


| Basic Information | |
|---|---|
| Family ID | F041908 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ |
| Number of Associated Samples | 142 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.53 % |
| % of genes near scaffold ends (potentially truncated) | 64.15 % |
| % of genes from short scaffolds (< 2000 bps) | 89.31 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.730 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.321 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.013 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.428 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.75% β-sheet: 0.00% Coil/Unstructured: 56.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF08388 | GIIM | 5.03 |
| PF00078 | RVT_1 | 3.14 |
| PF03401 | TctC | 2.52 |
| PF04392 | ABC_sub_bind | 2.52 |
| PF00589 | Phage_integrase | 1.26 |
| PF02585 | PIG-L | 0.63 |
| PF01790 | LGT | 0.63 |
| PF00106 | adh_short | 0.63 |
| PF00072 | Response_reg | 0.63 |
| PF08843 | AbiEii | 0.63 |
| PF00496 | SBP_bac_5 | 0.63 |
| PF13432 | TPR_16 | 0.63 |
| PF14464 | Prok-JAB | 0.63 |
| PF13592 | HTH_33 | 0.63 |
| PF05598 | DUF772 | 0.63 |
| PF03480 | DctP | 0.63 |
| PF02371 | Transposase_20 | 0.63 |
| PF12770 | CHAT | 0.63 |
| PF05694 | SBP56 | 0.63 |
| PF01272 | GreA_GreB | 0.63 |
| PF00701 | DHDPS | 0.63 |
| PF13181 | TPR_8 | 0.63 |
| PF13763 | DUF4167 | 0.63 |
| PF14534 | DUF4440 | 0.63 |
| PF00753 | Lactamase_B | 0.63 |
| PF00258 | Flavodoxin_1 | 0.63 |
| PF13442 | Cytochrome_CBB3 | 0.63 |
| PF01663 | Phosphodiest | 0.63 |
| PF01797 | Y1_Tnp | 0.63 |
| PF01425 | Amidase | 0.63 |
| PF03466 | LysR_substrate | 0.63 |
| PF13495 | Phage_int_SAM_4 | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.52 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.52 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.26 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.63 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.63 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.63 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.63 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.63 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.63 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.36 % |
| Unclassified | root | N/A | 22.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000655|AF_2010_repII_A100DRAFT_1083199 | Not Available | 562 | Open in IMG/M |
| 3300000886|AL3A1W_1056918 | Not Available | 1102 | Open in IMG/M |
| 3300001593|JGI12635J15846_10198666 | Not Available | 1328 | Open in IMG/M |
| 3300001661|JGI12053J15887_10085062 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
| 3300002074|JGI24748J21848_1045873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300004798|Ga0058859_11713797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
| 3300005167|Ga0066672_10022341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3334 | Open in IMG/M |
| 3300005168|Ga0066809_10008128 | Not Available | 1910 | Open in IMG/M |
| 3300005440|Ga0070705_100990702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300005552|Ga0066701_10741976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300005552|Ga0066701_10814900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 556 | Open in IMG/M |
| 3300005555|Ga0066692_10491506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300005556|Ga0066707_10144638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1502 | Open in IMG/M |
| 3300005650|Ga0075038_11290763 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
| 3300005713|Ga0066905_101392827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300005764|Ga0066903_100998925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1529 | Open in IMG/M |
| 3300005764|Ga0066903_107997543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 542 | Open in IMG/M |
| 3300005842|Ga0068858_101962001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 579 | Open in IMG/M |
| 3300005937|Ga0081455_10003672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 17560 | Open in IMG/M |
| 3300005993|Ga0080027_10136311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 936 | Open in IMG/M |
| 3300006041|Ga0075023_100154528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 848 | Open in IMG/M |
| 3300006055|Ga0097691_1014968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3600 | Open in IMG/M |
