
| Ga0099793_100139881 | 3300007258 | Vadose Zone Soil | LQAAAADSPLLAEFSRLHRISVSLESGVLLAGLVAVYLMVRELAAGQ* |
| Ga0099793_101583351 | 3300007258 | Vadose Zone Soil | ARVADSPLLAEFGRLHRISVSLESGVLLAGLVVLYLMVKESGVGS* |
| Ga0099793_102323792 | 3300007258 | Vadose Zone Soil | FSRLHRASVSLESGVLLAGLAAIYLMAKDLGAGH* |
| Ga0099793_105134891 | 3300007258 | Vadose Zone Soil | ATAADSPLLAEFSRFHRISVSLESGVLLAGFVAMYLMVKELGTIGK* |
| Ga0099794_100363061 | 3300007265 | Vadose Zone Soil | LLAEFRRLHQISVSLESGVLVAGFAALFLLVREVGVGR* |
| Ga0099829_108875871 | 3300009038 | Vadose Zone Soil | SPLLEEFRGLHRVSVTLESGVLLAGLVAMYLMVRELTSSH* |
| Ga0099829_110995492 | 3300009038 | Vadose Zone Soil | PLLAEFGRLHSISVSLESGVLLAGLVVLYLMVKESGVGS* |
| Ga0099830_103089244 | 3300009088 | Vadose Zone Soil | IQAFQATAADSPLLAEFSRLHRISVSLESGVLLAGMAAMYLMVKELGAIGK* |
| Ga0099830_111174902 | 3300009088 | Vadose Zone Soil | ADSPLLAEFSRLHRISVSLESGVLLAGLVAIYLMMKELAAGQ* |
| Ga0099830_113990611 | 3300009088 | Vadose Zone Soil | IQATAADSPLLAEFGRLHRISASLEGGVILAGLAALYLMAKDSGVGN* |
| Ga0099830_114245391 | 3300009088 | Vadose Zone Soil | QATAADSPLRAEFARLHRVSVSLESGVLMAGLVAMYLMVKDLAL* |
| Ga0075423_122239931 | 3300009162 | Populus Rhizosphere | EATAAASPLLAEFSRWHRFSVGLESGVLLAGLLAWYCLVRESAR* |
| Ga0105242_117185582 | 3300009176 | Miscanthus Rhizosphere | TAEANPLLAEFARLHRLSVSLESGVLLAGLLGMYFMVSELGESR* |
| Ga0105237_120136062 | 3300009545 | Corn Rhizosphere | EANPLLAEFARLHRLSVSLESGVLLAGLLGMYFMVSELGESR* |
| Ga0134067_100595283 | 3300010321 | Grasslands Soil | LAEFSRLHRASVSLESGVLLAGLAAMYLMAKDLGAGH* |
| Ga0134111_102412721 | 3300010329 | Grasslands Soil | MGSIQATAADSPMLLEFGRLHRISVSLESGVLLAGIAAMYLMVRELAFRSS* |
| Ga0074044_105776271 | 3300010343 | Bog Forest Soil | IQATGADSPLLAEFGRLHTISVSLESGVLLAGFAAMYLMVRELMAGR* |
| Ga0126376_117626181 | 3300010359 | Tropical Forest Soil | AADSPLLAEFGKLHQISVSLESGVLLAGIACMYLMVRELARG* |
| Ga0126376_127222551 | 3300010359 | Tropical Forest Soil | KFARLHRISVSLESGVLLAGFGALYLTVKDLASQP* |
| Ga0126376_128345102 | 3300010359 | Tropical Forest Soil | AEFGRLHQISVSLESGVLLAGFACIYLMVRELARG* |
| Ga0134066_100073851 | 3300010364 | Grasslands Soil | SIQATVADSPLLAEFSRLHRASVSLESGVLLAGLAAMYLMAKDLGAGH* |
