


| Basic Information | |
|---|---|
| Family ID | F041935 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 41 residues |
| Representative Sequence | ITSARDKMPFEVTPFYPRLARYGAGAPGAAPTTAASNTNTGN |
| Number of Associated Samples | 137 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.63 % |
| % of genes near scaffold ends (potentially truncated) | 98.11 % |
| % of genes from short scaffolds (< 2000 bps) | 90.57 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.453 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.063 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.755 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.491 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF11799 | IMS_C | 10.06 |
| PF03572 | Peptidase_S41 | 5.03 |
| PF04185 | Phosphoesterase | 4.40 |
| PF14685 | Tricorn_PDZ | 2.52 |
| PF01979 | Amidohydro_1 | 1.89 |
| PF14067 | LssY_C | 1.89 |
| PF00474 | SSF | 1.26 |
| PF13419 | HAD_2 | 1.26 |
| PF00072 | Response_reg | 0.63 |
| PF00106 | adh_short | 0.63 |
| PF00398 | RrnaAD | 0.63 |
| PF13470 | PIN_3 | 0.63 |
| PF00873 | ACR_tran | 0.63 |
| PF13732 | DUF4162 | 0.63 |
| PF00034 | Cytochrom_C | 0.63 |
| PF12680 | SnoaL_2 | 0.63 |
| PF01041 | DegT_DnrJ_EryC1 | 0.63 |
| PF12833 | HTH_18 | 0.63 |
| PF07885 | Ion_trans_2 | 0.63 |
| PF13565 | HTH_32 | 0.63 |
| PF13826 | DUF4188 | 0.63 |
| PF04191 | PEMT | 0.63 |
| PF08327 | AHSA1 | 0.63 |
| PF05163 | DinB | 0.63 |
| PF00005 | ABC_tran | 0.63 |
| PF04173 | DoxD | 0.63 |
| PF16264 | SatD | 0.63 |
| PF02517 | Rce1-like | 0.63 |
| PF07676 | PD40 | 0.63 |
| PF00691 | OmpA | 0.63 |
| PF13649 | Methyltransf_25 | 0.63 |
| PF13964 | Kelch_6 | 0.63 |
| PF12704 | MacB_PCD | 0.63 |
| PF02687 | FtsX | 0.63 |
| PF09624 | DUF2393 | 0.63 |
| PF12697 | Abhydrolase_6 | 0.63 |
| PF13007 | LZ_Tnp_IS66 | 0.63 |
| PF00884 | Sulfatase | 0.63 |
| PF08447 | PAS_3 | 0.63 |
| PF13193 | AMP-binding_C | 0.63 |
| PF00926 | DHBP_synthase | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 5.03 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 4.40 |
| COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 0.63 |
| COG0108 | 3,4-dihydroxy-2-butanone 4-phosphate synthase | Coenzyme transport and metabolism [H] | 0.63 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.63 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.63 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.63 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.63 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.63 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.63 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.63 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.63 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.45 % |
| Unclassified | root | N/A | 7.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y01C6LZE | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300000955|JGI1027J12803_104279253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1145 | Open in IMG/M |
| 3300001356|JGI12269J14319_10333819 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300001471|JGI12712J15308_10063453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 935 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100653471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 929 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101745537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300004082|Ga0062384_100044417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2109 | Open in IMG/M |
| 3300004091|Ga0062387_100346131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 979 | Open in IMG/M |
| 3300004091|Ga0062387_101706052 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300004092|Ga0062389_103297742 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300004152|Ga0062386_100022363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4635 | Open in IMG/M |
| 3300004152|Ga0062386_100123556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2004 | Open in IMG/M |
| 3300005177|Ga0066690_10995438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 528 | Open in IMG/M |
| 3300005468|Ga0070707_101955094 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005526|Ga0073909_10111361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1096 | Open in IMG/M |