| 3300006175|Ga0070712_101288938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300006806|Ga0079220_12111761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300006844|Ga0075428_102018890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 597 | Open in IMG/M |
| 3300006969|Ga0075419_10267042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1147 | Open in IMG/M |
| 3300007076|Ga0075435_101935666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300009038|Ga0099829_11277612 | Not Available | 607 | Open in IMG/M |
| 3300009088|Ga0099830_10110648 | Not Available | 2064 | Open in IMG/M |
| 3300009143|Ga0099792_10643299 | Not Available | 680 | Open in IMG/M |
| 3300009521|Ga0116222_1241287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 779 | Open in IMG/M |
| 3300009523|Ga0116221_1069370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1596 | Open in IMG/M |
| 3300009525|Ga0116220_10083247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1349 | Open in IMG/M |
| 3300009624|Ga0116105_1183839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300009792|Ga0126374_11553843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300009793|Ga0105077_106229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia lata | 853 | Open in IMG/M |
| 3300009812|Ga0105067_1055694 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 638 | Open in IMG/M |
| 3300010038|Ga0126315_10542066 | Not Available | 746 | Open in IMG/M |
| 3300010043|Ga0126380_10246235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1234 | Open in IMG/M |
| 3300010043|Ga0126380_10694011 | Not Available | 817 | Open in IMG/M |
| 3300010043|Ga0126380_11095935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 678 | Open in IMG/M |
| 3300010046|Ga0126384_10096024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2174 | Open in IMG/M |
| 3300010047|Ga0126382_11140904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
| 3300010047|Ga0126382_12404865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300010147|Ga0126319_1423430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300010159|Ga0099796_10375748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 618 | Open in IMG/M |
| 3300010162|Ga0131853_11047810 | Not Available | 624 | Open in IMG/M |
| 3300010358|Ga0126370_10107728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1944 | Open in IMG/M |
| 3300010361|Ga0126378_10814330 | Not Available | 1043 | Open in IMG/M |
| 3300010366|Ga0126379_11239591 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300010375|Ga0105239_11958308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300010398|Ga0126383_11088206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 889 | Open in IMG/M |
| 3300010856|Ga0126358_1234821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300011120|Ga0150983_11208636 | Not Available | 687 | Open in IMG/M |
| 3300011270|Ga0137391_11072552 | Not Available | 653 | Open in IMG/M |
| 3300011412|Ga0137424_1035056 | Not Available | 854 | Open in IMG/M |
| 3300011438|Ga0137451_1271447 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300011444|Ga0137463_1067411 | Not Available | 1340 | Open in IMG/M |
| 3300011444|Ga0137463_1333088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum | 549 | Open in IMG/M |
| 3300012041|Ga0137430_1168416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 632 | Open in IMG/M |
| 3300012199|Ga0137383_11095439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300012202|Ga0137363_10572833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 952 | Open in IMG/M |
| 3300012202|Ga0137363_11192825 | Not Available | 647 | Open in IMG/M |
| 3300012232|Ga0137435_1138156 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300012361|Ga0137360_10754044 | Not Available | 837 | Open in IMG/M |
| 3300012362|Ga0137361_10021755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4903 | Open in IMG/M |
| 3300012487|Ga0157321_1011471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300012918|Ga0137396_10658826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 773 | Open in IMG/M |
| 3300012925|Ga0137419_10155598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1655 | Open in IMG/M |