| Ga0126381_1023760821 | 3300010376 | Tropical Forest Soil | PLLAEFSRMHRISVSLESGVLLLGFVAMYLMVRELGAAAK* |
| Ga0134126_129642632 | 3300010396 | Terrestrial Soil | FGRLHRVSVFLESGVLLAGIAAFYFMVREMAGTP* |
| Ga0126350_108566672 | 3300010880 | Boreal Forest Soil | SIQATAADSPLLAEFTRLHSISVSLESVVLLAGITGMFLLVREVARVA* |
| Ga0137392_114816871 | 3300011269 | Vadose Zone Soil | TAADSPLLAAFSRLHRISVSLESGVLLAGLVAMYLMVKDLGAIGK* |
| Ga0137391_106463621 | 3300011270 | Vadose Zone Soil | AADSPLLAEFSRLHRISVSLESGVLLAGFVTMYLMVRELASVGH* |
| Ga0137393_107981231 | 3300011271 | Vadose Zone Soil | MGSIQATAAHSFLLAEFSKLHRISVSLESGVLLAGLAAMYLMVKELGALR* |
| Ga0137389_104085611 | 3300012096 | Vadose Zone Soil | ATAADSPLLAEFSRLHRISVSLESGVLLAGLAAMYLMVKDLGAIGK* |
| Ga0137388_109380021 | 3300012189 | Vadose Zone Soil | ATAEDSPLLAEFSRLHRISVLLESGGLLAGLAAFYFMVRETGVRY* |
| Ga0137383_112971621 | 3300012199 | Vadose Zone Soil | AADSPLLAEFSRLHRISVSLESGVLLAGLVAMYLTVRDLAIAQ* |
| Ga0137363_103136022 | 3300012202 | Vadose Zone Soil | EFSKLHRISVSLESGVLLAGLAAMFLMVRELSSVGR* |
| Ga0137363_103209321 | 3300012202 | Vadose Zone Soil | LAEFSRLHRISVSLESGVLLAGLTAMFLMVKELGAGR* |
| Ga0137363_109090743 | 3300012202 | Vadose Zone Soil | IQATAADSPLLAEFGRLHQISVSLESGVLLAGMACMFLMVRESFRAGN* |
| Ga0137363_110943162 | 3300012202 | Vadose Zone Soil | SPLLAEFGKLHRVSVSLESGVLLAGLACMYLMVKELAAVH* |
| Ga0137399_111813081 | 3300012203 | Vadose Zone Soil | LLAEFSRLHRISVSLESGVLLAGLAALFFMVREAGIAR* |
| Ga0137362_107057221 | 3300012205 | Vadose Zone Soil | TAADSPLLAEFGRLHRISASLEGGVILAGLAALYLMVKDSGVGN* |
| Ga0137362_108955882 | 3300012205 | Vadose Zone Soil | LAEFSRLHRISASLEGGVILAGLAALYLMAKDSGVGS* |
| Ga0137376_117714501 | 3300012208 | Vadose Zone Soil | AADSPLLAEFSRLHRISVSLESGVLLAGLVAMYLTVRDLAISQ* |
| Ga0137378_108463983 | 3300012210 | Vadose Zone Soil | LLAEFGKLHRISVSLESGVLLAGFAAMYLMVRELASAR* |
| Ga0137384_102499491 | 3300012357 | Vadose Zone Soil | PLLAEFGRLHRMSVTLESGVLLAGLAAMYFMVKDLAS* |
| Ga0137384_115725321 | 3300012357 | Vadose Zone Soil | MGSIQATAADSPLLAEFGKLHRISVSLESGVLLAGFAAMYLMVRELASTR* |
| Ga0137360_107975482 | 3300012361 | Vadose Zone Soil | TAEDSPLLAEFGRLHRVSASLEGAVLLAGFAALYLMVREFAAGK* |
| Ga0137360_117917992 | 3300012361 | Vadose Zone Soil | GSIQAFQATAADSPLLAEFSRLHRISVSLESGVLLAGLAAMYLMAKDLGAIGK* |