| 3300005535|Ga0070684_101947943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 554 | Open in IMG/M |
| 3300005538|Ga0070731_10945727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 571 | Open in IMG/M |
| 3300005545|Ga0070695_101112867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 647 | Open in IMG/M |
| 3300005557|Ga0066704_10036370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3040 | Open in IMG/M |
| 3300005561|Ga0066699_10986488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 584 | Open in IMG/M |
| 3300005591|Ga0070761_10082410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1836 | Open in IMG/M |
| 3300005591|Ga0070761_10189340 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300005591|Ga0070761_10837005 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005712|Ga0070764_10921550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 548 | Open in IMG/M |
| 3300005841|Ga0068863_101695292 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005890|Ga0075285_1015799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 874 | Open in IMG/M |
| 3300005921|Ga0070766_10019846 | All Organisms → cellular organisms → Bacteria | 3562 | Open in IMG/M |
| 3300005921|Ga0070766_10254302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1115 | Open in IMG/M |
| 3300006028|Ga0070717_10765140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300006032|Ga0066696_10636966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 689 | Open in IMG/M |
| 3300006102|Ga0075015_100015167 | All Organisms → cellular organisms → Bacteria | 3322 | Open in IMG/M |
| 3300006162|Ga0075030_101500047 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300006174|Ga0075014_100290718 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300006796|Ga0066665_10496233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1001 | Open in IMG/M |
| 3300006796|Ga0066665_11570570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 516 | Open in IMG/M |
| 3300006806|Ga0079220_10809079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300006871|Ga0075434_101919646 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300006914|Ga0075436_100003516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10743 | Open in IMG/M |
| 3300009088|Ga0099830_10100704 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
| 3300009089|Ga0099828_11122038 | Not Available | 699 | Open in IMG/M |
| 3300009521|Ga0116222_1329525 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300009523|Ga0116221_1212174 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300009635|Ga0116117_1099390 | Not Available | 728 | Open in IMG/M |
| 3300009759|Ga0116101_1023535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1222 | Open in IMG/M |
| 3300009824|Ga0116219_10522623 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300010048|Ga0126373_10707396 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300010048|Ga0126373_12172375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 616 | Open in IMG/M |
| 3300010336|Ga0134071_10201122 | Not Available | 982 | Open in IMG/M |
| 3300010360|Ga0126372_12758280 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300010379|Ga0136449_102613285 | Not Available | 720 | Open in IMG/M |
| 3300010937|Ga0137776_1603640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1166 | Open in IMG/M |
| 3300011271|Ga0137393_11343453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300012189|Ga0137388_10010070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6626 | Open in IMG/M |
| 3300012210|Ga0137378_11205720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_55_7 | 673 | Open in IMG/M |
| 3300012363|Ga0137390_10151660 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
| 3300012683|Ga0137398_10350590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_55_7 | 999 | Open in IMG/M |
| 3300012957|Ga0164303_10630321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300014156|Ga0181518_10553410 | Not Available | 540 | Open in IMG/M |
| 3300014501|Ga0182024_11513496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300016294|Ga0182041_11343206 | Not Available | 655 | Open in IMG/M |