| 3300012961|Ga0164302_10069494 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300012971|Ga0126369_10068339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3105 | Open in IMG/M |
| 3300012971|Ga0126369_10089299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2758 | Open in IMG/M |
| 3300012971|Ga0126369_11116190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 878 | Open in IMG/M |
| 3300014052|Ga0120109_1012081 | Not Available | 1901 | Open in IMG/M |
| 3300014152|Ga0181533_1197965 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300014320|Ga0075342_1081193 | Not Available | 825 | Open in IMG/M |
| 3300014495|Ga0182015_10838088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300014498|Ga0182019_10067920 | Not Available | 2107 | Open in IMG/M |
| 3300014968|Ga0157379_10580345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1045 | Open in IMG/M |
| 3300015052|Ga0137411_1173254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1870 | Open in IMG/M |
| 3300015053|Ga0137405_1193127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300016294|Ga0182041_12189569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300016319|Ga0182033_11052019 | Not Available | 725 | Open in IMG/M |
| 3300016341|Ga0182035_11919125 | Not Available | 537 | Open in IMG/M |
| 3300017935|Ga0187848_10389753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300017936|Ga0187821_10208904 | Not Available | 752 | Open in IMG/M |
| 3300017955|Ga0187817_10752301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300018019|Ga0187874_10040535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2225 | Open in IMG/M |
| 3300018019|Ga0187874_10386416 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300018028|Ga0184608_10319122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 682 | Open in IMG/M |
| 3300018058|Ga0187766_11103171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300018466|Ga0190268_11253060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 620 | Open in IMG/M |
| 3300019161|Ga0184602_121316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300019257|Ga0180115_1164703 | Not Available | 567 | Open in IMG/M |
| 3300019789|Ga0137408_1363706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 632 | Open in IMG/M |
| 3300020580|Ga0210403_10010724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7449 | Open in IMG/M |
| 3300020580|Ga0210403_10834820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 730 | Open in IMG/M |
| 3300021086|Ga0179596_10100217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 1314 | Open in IMG/M |
| 3300021168|Ga0210406_11170376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300021478|Ga0210402_10206854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1804 | Open in IMG/M |
| 3300021478|Ga0210402_11886678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300021560|Ga0126371_10143800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2439 | Open in IMG/M |
| 3300021560|Ga0126371_10875688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1043 | Open in IMG/M |
| 3300021860|Ga0213851_1161971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300021861|Ga0213853_11228991 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300022527|Ga0242664_1068956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 680 | Open in IMG/M |
| 3300022714|Ga0242671_1083932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum | 583 | Open in IMG/M |
| 3300025315|Ga0207697_10477837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300025457|Ga0208850_1009318 | Not Available | 1902 | Open in IMG/M |
| 3300025898|Ga0207692_10558829 | Not Available | 732 | Open in IMG/M |
| 3300025905|Ga0207685_10115310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1171 | Open in IMG/M |
| 3300025905|Ga0207685_10520392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300025915|Ga0207693_10395187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1081 | Open in IMG/M |
| 3300025949|Ga0207667_11599006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300026217|Ga0209871_1047288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 816 | Open in IMG/M |
| 3300026304|Ga0209240_1049139 | Not Available | 1590 | Open in IMG/M |
| 3300026317|Ga0209154_1037521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2203 | Open in IMG/M |
| 3300026319|Ga0209647_1160151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium uaiense | 923 | Open in IMG/M |
