


| Basic Information | |
|---|---|
| Family ID | F041718 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLAELGLR |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.91 % |
| % of genes near scaffold ends (potentially truncated) | 89.31 % |
| % of genes from short scaffolds (< 2000 bps) | 89.94 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.925 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock (16.352 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.868 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (35.849 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.14% β-sheet: 37.68% Coil/Unstructured: 52.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF01609 | DDE_Tnp_1 | 2.52 |
| PF13408 | Zn_ribbon_recom | 1.89 |
| PF02371 | Transposase_20 | 1.89 |
| PF04199 | Cyclase | 1.26 |
| PF01575 | MaoC_dehydratas | 1.26 |
| PF13586 | DDE_Tnp_1_2 | 1.26 |
| PF13701 | DDE_Tnp_1_4 | 1.26 |
| PF00665 | rve | 1.26 |
| PF13751 | DDE_Tnp_1_6 | 1.26 |
| PF13358 | DDE_3 | 1.26 |
| PF01548 | DEDD_Tnp_IS110 | 1.26 |
| PF00216 | Bac_DNA_binding | 1.26 |
| PF03401 | TctC | 0.63 |
| PF13609 | Porin_4 | 0.63 |
| PF13362 | Toprim_3 | 0.63 |
| PF06202 | GDE_C | 0.63 |
| PF00078 | RVT_1 | 0.63 |
| PF08281 | Sigma70_r4_2 | 0.63 |
| PF00108 | Thiolase_N | 0.63 |
| PF13610 | DDE_Tnp_IS240 | 0.63 |
| PF00903 | Glyoxalase | 0.63 |
| PF03626 | COX4_pro | 0.63 |
| PF01656 | CbiA | 0.63 |
| PF00118 | Cpn60_TCP1 | 0.63 |
| PF13155 | Toprim_2 | 0.63 |
| PF13333 | rve_2 | 0.63 |
| PF03640 | Lipoprotein_15 | 0.63 |
| PF05992 | SbmA_BacA | 0.63 |
| PF00872 | Transposase_mut | 0.63 |
| PF01471 | PG_binding_1 | 0.63 |
| PF00589 | Phage_integrase | 0.63 |
| PF05974 | DUF892 | 0.63 |
| PF14106 | DUF4279 | 0.63 |
| PF13591 | MerR_2 | 0.63 |
| PF01408 | GFO_IDH_MocA | 0.63 |
| PF00528 | BPD_transp_1 | 0.63 |
| PF13551 | HTH_29 | 0.63 |
| PF07969 | Amidohydro_3 | 0.63 |
| PF13384 | HTH_23 | 0.63 |
| PF06745 | ATPase | 0.63 |
| PF00593 | TonB_dep_Rec | 0.63 |
| PF02534 | T4SS-DNA_transf | 0.63 |
| PF00574 | CLP_protease | 0.63 |
| PF12762 | DDE_Tnp_IS1595 | 0.63 |
| PF01610 | DDE_Tnp_ISL3 | 0.63 |
| PF00529 | CusB_dom_1 | 0.63 |
| PF10335 | DUF294_C | 0.63 |
| PF12760 | Zn_Tnp_IS1595 | 0.63 |
| PF13340 | DUF4096 | 0.63 |
| PF08240 | ADH_N | 0.63 |
| PF07508 | Recombinase | 0.63 |
| PF08734 | GYD | 0.63 |
| PF05973 | Gp49 | 0.63 |
| PF13188 | PAS_8 | 0.63 |
| PF00171 | Aldedh | 0.63 |
| PF03466 | LysR_substrate | 0.63 |
| PF13737 | DDE_Tnp_1_5 | 0.63 |
| PF05853 | BKACE | 0.63 |
| PF02515 | CoA_transf_3 | 0.63 |
| PF13495 | Phage_int_SAM_4 | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 3.14 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.52 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.52 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.52 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.52 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.52 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.52 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.26 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.26 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.26 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 1.26 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 1.26 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 1.26 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 1.26 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 1.26 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.63 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.63 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.63 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.63 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.63 |
| COG3125 | Heme/copper-type cytochrome/quinol oxidase, subunit 4 | Energy production and conversion [C] | 0.63 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.63 |
| COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.63 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.63 |
| COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 0.63 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.63 |
| COG3505 | Type IV secretory pathway, VirD4 component, TraG/TraD family ATPase | Intracellular trafficking, secretion, and vesicular transport [U] | 0.63 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.63 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.63 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.63 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.63 |
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.63 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.92 % |
| Unclassified | root | N/A | 32.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2209111000|2209888357 | Not Available | 515 | Open in IMG/M |
| 3300001686|C688J18823_11093867 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300003219|JGI26341J46601_10209711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 527 | Open in IMG/M |