| 3300017823|Ga0187818_10206849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 857 | Open in IMG/M |
| 3300017933|Ga0187801_10103808 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300017934|Ga0187803_10101125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1132 | Open in IMG/M |
| 3300017943|Ga0187819_10052843 | All Organisms → cellular organisms → Bacteria | 2412 | Open in IMG/M |
| 3300017946|Ga0187879_10133811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1408 | Open in IMG/M |
| 3300017955|Ga0187817_10929541 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300017959|Ga0187779_10373822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 925 | Open in IMG/M |
| 3300017970|Ga0187783_10035513 | Not Available | 3693 | Open in IMG/M |
| 3300017975|Ga0187782_10453974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 977 | Open in IMG/M |
| 3300017975|Ga0187782_10494691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 935 | Open in IMG/M |
| 3300017975|Ga0187782_11559332 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300018007|Ga0187805_10235128 | Not Available | 839 | Open in IMG/M |
| 3300018022|Ga0187864_10184518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
| 3300018034|Ga0187863_10110997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 1534 | Open in IMG/M |
| 3300018034|Ga0187863_10185582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1158 | Open in IMG/M |
| 3300018034|Ga0187863_10310942 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300018044|Ga0187890_10029331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3350 | Open in IMG/M |
| 3300018062|Ga0187784_11218277 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300018085|Ga0187772_10457070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 896 | Open in IMG/M |
| 3300018085|Ga0187772_10887723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300018086|Ga0187769_10157142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1668 | Open in IMG/M |
| 3300018086|Ga0187769_10246287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1329 | Open in IMG/M |
| 3300018090|Ga0187770_11189018 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300018468|Ga0066662_10384592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1225 | Open in IMG/M |
| 3300018482|Ga0066669_11843486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300019786|Ga0182025_1156382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_55_7 | 1170 | Open in IMG/M |
| 3300019879|Ga0193723_1195778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_55_7 | 508 | Open in IMG/M |
| 3300020022|Ga0193733_1141055 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300020579|Ga0210407_10573521 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300020580|Ga0210403_10243876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1474 | Open in IMG/M |
| 3300020582|Ga0210395_10841860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300021170|Ga0210400_11182854 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300021171|Ga0210405_10523796 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300021178|Ga0210408_10172873 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300021405|Ga0210387_10302079 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300021406|Ga0210386_10400639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1183 | Open in IMG/M |
| 3300021420|Ga0210394_10351060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1296 | Open in IMG/M |
| 3300021420|Ga0210394_10830396 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300021474|Ga0210390_10299621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1362 | Open in IMG/M |
| 3300021559|Ga0210409_10791107 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300021559|Ga0210409_10938265 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300021559|Ga0210409_11135634 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300021560|Ga0126371_11198770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
| 3300021560|Ga0126371_11483241 | Not Available | 807 | Open in IMG/M |