| Ga0137390_109011482 | 3300012363 | Vadose Zone Soil | FAEFRRLHQISVSLESGVLLAGFAALFLLVREVGVGR* |
| Ga0137390_111839722 | 3300012363 | Vadose Zone Soil | AGNDPLLEEFSRLHRVSVTLESGVLLAGFAAMYFMVKELTSSR* |
| Ga0137358_103973272 | 3300012582 | Vadose Zone Soil | VQATAADSPLLAEFGRLHRVSASLEGAVLLAGFAALYLMVKELAAGK* |
| Ga0137398_108473582 | 3300012683 | Vadose Zone Soil | ADSPLLAEFSRLHRASVSLESAVLLAGLAAMYLMAKDLGAGH* |
| Ga0137395_104534612 | 3300012917 | Vadose Zone Soil | QRTAADSPLLAEFGRLHRISASLEGGVILAGLAALYLMVKDSGVGN* |
| Ga0137396_103508861 | 3300012918 | Vadose Zone Soil | TAADSPLLAEFSRLHRISVSLESGVLLAGFTAMYLTVRELGVGR* |
| Ga0137394_112783611 | 3300012922 | Vadose Zone Soil | TAADSPSLAEFSKLHRISVSLESGVLLAGFVTMYLMVRELGAGR* |
| Ga0137413_117970741 | 3300012924 | Vadose Zone Soil | SIQATAADSPLLAEFGRLHQISVSLESGVLLAGMACMFLMVRESVSAGS* |
| Ga0137419_110457702 | 3300012925 | Vadose Zone Soil | PLLAEFGKLHRISVSLESGVLLAGFAAMFLMVRELSSVGR* |
| Ga0137419_110492341 | 3300012925 | Vadose Zone Soil | IQATAADSPLLAEFGRLHRISVSLESGVLLAGLVALYLMVKELASGRG* |
| Ga0137404_120196061 | 3300012929 | Vadose Zone Soil | IQATAADSPLLAEFGKLHRISVSLESGVLLAGLAAMYLMVKDLGVGQ* |
| Ga0137407_117046642 | 3300012930 | Vadose Zone Soil | LLAEFGRLHQISVSLESGVLLAGMACMFLMVRESFRARN* |
| Ga0164301_113436332 | 3300012960 | Soil | LAEFSKLHRISVSLESGVLLAGLAAMYLMVKELGAGR* |
| Ga0126369_107684191 | 3300012971 | Tropical Forest Soil | NPLLVEFSRLHRISVSLESGVLLAGLAAMYLMAREL* |
| Ga0126369_131525071 | 3300012971 | Tropical Forest Soil | AADSPHLGEFSRLHRVSVALESGVLIAGFAALYLLVRETLLNA* |
| Ga0134076_104975241 | 3300012976 | Grasslands Soil | IQATAADSPLLAEFSRLHRISVTLESGVLLAGFAAMYLMVRELASTR* |
| Ga0134087_106913761 | 3300012977 | Grasslands Soil | LLVEFGKLHRISVSLESGVLLAGLACIYLMVKELVTVG* |
| Ga0163162_117915442 | 3300013306 | Switchgrass Rhizosphere | EATAEANPLLAEFARLHRLSVSLESGVLLAGLLGMYFMVSELGESR* |
| Ga0134079_106639263 | 3300014166 | Grasslands Soil | SIQATAADSPLLAEFAKLHQVSVTLESGVLLAGIACMFLMVRELASK* |
| Ga0137411_10736541 | 3300015052 | Vadose Zone Soil | DGADIQATAEDSPLLAEFGRLHRVSASLEGAVLLAGFAALYLMVREFAAGK* |
| Ga0137405_10976032 | 3300015053 | Vadose Zone Soil | IQATAADSPLLAEFGKLHQISVTLESGVLLAGIACIFLMVRELATK* |