| 3300026345|Ga0257148_1011436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300026369|Ga0257152_1023649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300026870|Ga0208762_1001944 | Not Available | 760 | Open in IMG/M |
| 3300027169|Ga0209897_1052970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300027523|Ga0208890_1002608 | Not Available | 1954 | Open in IMG/M |
| 3300027729|Ga0209248_10237902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300027767|Ga0209655_10109926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 917 | Open in IMG/M |
| 3300027783|Ga0209448_10026352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1931 | Open in IMG/M |
| 3300027821|Ga0209811_10319466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300027854|Ga0209517_10238050 | Not Available | 1098 | Open in IMG/M |
| 3300027854|Ga0209517_10603554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300027903|Ga0209488_10215983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1444 | Open in IMG/M |
| 3300027905|Ga0209415_10049319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5456 | Open in IMG/M |
| 3300027948|Ga0209858_1000327 | All Organisms → cellular organisms → Bacteria | 3010 | Open in IMG/M |
| 3300028885|Ga0307304_10124366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1054 | Open in IMG/M |
| 3300030007|Ga0311338_10300573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1772 | Open in IMG/M |
| 3300030606|Ga0299906_10677151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 776 | Open in IMG/M |
| 3300030877|Ga0265777_117484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300030885|Ga0265743_108622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300030902|Ga0308202_1107744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 583 | Open in IMG/M |
| 3300030989|Ga0308196_1019570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 781 | Open in IMG/M |
| 3300030991|Ga0073994_10024970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 789 | Open in IMG/M |
| 3300031028|Ga0302180_10652046 | Not Available | 503 | Open in IMG/M |
| 3300031152|Ga0307501_10161424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 616 | Open in IMG/M |
| 3300031242|Ga0265329_10068836 | Not Available | 1120 | Open in IMG/M |
| 3300031422|Ga0308186_1025525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 590 | Open in IMG/M |
| 3300031469|Ga0170819_12724220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 591 | Open in IMG/M |
| 3300031572|Ga0318515_10119489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. PW1 | 1392 | Open in IMG/M |
| 3300031573|Ga0310915_10041479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2933 | Open in IMG/M |
| 3300031573|Ga0310915_11148996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
| 3300031744|Ga0306918_11204679 | Not Available | 584 | Open in IMG/M |
| 3300031744|Ga0306918_11312880 | Not Available | 556 | Open in IMG/M |
| 3300031770|Ga0318521_10601477 | Not Available | 665 | Open in IMG/M |
| 3300031846|Ga0318512_10336381 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300031858|Ga0310892_11033422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300031893|Ga0318536_10132372 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300031944|Ga0310884_10541015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 689 | Open in IMG/M |
| 3300031945|Ga0310913_10121936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1781 | Open in IMG/M |
| 3300032035|Ga0310911_10782635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300032160|Ga0311301_11092217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1039 