| 3300021860|Ga0213851_1493037 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300022509|Ga0242649_1069303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300024176|Ga0224565_1021763 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300025922|Ga0207646_10611411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_55_7 | 978 | Open in IMG/M |
| 3300025928|Ga0207700_10710345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300026078|Ga0207702_10578228 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1101 | Open in IMG/M |
| 3300026318|Ga0209471_1171014 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300026532|Ga0209160_1350447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300026550|Ga0209474_10275042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1017 | Open in IMG/M |
| 3300027521|Ga0209524_1022265 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300027583|Ga0209527_1137707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300027641|Ga0208827_1125531 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300027648|Ga0209420_1016255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2483 | Open in IMG/M |
| 3300027821|Ga0209811_10084700 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300027821|Ga0209811_10103425 | Not Available | 1026 | Open in IMG/M |
| 3300027825|Ga0209039_10307168 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300027853|Ga0209274_10227756 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300027855|Ga0209693_10167208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_55_7 | 1085 | Open in IMG/M |
| 3300027875|Ga0209283_10625520 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300027889|Ga0209380_10199819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_55_7 | 1174 | Open in IMG/M |
| 3300027889|Ga0209380_10761019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300027911|Ga0209698_11306215 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300028013|Ga0265350_104028 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300028380|Ga0268265_10543827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_55_7 | 1101 | Open in IMG/M |
| 3300028560|Ga0302144_10152156 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300028747|Ga0302219_10327161 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300028773|Ga0302234_10280634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300028784|Ga0307282_10500908 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300028828|Ga0307312_10207798 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300030007|Ga0311338_10114558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3308 | Open in IMG/M |
| 3300030041|Ga0302274_10148652 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300030053|Ga0302177_10402309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300030057|Ga0302176_10305895 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300030503|Ga0311370_10732862 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300030520|Ga0311372_12630934 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300030707|Ga0310038_10299635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300030815|Ga0265746_1036781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300031028|Ga0302180_10496005 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300031128|Ga0170823_17040466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 568 | Open in IMG/M |
| 3300031231|Ga0170824_107181401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1165649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300031344|Ga0265316_10402155 | Not Available | 986 | Open in IMG/M |
| 3300031708|Ga0310686_101562773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 968 | Open in IMG/M |
| 3300031715|Ga0307476_10263546 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300031718|Ga0307474_10270563 | Not Available | 1304 | Open in IMG/M |
| 3300031718|Ga0307474_11098837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300031720|Ga0307469_11477697 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300031753|Ga0307477_10136249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1713 | Open in IMG/M |
| 3300031753|Ga0307477_10813229 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031823|Ga0307478_11722301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_55_7 | 516 | Open in IMG/M |