| Ga0137405_11193902 | 3300015053 | Vadose Zone Soil | ATAADSPLLAEFGKLHQISVTLESGVLLAGIACIFLMVRELATK* |
| Ga0137418_105929922 | 3300015241 | Vadose Zone Soil | AADSPLLAEFAKLHTVSVTLESGVLLAGIACVFLMVSESFGSGS* |
| Ga0137403_106998551 | 3300015264 | Vadose Zone Soil | DSPLLAQFSRLHQISVSLESGVLLAGFAAMYLMVKELGAMGK* |
| Ga0187818_100456431 | 3300017823 | Freshwater Sediment | ADSPLLAEFSRLHRISVVLESGVLLAGLAAMYLMVRELATRQ |
| Ga0187825_103096501 | 3300017930 | Freshwater Sediment | QATAADNPLRVEFDRLHRRSVMLESGVLLAGFAAMFLLVKELGSIR |
| Ga0137408_14753571 | 3300019789 | Vadose Zone Soil | DSPLLAEFGRLHQISVSLESGVLLAGMACMFLMVRESFRARN |
| Ga0210403_103914772 | 3300020580 | Soil | EFSRLHTISVSLESGVLLAGIAAMYLMVRELTAGR |
| Ga0210403_109016781 | 3300020580 | Soil | PLLAEFSRLHRISVLLESGVLLAGFAAMYLMVRELTVAGN |
| Ga0210399_115692732 | 3300020581 | Soil | EFSRLHRISVSLESGVLLAGLAALYLMVRESAMAN |
| Ga0210395_111839801 | 3300020582 | Soil | AAAADSPLLAGFSRLHTISVSLESGVLLAGFAAMYLMVRELAAGSR |
| Ga0179596_104747691 | 3300021086 | Vadose Zone Soil | RAADSPLLAEFSRLHRISVSLESGVLLAGFVAMYLMVRELASLGH |
| Ga0210404_100104855 | 3300021088 | Soil | AEFGRLHRISVSLESGVLLAGLAAMFLMVKELGTVQ |
| Ga0210406_109814192 | 3300021168 | Soil | TAADSPLLAEFGRLHRISVSLESAVLLAGFLAMYGMVKEFGSAN |
| Ga0210400_109987581 | 3300021170 | Soil | DSPLLAEFGRLHRISVSLESGVLLAGFAAVFLLVREVGLGR |
| Ga0210400_112406661 | 3300021170 | Soil | SIQATAADNPLLVEFSRLHRISVSLESGVLLAGLVALYLMVRDVATARG |
| Ga0210405_100573045 | 3300021171 | Soil | ADSPLLAEFGRLHRISVSLESGVLLAGLLALFLMVRELVAVH |
| Ga0210408_108076991 | 3300021178 | Soil | LLAEFSRLHRISVSLESGVLLAGIAAMYLMVRELGAGS |
| Ga0210393_101015591 | 3300021401 | Soil | GSIQATAAESPLLAEFSRLHSISVSLESGVLLAGITAMYFMVREFTAGR |
| Ga0210383_101581684 | 3300021407 | Soil | PLLAEFGRLHGISVTLESGVLLAGIAAMYLMVRELMAGR |
| Ga0210394_1001189911 | 3300021420 | Soil | GSIQATGADSPLLAEFSRLHTISVSLESGVLLAGIAAMCLMVRELTAGR |
| Ga0210384_108997011 | 3300021432 | Soil | EFSRLHGISVSLESGVLLAGITAMYFMVREFTAGR |
| Ga0210390_103829021 | 3300021474 | Soil | MGSIQATAADSPLLLEFSRWHRVSVSLESGVLLAGFLALYFMVREFGA |
| Ga0210390_114982061 | 3300021474 | Soil | TAGDSPLLAEFGRLHGISVALESGVLLAGIGAMYLMVRELVAGR |
| Ga0210409_106126211 | 3300021559 | Soil | QATGADSPLLAEFSRLHTVSVSLESGVLLAGFAAMYLMVRELVAGR |