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.32% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.92% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.40% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.14% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.89% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.89% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.89% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.26% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.26% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.26% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.26% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.26% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.26% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.63% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.63% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.63% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.63% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.63% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.63% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.63% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.63% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.63% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.63% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.63% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.63% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.63% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.63% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_055 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009793 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 | Environmental | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010856 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026345 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-A | Environmental | Open in IMG/M |
| 3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
| 3300026870 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027948 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030885 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031422 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A100DRAFT_10831991 | 3300000655 | Forest Soil | VLEMKVGPSGSAIRSLIPSHRKLLQSKAVVVSVAEKPGR* |
| AL3A1W_10569182 | 3300000886 | Permafrost | EMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ* |
| JGI12635J15846_101986661 | 3300001593 | Forest Soil | MKVGPSGSAIGSLIPSRRGPLWSKATVVSAAERLDND |
| JGI12053J15887_100850621 | 3300001661 | Forest Soil | CTRVKEAPSSSAIRSLIPSHRKLLWSKAVVVRVAAI* |
| JGI24748J21848_10458731 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | VLEMKEGPSGSAIRSLIPSHHERLWSKATVVSVAETSGR* |
| Ga0058859_117137971 | 3300004798 | Host-Associated | ATVLEMKEGPSGSAIRSLIPSHRERLWSKATVVSVAETSGR* |
| Ga0066672_100223411 | 3300005167 | Soil | MKEGPSGSAIRSLIPSHRKLLSSKATVVNVAEKSEHDSGRHG* |
| Ga0066809_100081281 | 3300005168 | Soil | VTVREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETPGQ* |
| Ga0070705_1009907022 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RATVLEMKEGPSGSAIRSLIPSHRERLWSKATVVSVAETSGR* |
| Ga0066701_107419761 | 3300005552 | Soil | VREMKEGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPGR* |
| Ga0066701_108149001 | 3300005552 | Soil | REMKEGPSGSAIRSLIPSHRKLLRSKAVVVSVAETSGR* |
| Ga0066692_104915062 | 3300005555 | Soil | TVREMKEGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPGR* |
| Ga0066707_101446384 | 3300005556 | Soil | MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETPGQ* |
| Ga0075038_112907632 | 3300005650 | Permafrost Soil | MKEGPSGSAIRSLIPSHRKLLSSKAMVVNVAETSGQ* |
| Ga0066905_1013928271 | 3300005713 | Tropical Forest Soil | SKRRCVTVLEMKVGPSGSAIRSLIPSHRELLRSNAVVVSVAEKSGQ* |
| Ga0066903_1009989253 | 3300005764 | Tropical Forest Soil | MKEDPSGSAIRSLIPNYRKLLRSKAVVVSVAEKSGQ* |
| Ga0066903_1079975432 | 3300005764 | Tropical Forest Soil | EDPSDSAIRSLIPNHRKLLRPKAVVVSVAEESEQ* |
| Ga0068858_1019620011 | 3300005842 | Switchgrass Rhizosphere | MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETPGR* |
| Ga0081455_1000367216 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKEGPSGSAIRPLIQSHRELLGPKAALVSVADTPGP* |
| Ga0080027_101363112 | 3300005993 | Prmafrost Soil | MKEGPSGSAIRSLIPSHRELLSSKAMVVNVAEKSE* |
| Ga0075023_1001545282 | 3300006041 | Watersheds | MKEGPSGSAIRSLIPSHRKLLSSKAMVVNVAEKSGQ* |
| Ga0097691_10149685 | 3300006055 | Arctic Peat Soil | MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ* |
| Ga0070712_1012889382 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKEGPSGSAIRSLILSHRKLLSSKAMVVNVAETSGQ* |
| Ga0079220_121117611 | 3300006806 | Agricultural Soil | PEMKEGPSDSAIRSLIPNHRKLLRSKAVVVNVAEKLGR* |
| Ga0075428_1020188901 | 3300006844 | Populus Rhizosphere | KEGPSGSAIRSLIPSHRERLWSKATVVSVAETSGP* |
| Ga0075419_102670422 | 3300006969 | Populus Rhizosphere | MEEGPSGSAIRSLIPNHRELLRSKAGVVSIAETSGQ* |