| 3300031945|Ga0310913_11188070 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300032001|Ga0306922_10723459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_55_7 | 1046 | Open in IMG/M |
| 3300032180|Ga0307471_100800633 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300032783|Ga0335079_11383509 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300032892|Ga0335081_11365629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.06% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.29% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.03% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.03% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.03% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.40% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.40% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.77% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.14% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.26% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.26% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.26% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.26% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.63% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.63% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.63% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.63% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.63% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.63% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.63% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028013 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_00619110 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | RDKMPFEVTPFFPRLARFGANAAPAAAPTTATNNPNTGN |
| JGI1027J12803_1042792531 | 3300000955 | Soil | TAPVAITSARDKMPFEVTPFFPRLSRYGGNAAPTTAANGTQNPGN* |
| JGI12269J14319_103338192 | 3300001356 | Peatlands Soil | AITSARDKMPFEVTPFFPRLIRYGSGPAAPAAAPTTAANNSGSGN* |
| JGI12712J15308_100634531 | 3300001471 | Forest Soil | AITSARDKMPFEVTPFYPRLARYGASNTPGATPGTSASNSPTGN* |
| JGIcombinedJ26739_1006534711 | 3300002245 | Forest Soil | RDKMPFEVTPFFPRLARYGTGVAPTAAPTTAANSGSGN* |
| JGIcombinedJ26739_1017455371 | 3300002245 | Forest Soil | KMPFEVTPFYPRLARYGSSNTPGTPSAPTTAAANPNPGN* |
| Ga0062384_1000444173 | 3300004082 | Bog Forest Soil | TSARDKMPFEVTPFYPRLARIGSSTAPSAAPATAAANSNSGN* |
| Ga0062387_1003461311 | 3300004091 | Bog Forest Soil | VAITSARDKMPFEVTPFYPRLARYGASTAPSAAPATSAANSNTGN* |
| Ga0062387_1017060521 | 3300004091 | Bog Forest Soil | VAITSARDKMPFEVTPFFPRLARFGTGVAPAAAPTTAAANTGN* |
| Ga0062389_1032977422 | 3300004092 | Bog Forest Soil | SARDKMPFEVTPFYPRLARFGAGVAAPAPTTAAANGNTGN* |
| Ga0062386_1000223634 | 3300004152 | Bog Forest Soil | ITSARDKMPFEVTPFYPRLARYGATAPGAAPTTAASNTNSGN* |
| Ga0062386_1001235562 | 3300004152 | Bog Forest Soil | ITSARDKMPFEVTPFYPRLARYGAGAPGAAPTTAASNTNTGN* |
| Ga0066690_109954381 | 3300005177 | Soil | SARDKMPFEVTPFFPRLARFGAGNNQAPAASPTTAASNTGN* |
| Ga0070707_1019550941 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AITSARDKMPFEVTPFFPRLARFGTGTAPAAPATAAANTGN* |
| Ga0073909_101113613 | 3300005526 | Surface Soil | DKMPFEVTPFFPRLSRFGSNATPAAAPTTAANSPQTTGN* |
| Ga0070684_1019479432 | 3300005535 | Corn Rhizosphere | APVAITSARDKMPFEVTPFFPRLTRYGSGPGTPTTANAAPTN* |
| Ga0070731_109457271 | 3300005538 | Surface Soil | PVAITSARDKMPFEVTPFFPRLSRYNSGTTNGTTPTTAAANAAPANQ* |
| Ga0070695_1011128672 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VAITSARDKMPFEVTPFFPRLTRINAGGNTGNSTTAANTAQ* |
| Ga0066704_100363701 | 3300005557 | Soil | AITSARDKMPFEVTPFFPRLARFGAGNQAPAAAPTTAASNTGN* |
| Ga0066699_109864882 | 3300005561 | Soil | ITSARDKMPFEVTPFFPRLTRITAGGNTGNPTTAANTEQK* |
| Ga0070761_100824104 | 3300005591 | Soil | ARDKMPFEVTPFFPRLSRLNSDANVGNTTAASNATPSN* |
| Ga0070761_101893401 | 3300005591 | Soil | ITSARDKMPFEVTPFYPRLARYGTTNAPGAAPTTAAANSNSSN* |
| Ga0070761_108370051 | 3300005591 | Soil | SARDKMPFEVTPFYPRLGRYGAATPSTTPATAANSNPGN* |
| Ga0070764_109215501 | 3300005712 | Soil | RDKMPFEVTPFYPRLARWGASTTPTAPATSAANSPSSN* |
| Ga0068863_1016952922 | 3300005841 | Switchgrass Rhizosphere | APVAITSARDKMPFEVTPFFPRLIRYGSGANPGSPTSTANATPSTN* |
| Ga0075285_10157992 | 3300005890 | Rice Paddy Soil | VAITSARDKMPFEVTPFFPRLARYGANAATATAPTNTAPNTAANTSTTN* |