| Ga0126371_117783842 | 3300021560 | Tropical Forest Soil | AEFTRLHAISVSLESGVLLAALASMYLMVRELAAQA |
| Ga0224549_10171321 | 3300022840 | Soil | GSIQATAADSPLLAEFSRLHRVSVSLESCVLLLGIAAMYLMVRELNARG |
| Ga0247695_10195742 | 3300024179 | Soil | TAAGSPLLAEFGRMHRVSVGLESGVLLAGMAALFWMVKEAARQ |
| Ga0247690_10458551 | 3300024287 | Soil | TAGDSPLLAEFNKLHSISVSLESGVLLAGFAAMYFMVRELAATH |
| Ga0209171_103455811 | 3300025320 | Iron-Sulfur Acid Spring | PLLAEFSRLHSVSVSLESGVLLAGFAAMYLMVRELR |
| Ga0207711_108610912 | 3300025941 | Switchgrass Rhizosphere | EFARLHRLSVSLESGVLLAGLLGMYFMVSELGESR |
| Ga0209238_11577222 | 3300026301 | Grasslands Soil | GSIQATVADSPLLVEFSRLHRASVSLESGVLLAGLAAMYLMAKDLGAGH |
| Ga0209469_11448322 | 3300026307 | Soil | LEFGRLHRISVSLESGVLLAGIAAMYLMVRELAFRSS |
| Ga0209153_11644811 | 3300026312 | Soil | SPLLGEFSRLHRISVSLESGVLLAGIAAIYLMAKELTLIAS |
| Ga0209161_102754121 | 3300026548 | Soil | ADSPMLFEFGRLHRISVSLESGVLLAGIAAMYLMVRELAFRSS |
| Ga0209648_105923271 | 3300026551 | Grasslands Soil | TEKDSPLLAEFRRLHQISVSLESGVLLAGFAALFLLVREVGVGR |
| Ga0208606_1075791 | 3300027095 | Forest Soil | ATAAESPLLTEFSRLHTISVSLESGVLLAGIAAMYFMVREFTAGP |
| Ga0208603_10675571 | 3300027109 | Forest Soil | IQATAADSPLLAEFSRLHAISVSLESGVLLAGIAATYSIVRELAASQGFSR |
| Ga0209331_10846141 | 3300027603 | Forest Soil | IQATAADSPLLAEFTRLHSISVSLESVVLLAGIAAMFLLVREVARLP |
| Ga0209388_11530282 | 3300027655 | Vadose Zone Soil | SPLLAEFSKLHRISVSLESGVLLAGLAAMYLMVKELGAGR |
| Ga0209388_12099431 | 3300027655 | Vadose Zone Soil | IQATAADSPLLAEFGRLHRISVSLESGVLLAGFAAMYLMVGELAARR |
| Ga0209588_11915431 | 3300027671 | Vadose Zone Soil | DSPLLVEFSRLHRISVLLESGVLLAGFAAMYLMVRELTVAGN |
| Ga0209118_11351051 | 3300027674 | Forest Soil | AQDSPLLAEFGRLHRISVLLESGVLLAGLGAMLFMVRELSQH |
| Ga0209118_11494312 | 3300027674 | Forest Soil | MGSIQATAQDSPLLAEFARLHRISVSLESGVLLAGFAAIYLMIRELTVAGN |
| Ga0209073_102678212 | 3300027765 | Agricultural Soil | EFTRLHAISVSLESGVLLAGIAAIYLMARELAIRPS |
| Ga0209655_102453582 | 3300027767 | Bog Forest Soil | IQATAADSPLLAEFSRWHRVSVSLESGVLLAGFLALYFMVREFGA |
| Ga0209810_10390884 | 3300027773 | Surface Soil | ATAADSPLLAQFGRLHGVSVTLESGVLLAGLAAMYLMVKELASGR |