| Ga0075435_1019356661 | 3300007076 | Populus Rhizosphere | EMKEGPSGSAIRSLIPSHRKLLWSKSMVVSVAEKSGR* |
| Ga0099829_112776122 | 3300009038 | Vadose Zone Soil | MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSG |
| Ga0099830_101106481 | 3300009088 | Vadose Zone Soil | TVREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ* |
| Ga0099792_106432991 | 3300009143 | Vadose Zone Soil | MKEGPSGSAIRSLIPSHRELLSSKAMVVNVAEKSG* |
| Ga0116222_12412871 | 3300009521 | Peatlands Soil | PSGSAIRSLIPSHRKLLSSKAMVVNVAEKSEQDSDRHD* |
| Ga0116221_10693702 | 3300009523 | Peatlands Soil | MKEGLSGSAIRSLIPSHRKLLSSKAMVVNVAETSGQ* |
| Ga0116220_100832472 | 3300009525 | Peatlands Soil | MKDGPSGSAIRSLIPSHRKLLSSKAMVVNVAETSGQ* |
| Ga0116105_11838392 | 3300009624 | Peatland | VREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ* |
| Ga0126374_115538431 | 3300009792 | Tropical Forest Soil | EMKEGPSGSVIRSLIPSHREPLRSKAVVVSVAETPGQ* |
| Ga0105077_1062292 | 3300009793 | Groundwater Sand | MKEGASGSAIRSLIPSHRELLRSKAVVVSVTEKSGL* |
| Ga0105067_10556941 | 3300009812 | Groundwater Sand | ATVREMKEGPSGSAIRSLNPSHCKLLRSKAVVVSVAEKPGL* |
| Ga0126315_105420662 | 3300010038 | Serpentine Soil | MKEGPSGSAIRSLIPSHRKLLLSKAMVVNVADKSEQDSSRQG* |
| Ga0126380_102462353 | 3300010043 | Tropical Forest Soil | MKEDPSDSAIRSLIPNHRKLLRSKAVVVNVAEKSGQ* |
| Ga0126380_106940111 | 3300010043 | Tropical Forest Soil | MRNCAGDEGPSGSVIKSLIPGHRELLRSKAAVVSIAEKGE |
| Ga0126380_110959352 | 3300010043 | Tropical Forest Soil | MKEDPSGSAIRSLIPNHRKLLRSKAVVVNVAEKSEQ* |
| Ga0126384_100960243 | 3300010046 | Tropical Forest Soil | MRLHATVLEMKEGPSGSAIRSLIPKHRKLLRSKAVVVSVAEKSGR* |
| Ga0126382_111409042 | 3300010047 | Tropical Forest Soil | MKEGPSGSAIKSLVLSHRKLLWSKAVVVRCGNAGTMIR |
| Ga0126382_124048651 | 3300010047 | Tropical Forest Soil | MKEDPSGSAIRSLIPNYRKLLRSKAAVVSVAEKSEQ* |
| Ga0126319_14234301 | 3300010147 | Soil | GPSGSAIRSLIPSHRELLRSKAVVVSVAEKSGHDPVRHG* |
| Ga0099796_103757481 | 3300010159 | Vadose Zone Soil | KEGPTGSAIRSLIPSHRKLLRSKAVVVSVAETSGHDPGRHG* |
| Ga0131853_110478102 | 3300010162 | Termite Gut | MKEGPSSSVIREPISSHRKLLRAKAVVVSVAETPGPDF |
| Ga0126370_101077281 | 3300010358 | Tropical Forest Soil | TVLEMKVGPSGSAIRPLIPSHRKLLLPKSVVVSVAEKSGQ* |
| Ga0126378_108143301 | 3300010361 | Tropical Forest Soil | MKEGPSGSAIMSLIPSHCKLLSSKAMVVNVAEKSGR* |
| Ga0126379_112395912 | 3300010366 | Tropical Forest Soil | MKEGPSGSAIRSLIPSHCKLLSSKAMVVNVAEKSGMIPAGKV |
| Ga0105239_119583081 | 3300010375 | Corn Rhizosphere | EMKEGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPGR* |
| Ga0126383_110882061 | 3300010398 | Tropical Forest Soil | TVLEMKVGPSGSAIRSLIPSHRKLLRSKAVVVSVAEKSGQ* |
| Ga0126358_12348212 | 3300010856 | Boreal Forest Soil | REMKEGPSGSAIRSLIPSHRKLLWSKATVVSVAETSGR* |
| Ga0150983_112086361 | 3300011120 | Forest Soil | MKEGPSGSAIRSLIPSHRELLSSKATVVNVAEKSE* |
| Ga0137391_110725522 | 3300011270 | Vadose Zone Soil | MKEGPSGSAIRSLIPSHRELLSSKAMVVNVAEKLE* |
| Ga0137424_10350563 | 3300011412 | Soil | TVRKMEVGPPGSAIRSLIPSYRELLRSRAVVASVTETSGR* |
| Ga0137451_12714471 | 3300011438 | Soil | TVQEMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAEKSGR* |
| Ga0137463_10674112 | 3300011444 | Soil | MKEGPSGSAIGSLIPSQRELLRSKAVVVSVAEMSGQ* |
| Ga0137463_13330881 | 3300011444 | Soil | RATVLEMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAEKSGHDPVRHG* |
| Ga0137430_11684161 | 3300012041 | Soil | TVLEMKEGPSGSAIRSSIPSHRERLWSKATVVSVAEKPGH* |
| Ga0137383_110954392 | 3300012199 | Vadose Zone Soil | MKDGPSGSAIRLLIPSHRKLLSSKAMVVNVAETSGQ* |
| Ga0137363_105728331 | 3300012202 | Vadose Zone Soil | MKEGPSGSAIRSLMPSHRELLSSKATVVNVAEKSE* |
| Ga0137363_111928251 | 3300012202 | Vadose Zone Soil | EGPSGSAIRSLIPSHRELLRSKAVVVSVAETPGQ* |
| Ga0137435_11381562 | 3300012232 | Soil | MKEGPLGSVIRSLISSHRKLLRSKAMVVSVAETSVTIQPL* |
| Ga0137360_107540442 | 3300012361 | Vadose Zone Soil | MKEGPSGSVIRSLIPSHREALRSKAVVVSVAETPGQ* |
| Ga0137361_100217558 | 3300012362 | Vadose Zone Soil | MKEGPSGSAIRSLIPSHCKLLSSKAMVVNVAEKSG |
| Ga0157321_10114711 | 3300012487 | Arabidopsis Rhizosphere | KEGPSDSAIRSLISNHRKLLRSKAGVVSVAEKSGR* |
| Ga0137396_106588261 | 3300012918 | Vadose Zone Soil | MKEGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPGR* |
| Ga0137419_101555982 | 3300012925 | Vadose Zone Soil | MKEGPSGSAIRSLIPSHRKLLSSKAMVVNVAETSGL* |
| Ga0164302_100694942 | 3300012961 | Soil | MKGGPSGSAIRPLIPSHRKLLWSKAMVVSVAGNAGTM |