| Ga0070766_100198465 | 3300005921 | Soil | APVAITSARDKMPFEVTPFYPRLARFGTGAAQQGAAPTSAAAANTTPSPNPSN* |
| Ga0070766_102543022 | 3300005921 | Soil | AITSARDKMPFEVTPFYPRLARIGSSTTPSAAPATSAANSNSGN* |
| Ga0070717_107651401 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RDKMPLEVTPFFPRMTRYGAVANSTATASVVQGNQ* |
| Ga0066696_106369661 | 3300006032 | Soil | PVAITSARDKMPFEVTPFFPRLARYGATPTAPVAPTSAANNSGSN* |
| Ga0075015_1000151673 | 3300006102 | Watersheds | FEVTPFFPRLSRYAGNATPVAAPTTAASSAQNTGN* |
| Ga0075030_1015000472 | 3300006162 | Watersheds | SARDKMPFEVTPFFPRLARYGAGVAAPAAAPTTAANSGSGN* |
| Ga0075014_1002907181 | 3300006174 | Watersheds | DKMPFEVTPFYPRLARFGTNVAPNAAPTTAAANSGN* |
| Ga0066665_104962333 | 3300006796 | Soil | ITSARDKMPFEVTPFFPRLARFGAGNQAPAAAPTTAASNTGN* |
| Ga0066665_115705701 | 3300006796 | Soil | TITSARDKMPFEVTPFYPRLARFGASNFPSAGATNAIVNSNLGN* |
| Ga0079220_108090792 | 3300006806 | Agricultural Soil | DKMPFEVTPFFPRLTRYGGGANPGSPTSTANAAPNN* |
| Ga0075434_1019196461 | 3300006871 | Populus Rhizosphere | SARDKMPFEVTPFFPRLTRSGAADSNNASGNTGSAGSTQAANQKQ* |
| Ga0075436_10000351610 | 3300006914 | Populus Rhizosphere | VAITSARDKMPFEVTPFFPRLSRYGAVTTAGAPAGAGNPSAAN* |
| Ga0099830_101007041 | 3300009088 | Vadose Zone Soil | TAPIAITSARDKMPFEVTPFYPRLARYGSSNTPGTPSAPTTAAANPGN* |
| Ga0099828_111220381 | 3300009089 | Vadose Zone Soil | KMPFEVTPFYPRLARYGSQVAPSATPATSAANAPTGSN* |
| Ga0116222_13295251 | 3300009521 | Peatlands Soil | MPFEVTPFYPRLARYGASLTPNAQPTTAANSNTGN* |
| Ga0116221_12121742 | 3300009523 | Peatlands Soil | MPFEVTPFYPRLARYGAGAAANPTPNATPTTAANTNTGN* |
| Ga0116117_10993901 | 3300009635 | Peatland | ITSARDKMPFEVTPFFPRLIRYGTGVAAPAATPTTAAATPSSGN* |
| Ga0116101_10235352 | 3300009759 | Peatland | TSARDKMPFEVTPFYPRLARYGTTNAPGAAPTTAAANSNSGN* |
| Ga0116219_105226231 | 3300009824 | Peatlands Soil | IISARDKMPFEVTPFFPRLSRLVTDANSGNTTSASNTAPSN* |
| Ga0126373_107073961 | 3300010048 | Tropical Forest Soil | MVKTATVSITSASDKMTFEVTPFFPRLARIGGGAAQPAASTTAASNSPTTAN* |
| Ga0126373_121723752 | 3300010048 | Tropical Forest Soil | AITSARDKMPFEVTPFFPRLARFGGNAAPNATPTTAANTNSGN* |
| Ga0134071_102011221 | 3300010336 | Grasslands Soil | KMPFEVTPFLPRLSRCGAVRTAVAPAGAGNASAAN* |
| Ga0126372_127582801 | 3300010360 | Tropical Forest Soil | RDKMPFEVTPFFPRLSRYGANAVPAAAPTTAANGTPNQGSN* |
| Ga0136449_1026132852 | 3300010379 | Peatlands Soil | TSARDKMPFEVTPFFPRLSRLTSDANTGNATSASNTAPSN* |
| Ga0137776_16036401 | 3300010937 | Sediment | RDKMPFEVTPFFPRLSRIGAGAAQPAAPTTAANNNGTGN* |
| Ga0137393_113434532 | 3300011271 | Vadose Zone Soil | AITSARDKMPFEVTPFYPRLARYGSSNTPGTPSAPTTAAANPGN* |
| Ga0137388_100100704 | 3300012189 | Vadose Zone Soil | ARDKMPFEVTPFFPRLTRITSGGNTGNPTTAANTVQK* |
| Ga0137378_112057201 | 3300012210 | Vadose Zone Soil | ITSARDKMPFEVTPFFPRLIRYGANPGSSTSTANAAPSNN* |
| Ga0137390_101516603 | 3300012363 | Vadose Zone Soil | AITSARDKMPFEVTPFYPRLARYGSQVAPSATPATSAANAPTGSN* |
| Ga0137398_103505901 | 3300012683 | Vadose Zone Soil | FEVTPFYPRLVRWGASTTPSTAPATSAANAPTGN* |
| Ga0164303_106303212 | 3300012957 | Soil | PFEVTPFFPRLSRVGAGAAQPAAPNTAASNNPGN* |
| Ga0181518_105534101 | 3300014156 | Bog | KMPFEVTPFFPRLTRYGAAAQNAAPATTASNSNGGN* |
| Ga0182024_115134962 | 3300014501 | Permafrost | SARDKMPFEVTPFFPRLARYGTGAASFPAPATAAANSGSGN* |
| Ga0182041_113432061 | 3300016294 | Soil | MPFEVTPFFPRLARFGANAAQPAAPTTAANSNSGN |
| Ga0187818_102068491 | 3300017823 | Freshwater Sediment | RDKMPFEVTPFFPRLVRYGTGATAPAAAPTTAAANSGSGN |
| Ga0187801_101038081 | 3300017933 | Freshwater Sediment | FEVTPFFPRLSRYNATSAPTAAPTTATTAANSSPAPAN |
| Ga0187803_101011251 | 3300017934 | Freshwater Sediment | SARDKMPFEVTPFFTRLARYGAGASNAAPTTAAVNSNSGN |
| Ga0187819_100528434 | 3300017943 | Freshwater Sediment | RDKMPFEVTPFFPRLARFGANAAQPAAPTTAANTNAGN |
| Ga0187879_101338114 | 3300017946 | Peatland | AITSARDKMPFEVTPFFPRLARFTVVAAPVAAPTTAAANSGSGN |
| Ga0187817_109295411 | 3300017955 | Freshwater Sediment | TAPVAITSARDKMPFEVTPFYPRLARYGSGTSNTAPATAASNANPGN |
| Ga0187779_103738221 | 3300017959 | Tropical Peatland | VAITSARDKMPFEVTPFYPRLARYSAGATNGTPTTASNSNSGN |
| Ga0187783_100355131 | 3300017970 | Tropical Peatland | ISARDKMPFEVTPFFPRLIRFGMEDQSASASAPASAPANQ |
| Ga0187782_104539741 | 3300017975 | Tropical Peatland | AITSARDKMPFEVTPFYPRLARFGANATPNAPATASNNSGN |