| Ga0209139_100265191 | 3300027795 | Bog Forest Soil | AATDSPLLAEFSRLHQISVSLESGVLLAGFAAMYLMVRELAAGR |
| Ga0209283_100319401 | 3300027875 | Vadose Zone Soil | AAADSPLLAEFSRLHRVSVSLESGVLLAGIAAMYLMVKELKSGQ |
| Ga0209283_108915751 | 3300027875 | Vadose Zone Soil | ATAEGSPLLAEFGRLHRISVSLESGVLLAGFAAMFLLVRELGIGR |
| Ga0209067_106263102 | 3300027898 | Watersheds | PLLAEFSKLHKISISLESGVLLAGIAAMVLMVRELERMK |
| Ga0247684_10239433 | 3300028138 | Soil | VSIQATAADSPLLAEFSKLHTISVSLESGVLLAGFLAVYLMVRELLVTR |
| Ga0247684_10504141 | 3300028138 | Soil | TAVESPLLAEFSRLHTISVSLESGVLLAGIAAIYFLVGEIAAS |
| Ga0308309_114542441 | 3300028906 | Soil | AAESPLLNEFSRLHSVSVSLESGVLLAGIAAVYLMVRELAVGR |
| Ga0302178_101439791 | 3300030013 | Palsa | SIQATASGSPLLAEFTRLHGISVALESAVLLAGFAALYLLVREVSTPN |
| Ga0311355_108985452 | 3300030580 | Palsa | MGSIQATAADSPLLAEFSRLHRVSVSLESCVLLLGIAAMYLMVRELNARG |
| Ga0265750_10004255 | 3300030813 | Soil | ADNPLLAEFSRLHRISVSLESGVLLAGFAAMYLMVRELAAGSR |
| Ga0073994_100479882 | 3300030991 | Soil | GEFGRLHRISVFLESGVLLAGFGAFYFMVRELSVGT |
| Ga0170834_1005862021 | 3300031057 | Forest Soil | LAEFSRLHKISVSLESGVLLAGLAALFLFVRETTAGQ |
| Ga0265760_103366211 | 3300031090 | Soil | SIQATAMDSPLMAEFSRLHGISVSLESGVLLAGFAAMYLMVRELAAGCR |
| Ga0307477_101524661 | 3300031753 | Hardwood Forest Soil | PLLAEFGRLHRVSVLLESGVLLAGLAAIYFMVREFAAARN |
| Ga0307475_111682851 | 3300031754 | Hardwood Forest Soil | DSPLLAEFNRWHRVSVRLEGGVLLAGLAAMYFLVKELGSAARA |
| Ga0307473_107065931 | 3300031820 | Hardwood Forest Soil | AADSPLLAEFSRLHRISVSLESGVLLAGLAAMYLMVRELGAGR |
| Ga0310913_109712682 | 3300031945 | Soil | STATDSPLLAEFARLHQISVSLESGVLLAGIACMYLMERELART |
| Ga0307479_118043792 | 3300031962 | Hardwood Forest Soil | EFRRFHSISVSLESGVLLAGLAGIYLMVRELTTAVN |
| Ga0306924_111541651 | 3300032076 | Soil | LAEFTRLHAISVSLESGVLLAGLAGIYSMTHELTAKI |
| Ga0307471_1000017761 | 3300032180 | Hardwood Forest Soil | LVEFGKLHRVSVSLESGVLLAGFTAMFLMVRELSRVGR |
| Ga0307471_1013360792 | 3300032180 | Hardwood Forest Soil | TAANSPLLAEFSRLHRLSVSLESGVLLAGLAALYLMVRELSLASK |
| Ga0307471_1026635252 | 3300032180 | Hardwood Forest Soil | IQAFQEKAADSPLLAEFSKLHRISVSLESGVLLVGLAAMYFMIKDLAS |
| Ga0335081_104230121 | 3300032892 | Soil | TDNPLLVAFMRLHQVSVLLESGVLLCGFAALYLMVRELALRG |
| ⦗Top⦘ |