| Ga0126369_100683393 | 3300012971 | Tropical Forest Soil | MKEGPSGSAIMSLIPSHCKLLSSKAMVVSIEKKPK* |
| Ga0126369_100892991 | 3300012971 | Tropical Forest Soil | KEDPSDSAIRSLIPNHRKLLRSKAVVVSVTEKSGQ* |
| Ga0126369_111161902 | 3300012971 | Tropical Forest Soil | SKRRCVTVLEMKVGPSGSAIRSLIPSHRKLLRSKAVVVSVAETPGR* |
| Ga0120109_10120812 | 3300014052 | Permafrost | AVREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ* |
| Ga0181533_11979651 | 3300014152 | Bog | MKEGPSGSAIRSLIPSHCKLLWSKATVVNVAEKPEQEF |
| Ga0075342_10811932 | 3300014320 | Natural And Restored Wetlands | MKEGPSGSVIRSLIPSHRKLLRSKAVVVSVAEKSGHHPGKHG* |
| Ga0182015_108380881 | 3300014495 | Palsa | TRLRATVREMKEGPSGSAIRSLIPSHRELLRSKAAVVSVAETSGQ* |
| Ga0182019_100679203 | 3300014498 | Fen | MKEGPSGSAIRSLIPSHRKLLWSKAMVGSVAEKPGQ* |
| Ga0157379_105803453 | 3300014968 | Switchgrass Rhizosphere | EMKEGPSGSAIRSLIPSHRERLWSKAMVVSVAETSGR* |
| Ga0137411_11732541 | 3300015052 | Vadose Zone Soil | MTEGPSGSAIRSLIPSHCKLLSSKAMVVNVAEKSGR |
| Ga0137405_11931271 | 3300015053 | Vadose Zone Soil | GTVREMKEGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPGR* |
| Ga0182041_121895691 | 3300016294 | Soil | ATVREMKEGPSGSVIRSLIPSHREPLRSKAVVVSVAETPGQ |
| Ga0182033_110520191 | 3300016319 | Soil | MKEDPSDSAIRSLIPNHRKLLRSKAVVVNVAEKSG |
| Ga0182035_119191251 | 3300016341 | Soil | KEGPSGSAIRSLIPSHRELLRSKTVVVSVAETPGQ |
| Ga0187848_103897531 | 3300017935 | Peatland | RLRATVREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ |
| Ga0187821_102089042 | 3300017936 | Freshwater Sediment | RCVTVREMKEGPSGSVIRSLIPSHCKLLSSKAMVVNVAEKSGR |
| Ga0187817_107523011 | 3300017955 | Freshwater Sediment | TVREMKEGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPGR |
| Ga0187874_100405353 | 3300018019 | Peatland | WEMKVGPSGSVIRSLIPSHRELLRSKAVVVSVAETSGQ |
| Ga0187874_103864162 | 3300018019 | Peatland | VREMKEGPSGSAIRSLIPSHRELLSSKAMVVKVAETSGQ |
| Ga0184608_103191221 | 3300018028 | Groundwater Sediment | EMKEGPSGSAIRSLIPSHRKLLRSKAVVVSVAETSGHDPGRHG |
| Ga0187766_111031711 | 3300018058 | Tropical Peatland | CVTVREMKAGPSGSAIRSLITSHCKLLSSKAPVVNVAEKSGR |
| Ga0190268_112530601 | 3300018466 | Soil | EMKEGPSGSAIRSLIPSHRKLLRSKVVVVSVAEKSGHDPGRHG |
| Ga0184602_1213162 | 3300019161 | Soil | MKEGPSGSAIRSLIPSHRKLLSSKAMVVNVAETSGQ |
| Ga0180115_11647031 | 3300019257 | Groundwater Sediment | ATVLEMKEGPSGSAIRSLIPSHRELLRPKAVVVSVAETSGQ |
| Ga0137408_13637062 | 3300019789 | Vadose Zone Soil | MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETPGQ |
| Ga0210403_100107247 | 3300020580 | Soil | MKEGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPGR |
| Ga0210403_108348202 | 3300020580 | Soil | MKEGPSGSAIRSLIPSHRELLSSKATVVNVAEKSE |
| Ga0179596_101002171 | 3300021086 | Vadose Zone Soil | MKEGPSGSAIRSLIPSHRELLSSKAMVVNVAEKSG |
| Ga0210406_111703761 | 3300021168 | Soil | MKEGPSGSVIRSLIPSHRELLRSKAVVVSVAETPGQ |
| Ga0210402_102068541 | 3300021478 | Soil | MKEGPSGSAIRSLIPSHRKLLSSKAMVVNVAEKSGQ |
| Ga0210402_118866782 | 3300021478 | Soil | REMEEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ |
| Ga0126371_101438001 | 3300021560 | Tropical Forest Soil | MKEGPSGSAIMSLIPSHCKLLSSKAMVVNVAEKSGR |
| Ga0126371_108756882 | 3300021560 | Tropical Forest Soil | MRLHATVLEMKEGPSGSAIRSLIPKHRKLLRSKAVVVSVAEKSGR |
| Ga0213851_11619711 | 3300021860 | Watersheds | RATVREMKEGPSGSAIRSLIPSHRELLRSKVVVVSVAETSGQ |
| Ga0213853_112289912 | 3300021861 | Watersheds | MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETPG |
| Ga0242664_10689561 | 3300022527 | Soil | MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAEKPGQ |
| Ga0242671_10839321 | 3300022714 | Soil | RRYATVREMKEGPSGSAIRSLIPSHRELLSSKATVVNVAEKSE |
| Ga0207697_104778371 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | KMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETPGQ |
| Ga0208850_10093182 | 3300025457 | Arctic Peat Soil | MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ |
| Ga0207692_105588291 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVREMKEGPSGSAIRSLIPSHCKLLSSKALVVNVAEKSGR |
| Ga0207685_101153101 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GSDGCATVLEMKEGPSGSVIRSLIPSHRELLRSNAVVVSVAEKSGR |
| Ga0207685_105203921 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | EMEEGPSGSAIRSLIPSHHKLLRSKAVVVSVVEKSGL |