| Ga0187782_104946912 | 3300017975 | Tropical Peatland | AITSARDKMPFEVTPFYPRLNRYGATTPTTAPTSAAANNNSGN |
| Ga0187782_115593321 | 3300017975 | Tropical Peatland | ARDKMPFEVTPFFPRLSRYGANAAPAGAPTTAAATPNSGAPASN |
| Ga0187805_102351281 | 3300018007 | Freshwater Sediment | KMPFEVTPFFPRLARFGANAAQPAAAPTTAAANTNSGN |
| Ga0187864_101845182 | 3300018022 | Peatland | RDKMPFEVTPFYPRLARYSVENAPVSTAATQASTAAPSN |
| Ga0187863_101109971 | 3300018034 | Peatland | ITSARDKMPFEVTPFYPRLARYGASTTPSAPATAAANAPSGN |
| Ga0187863_101855822 | 3300018034 | Peatland | SARDKMPFEVTPFFPRLARIGASNTPAATPNATAANSTTGGN |
| Ga0187863_103109422 | 3300018034 | Peatland | VAITSARDKMPFEVTPFFPRLSRYNANPAAAPTTATTAANTAAGTTN |
| Ga0187890_100293311 | 3300018044 | Peatland | KMPFEVTPFYPRLARYGTTNAPGAAPTTAAANSNSGN |
| Ga0187784_112182771 | 3300018062 | Tropical Peatland | ITSARDKMPFEVTPFYPRLTRFGANVPAAAPTTTATNSNAGN |
| Ga0187772_104570702 | 3300018085 | Tropical Peatland | ARDKMPFEVTPFYPRLARFGEAAPNGGPGSTTTATTSNSGN |
| Ga0187772_108877232 | 3300018085 | Tropical Peatland | RDKMPFEVTPFFPRLSRYAADAPATPPSTTATNSPSGN |
| Ga0187769_101571423 | 3300018086 | Tropical Peatland | ITSARDKMPFEVTPFYPRLARYGTQTAPSAAPATAAANSGN |
| Ga0187769_102462871 | 3300018086 | Tropical Peatland | DKMPFEVTPFYPRLARFGAAAAPATTPTTAANTPAGN |
| Ga0187770_111890182 | 3300018090 | Tropical Peatland | ARDKMPFEVTPFYPRLARYGTQTAPSAAPATAAANSGN |
| Ga0066662_103845922 | 3300018468 | Grasslands Soil | ITSARDKMPFEVTPFFPRLSRFGANATPATAPGTAASNANPGN |
| Ga0066669_118434861 | 3300018482 | Grasslands Soil | RDKMPFEVTPFFPRLARYGATPTAPVAPTSAANNSGSN |
| Ga0182025_11563822 | 3300019786 | Permafrost | KMPFEVTPFYPRLARWGAQAAPAATPTTAANSPSGN |
| Ga0193723_11957781 | 3300019879 | Soil | KTAPVAITSARDKMPFEVTPFFPRLTRINAGGNTGNPTTASNTDQK |
| Ga0193733_11410552 | 3300020022 | Soil | VKTTPVTITSARDKMPFEVTPFYPRLARFGASNFPSAGATNAIVNSNLGN |
| Ga0210407_105735211 | 3300020579 | Soil | PVAITSARDKMPFEVTPFFPRLARYGAGAAPVAAPTTAAANSGSGN |
| Ga0210403_102438763 | 3300020580 | Soil | TSARDKMPFEVTPFFPRLSRLTGDAVPASTTSASNTTPSN |
| Ga0210395_108418601 | 3300020582 | Soil | VAITSARDKMPFEVTPFFPRLTRYNNAGAVSPTSAANTAPSN |
| Ga0210400_111828541 | 3300021170 | Soil | ITSARDKMPFEVTPFYPRLARFGAGVPAPAAAPTTAAANTGAGSSN |
| Ga0210405_105237961 | 3300021171 | Soil | AIISARDKMPFEVTPFFPRLSRLTGDANVGNATSASNTTPSN |
| Ga0210408_101728733 | 3300021178 | Soil | PVAITSARDKMPFEVTPFYPRLARFGTAVPTAAPATAASNSNSGN |
| Ga0210387_103020792 | 3300021405 | Soil | ARDKMPFEVTPFFPRLARFGTGVAPAAAPTTAANTGAN |
| Ga0210386_104006392 | 3300021406 | Soil | AITSARDKMPFEVTPFFPRLARFGAGNTPAVVPAATAANSTTGGN |
| Ga0210394_103510601 | 3300021420 | Soil | MPFEVTPFFPRLSRYGTAVAPAAAPTTASNSPSGN |
| Ga0210394_108303962 | 3300021420 | Soil | IISARDKMPFEVTPFFPRLSRLTGDANTGNTTSASNTTPSN |
| Ga0210390_102996211 | 3300021474 | Soil | PFEVTPFFPRLARFGAGNTPAVVPAATAANSTTGGN |
| Ga0210409_107911071 | 3300021559 | Soil | ITSARDKMPFEVTPFYPRLARWGASTPSAAPATAATNSTPGTN |
| Ga0210409_109382652 | 3300021559 | Soil | PVAITSARDKMPFEVTPFFPRLTRYNNAGAVSPTNAANTAPSN |
| Ga0210409_111356341 | 3300021559 | Soil | APVAITSARDKMPFEVTPFFPRLTRYNNAGAVSPTSAANTAPSN |
| Ga0126371_111987701 | 3300021560 | Tropical Forest Soil | KMPFEVTPFFPRLSRFGSNAAPTAAPTTAANSSQNTGN |
| Ga0126371_114832411 | 3300021560 | Tropical Forest Soil | AITSARDKMPFEVTPFFPRLTRYGSAAPNAVVTTATTKQ |
| Ga0213851_14930371 | 3300021860 | Watersheds | MPFEVTPFFPRLSRYGGNIAPVPAPTTAANSSQNTGN |
| Ga0242649_10693031 | 3300022509 | Soil | FEVTPFYPRLARFGTGAAQQGAAPTSAAAANTTPSPNPSN |
| Ga0224565_10217631 | 3300024176 | Plant Litter | ITSARDKMPFEVTPFYPRLARYGASNPSAAPATAAANSTPGSN |
| Ga0207646_106114112 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ARDKMPFEVTPFFPRLTRYGSGANPGSPTSTASAAPNN |
| Ga0207700_107103452 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VAITSARDKMPFEVTPFFPRLARFGANAAPAAAPTTAANNPNTGN |
| Ga0207702_105782281 | 3300026078 | Corn Rhizosphere | RDKMPFEVTPFFPRLARYGANSATPAAPTSAANNGGSN |
| Ga0209471_11710142 | 3300026318 | Soil | VTITSARDKMPFEVTPFYPRLARFGASNFPSAGATNAIVNSNLGN |
| Ga0209160_13504471 | 3300026532 | Soil | ITSARDKMPFEVTPFFPRLARFGAGNQAPAAAPTTAASNTGN |
| Ga0209474_102750422 | 3300026550 | Soil | APVAITSARDKMPFEVTPFFPRLARYGATPTAPVAPTSAANNSGSN |
| Ga0209524_10222652 | 3300027521 | Forest Soil | ARDKMPFEVTPFYPRLARFGVSNFPSAGTTTATVNSNSGN |