| Ga0207693_103951873 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKEGPSGSAIRSLILSHRKLLSSKAMVVNVAETSGQ |
| Ga0207667_115990062 | 3300025949 | Corn Rhizosphere | TVLKMKEGPSGSAIRSLIPSHRELLRSKALVVSVAETSGR |
| Ga0209871_10472882 | 3300026217 | Permafrost Soil | MKEGPSGSAIRSLIPSHRELLSSKAMVVNVAEKSE |
| Ga0209240_10491391 | 3300026304 | Grasslands Soil | MKEGPSGSAIRSLIPSHRKLLWSKPVVVSVAETPGQ |
| Ga0209154_10375213 | 3300026317 | Soil | MKEGPSGSAIRSLIPSHRKLLSSKATVVNVAEKSEHDSGRHG |
| Ga0209647_11601511 | 3300026319 | Grasslands Soil | MKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETLGQ |
| Ga0257148_10114361 | 3300026345 | Soil | VREMKEGPSGSAIRSLIPSHCKLLSSKAMVVNVAEKSGR |
| Ga0257152_10236491 | 3300026369 | Soil | EMKEGPSGSAIRSLIPSHCKLLSSKAMVVNVAEKSGR |
| Ga0208762_10019441 | 3300026870 | Soil | KEGPSGSAIRSLIPSHRELLRSKAVVVSVAETPGQ |
| Ga0209897_10529702 | 3300027169 | Groundwater Sand | MKEGASGSAIRSLIPSHRELLRSKAVVVSVTEKSGL |
| Ga0208890_10026083 | 3300027523 | Soil | EMKEGPSGSAIRSLIPSHRELLRSKAVVASVAETSGQ |
| Ga0209248_102379021 | 3300027729 | Bog Forest Soil | MKDGPSGSAIRSLIPSHRKLLSSKAMVVNVAEKSGQ |
| Ga0209655_101099263 | 3300027767 | Bog Forest Soil | MKEGPSGSAIGSLIPSHRELLSSKATVVNVAEKSEQDFDRHD |
| Ga0209448_100263523 | 3300027783 | Bog Forest Soil | MKDGPSGSAIRSLIPSHRKLLSSKAMVVNVAETSGQ |
| Ga0209811_103194661 | 3300027821 | Surface Soil | EMKEGPSGSAIRSLIPSHHERLWSKATVVSVAETSGR |
| Ga0209517_102380502 | 3300027854 | Peatlands Soil | MKEGPSGSAIRSLIPSHRKLLSSKAMVVNVAEMPGQ |
| Ga0209517_106035542 | 3300027854 | Peatlands Soil | EMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ |
| Ga0209488_102159831 | 3300027903 | Vadose Zone Soil | MKAGPSGSAIRSLIPSHRELLRSKAVVVSVAETSG |
| Ga0209415_100493194 | 3300027905 | Peatlands Soil | MKEGLSGSAIRSLIPSHRKLLSSKAMVVNVAETSGQ |
| Ga0209858_10003274 | 3300027948 | Groundwater Sand | EMEEGPSGSAIRSPIPSHRELLRPKAVVVSVAEKPGR |
| Ga0307304_101243664 | 3300028885 | Soil | IREMKEGPSGSAIRSLIPSHRELLRSKAGVVSVTETPGR |
| Ga0311338_103005731 | 3300030007 | Palsa | MKEGPSGSAIRSLIPSHRELLSSKAMVVKVAETSGQ |
| Ga0299906_106771511 | 3300030606 | Soil | KRRCATVLEMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGR |
| Ga0265777_1174841 | 3300030877 | Soil | RATVREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGR |
| Ga0265743_1086221 | 3300030885 | Soil | TVREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ |
| Ga0308202_11077442 | 3300030902 | Soil | ATVREMKEGPSGSAIRSLIPSHRELLRSNAVVVSVAETSGQ |
| Ga0308196_10195702 | 3300030989 | Soil | MKDGPSGSAIRLLIPSHRKLLSSKAMVVNVAETSGQ |
| Ga0073994_100249701 | 3300030991 | Soil | TVREMKEGPSGSAIRSLIPSHRELLSSKATVVNVAEKSE |
| Ga0302180_106520462 | 3300031028 | Palsa | MKEGPSGSAIRSLIPSHRELLRPKAVVVSGAETSGQ |
| Ga0307501_101614241 | 3300031152 | Soil | VLEMKEGPSGSVIRSPIPSHRELLRSNAVVVSVAETSGQ |
| Ga0265329_100688361 | 3300031242 | Rhizosphere | LRATVREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGQ |
| Ga0308186_10255251 | 3300031422 | Soil | TVREMKEGPSGSAIRSLIPSHRELLRSKAVVVSVAETSGL |
| Ga0170819_127242201 | 3300031469 | Forest Soil | MKEGPSGSAIRSPIPSHRELLRSKAVVVSVAETSGQ |
| Ga0318515_101194891 | 3300031572 | Soil | GSAIRSLIPNHRKLLRSKAVVVSVAEKSGQDPGEPRHVT |
| Ga0310915_100414791 | 3300031573 | Soil | RRCATVLEMKEDPSDSAIRSLIPNHRKLLRSKAVVVNVAEKSGQ |
| Ga0310915_111489961 | 3300031573 | Soil | SKRRCVTVLERKAGPSGSAIRSLIPSDRKLLRSKAVVVSVAEK |
| Ga0306918_112046791 | 3300031744 | Soil | KEDPSDSAIRSLIPNHRKLLRSKAVVVNVAEKSGQ |
| Ga0306918_113128801 | 3300031744 | Soil | MKEGPSGSAIRSLIPNHRKLLWSKLTVVSVAETPGR |
| Ga0318521_106014772 | 3300031770 | Soil | MKEDPSDSAIRSLIPNHRKLLRSKAVVVNVAEKSGQ |
| Ga0307478_104650782 | 3300031823 | Hardwood Forest Soil | VTSNAGPHGGCVTVREMKAGPSGSAIRSLTPSHCKLLSSKAMVVNVAEKSGR |
| Ga0318512_103363812 | 3300031846 | Soil | MKDGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPG |
| Ga0310892_110334222 | 3300031858 | Soil | REMKEGPSGSAIRSLIPSHRKLLWSKVTVVSVAETPGR |
| Ga0318536_101323722 | 3300031893 | Soil | CATVLEMKEDPSDSAIRSLIPNHRKLLRSKAVVVNVAEKSGQ |
| Ga0310884_105410152 | 3300031944 | Soil | VLEMKEGPSGSAIRSLIPSHRERLWPKAMVVSVAETSRR |
| Ga0310913_101219361 | 3300031945 | Soil | EMKEDPSDSAIRSLIPNHRKLLRSKAVVVNVAEKSGQ |
| Ga0310911_107826352 | 3300032035 | Soil | VTVLEMKEGPSGSAIRSLIPSHRKLLWSKSMVVSVAEKSGR |
| Ga0311301_110922171 | 3300032160 | Peatlands Soil | MKDGPSGSAIRSLIPSHRKLLSSKAMAVNVAEKSGQ |
| ⦗Top⦘ |