| Ga0209527_11377071 | 3300027583 | Forest Soil | MPFEVTPFFPRLARYGANAAAPAASTTAAANSPSGN |
| Ga0208827_11255311 | 3300027641 | Peatlands Soil | VAITSARDKMPFEVTPFYPRLARYGAGAAANPTPNATPTTAANTNTGN |
| Ga0209420_10162555 | 3300027648 | Forest Soil | TSARDKMPFEVTPFYPRLARYGTTNAPGAAPTTAAANSNSSN |
| Ga0209811_100847001 | 3300027821 | Surface Soil | ITSARDKMPFEVTPFFPRLIRYGTGVNAPATPTTASNSGSGN |
| Ga0209811_101034251 | 3300027821 | Surface Soil | TSARDKMPFEVTPFFPRLSRFGSNATPAAAPTTAANSPQTTGN |
| Ga0209039_103071682 | 3300027825 | Bog Forest Soil | DKMPFEVTPFFPRLTRYGGSIAPAAVPTTAANSNSGN |
| Ga0209274_102277562 | 3300027853 | Soil | KMPFEVTPFYPRLARYGAQTVPSAPATAAANSNTSN |
| Ga0209693_101672081 | 3300027855 | Soil | SARDKMPFEVTPFFPRLSRLTSDGNTGNATSASNTAPSN |
| Ga0209283_106255201 | 3300027875 | Vadose Zone Soil | PPVAITSARDKMPFEVTPFFPRLSRYGTTGTPTTAANTAPSN |
| Ga0209380_101998192 | 3300027889 | Soil | SARDKMPFEVTPFYPRLARIGSSTTPSAAPATSAANSNSGN |
| Ga0209380_107610192 | 3300027889 | Soil | SIRDKMPFEVTPFFPRLTRYGSAAPMAALTAATTKQ |
| Ga0209698_113062151 | 3300027911 | Watersheds | SARDKMPFEVTPFFPRLARYGAGVAAPAAAPTTAANSGSGN |
| Ga0265350_1040282 | 3300028013 | Soil | KMPFEVTPFYPRLSRFGATAPGAAPTSAAAANTTPSTTPSN |
| Ga0268265_105438272 | 3300028380 | Switchgrass Rhizosphere | APVAITSARDKMPFEVTPFFPRLTRYGSGPGTPTTANAAPTN |
| Ga0302144_101521562 | 3300028560 | Bog | DKMPFEVTPFYPRLVRWNTTNAQSATPTTASNSPSTN |
| Ga0302219_103271612 | 3300028747 | Palsa | AITSARDKMPFEVTPFYPRLARYGAQTVPSAPATAAANSNPSN |
| Ga0302234_102806342 | 3300028773 | Palsa | ITSARDKMPFEVTPFYPRLARYGVSNAPTAAPTTAANSPSGN |
| Ga0307282_105009081 | 3300028784 | Soil | PVAITSARDKMPFEVTPFFPRLTRINAGGNTGNPTTASNTDQK |
| Ga0307312_102077981 | 3300028828 | Soil | TSARDKMPFEVTPFFPRLTRYGSGANPGSPTSTANATPNN |
| Ga0311338_101145584 | 3300030007 | Palsa | SARDKMPFEVTPFYPRLTRYGTTNGPAAAAAATTANVNPAPNN |
| Ga0302274_101486523 | 3300030041 | Bog | APVAITSARDKMPLEVTPFFPHLMRLSNTDAAASSATTAANSVPTTTPAPTN |
| Ga0302177_104023091 | 3300030053 | Palsa | ARDKMPFEVTPFYPRLARYGTTAPANTPTTAANSTSSN |
| Ga0302176_103058952 | 3300030057 | Palsa | ITSARDKMPFEVTPFYPRLSRFGATPGAAPTSAAAANTTPSPNPSN |
| Ga0311370_107328621 | 3300030503 | Palsa | VAITSARDKMPFEVTPFYPRLARFGAQTVPSAPATAAANSNTSN |
| Ga0311372_126309342 | 3300030520 | Palsa | RDKMPFEVTPFYPRLSRFGATPGAAPTSAAAANTTPSPNPSN |
| Ga0310038_102996353 | 3300030707 | Peatlands Soil | MPFEVTPFYPRLARYGSGNAPATAPTTAANSPSGN |
| Ga0265746_10367812 | 3300030815 | Soil | APVAITSARDKMPFEVTPFYPRLARFGVTATGGAPTSAAAASTTPSATPSN |
| Ga0302180_104960052 | 3300031028 | Palsa | KMPFEVTPFYPRLARYGAQTVPSAPATAAANSNPSN |
| Ga0170823_170404662 | 3300031128 | Forest Soil | RDKMPFEVTPFFPRLARFGTGVAAPAATPTTAAATPNTGN |
| Ga0170824_1071814012 | 3300031231 | Forest Soil | VAITSARDKMPFEVTPFFPRLARYGAGAAPVAPPTTAAATPGTGN |
| (restricted) Ga0255312_11656491 | 3300031248 | Sandy Soil | ITSARDKMPFEVTPFFPRLTRYGSGANPGSPTTANAAPTN |
| Ga0265316_104021551 | 3300031344 | Rhizosphere | FEVTPFFPRLARYGAGAAAQPAAPTTAASNNPTAAN |
| Ga0310686_1015627731 | 3300031708 | Soil | RDKMPFEVTPFYPRLARYGASTTPSATPATAAANSAPGSN |
| Ga0307476_102635461 | 3300031715 | Hardwood Forest Soil | PVAITSARDKMPFEVTPFYPRLARYGSSTTPSAAPATAAGNSNSGTN |
| Ga0307474_102705631 | 3300031718 | Hardwood Forest Soil | TAPVAITSARDKMPFEVTPFFPRLSRYGGNAPTAAPTTAANGPQNSGN |
| Ga0307474_110988371 | 3300031718 | Hardwood Forest Soil | DKMPFEVTPFYPRLARYGSSTTPSAAPATAANSNSGN |
| Ga0307469_114776971 | 3300031720 | Hardwood Forest Soil | RDKMPFEVTPFFPRLTRYGANAPNVGPVSATTASSANVSSPTN |
| Ga0307477_101362491 | 3300031753 | Hardwood Forest Soil | DKMPFEVTPFFPRLARFGASAAPAAAPTTAANSNTGN |
| Ga0307477_108132292 | 3300031753 | Hardwood Forest Soil | RDKMPFEVTPFYPRLARWGAQNAPAATPTTAANSPSGN |
| Ga0307478_117223011 | 3300031823 | Hardwood Forest Soil | AITSARDKMPFEVTPFYPRLARYGSSTTPSAAPATAAGNSNSGTN |
| Ga0310913_111880701 | 3300031945 | Soil | AITSARDKMPFEVTPFFPRLARFGANAAQPAAPTTAANSNSGN |
| Ga0306922_107234592 | 3300032001 | Soil | TSARDKMPFEVTPFFPRLTRYNSGGANGASTSAAANTAPANQ |
| Ga0307471_1008006332 | 3300032180 | Hardwood Forest Soil | RDKMPIEVTPFVPRLTRIVSGGNTGNPTTAANRVQK |
| Ga0335079_113835092 | 3300032783 | Soil | TAPVAITSARDKMPFEVTPFFPRLSRLGAGAAPTAAANNSQNAGN |
| Ga0335081_113656292 | 3300032892 | Soil | AITSVRDKMPFEVTPFFPRLSRLTAGASPNATTASNTPPSN |
| ⦗Top⦘ |