| 3300003368|JGI26340J50214_10093439 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300004152|Ga0062386_100967143 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300005184|Ga0066671_10203524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1192 | Open in IMG/M |
| 3300005366|Ga0070659_101729116 | Not Available | 560 | Open in IMG/M |
| 3300005506|Ga0068912_11170667 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005539|Ga0068853_101700247 | Not Available | 612 | Open in IMG/M |
| 3300005602|Ga0070762_10781111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 645 | Open in IMG/M |
| 3300005618|Ga0068864_102564712 | Not Available | 516 | Open in IMG/M |
| 3300005718|Ga0068866_10505249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 800 | Open in IMG/M |
| 3300006642|Ga0075521_10067977 | Not Available | 1588 | Open in IMG/M |
| 3300006642|Ga0075521_10503377 | Not Available | 594 | Open in IMG/M |
| 3300006794|Ga0066658_10113121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1310 | Open in IMG/M |
| 3300006804|Ga0079221_11075982 | Not Available | 612 | Open in IMG/M |
| 3300006806|Ga0079220_10033072 | All Organisms → cellular organisms → Bacteria | 2310 | Open in IMG/M |
| 3300006806|Ga0079220_10716391 | Not Available | 739 | Open in IMG/M |
| 3300006881|Ga0068865_101893239 | Not Available | 540 | Open in IMG/M |
| 3300006893|Ga0073928_11048778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 554 | Open in IMG/M |
| 3300009098|Ga0105245_10679253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1062 | Open in IMG/M |
| 3300009174|Ga0105241_11303963 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300009400|Ga0116854_1099259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Dankookia → Dankookia rubra | 697 | Open in IMG/M |
| 3300009701|Ga0116228_11181569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 505 | Open in IMG/M |
| 3300009709|Ga0116227_10769438 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300009789|Ga0126307_10582305 | Not Available | 904 | Open in IMG/M |
| 3300009789|Ga0126307_11518545 | Not Available | 543 | Open in IMG/M |
| 3300009840|Ga0126313_10579794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 903 | Open in IMG/M |
| 3300009840|Ga0126313_11191027 | Not Available | 628 | Open in IMG/M |
| 3300010036|Ga0126305_10903999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas wenyumeiae | 603 | Open in IMG/M |
| 3300010037|Ga0126304_10076495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. | 2081 | Open in IMG/M |
| 3300010037|Ga0126304_11051859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. | 556 | Open in IMG/M |
| 3300010037|Ga0126304_11224868 | Not Available | 515 | Open in IMG/M |
| 3300010038|Ga0126315_10224197 | Not Available | 1140 | Open in IMG/M |
| 3300010040|Ga0126308_10806967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Paracraurococcus → Paracraurococcus ruber | 650 | Open in IMG/M |
| 3300010041|Ga0126312_10381047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1001 | Open in IMG/M |
| 3300010041|Ga0126312_10433170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga ossetica | 937 | Open in IMG/M |
| 3300010042|Ga0126314_10268311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1213 | Open in IMG/M |
| 3300010044|Ga0126310_11435484 | Not Available | 564 | Open in IMG/M |
| 3300010044|Ga0126310_11465542 | Not Available | 559 | Open in IMG/M |
| 3300010044|Ga0126310_11628626 | Not Available | 534 | Open in IMG/M |
| 3300010045|Ga0126311_10493153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Chelatococcaceae → Chelatococcus → Chelatococcus reniformis | 957 | Open in IMG/M |
| 3300010045|Ga0126311_10741043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium rhizogenes | 788 | Open in IMG/M |
| 3300010146|Ga0126320_1000403 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300010146|Ga0126320_1094572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 563 | Open in IMG/M |
| 3300010166|Ga0126306_10290913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1256 | Open in IMG/M |
| 3300010341|Ga0074045_10061827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2673 | Open in IMG/M |
| 3300010373|Ga0134128_12156827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Brucellaceae → Brucella/Ochrobactrum group → Brucella → Brucella pinnipedialis | 614 | Open in IMG/M |
| 3300010375|Ga0105239_10804847 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300010403|Ga0134123_13294443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300011106|Ga0151489_1191645 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300011119|Ga0105246_10036648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3287 | Open in IMG/M |
| 3300012212|Ga0150985_100644815 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300012212|Ga0150985_101419487 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300012212|Ga0150985_103492398 | Not Available | 751 | Open in IMG/M |
| 3300012212|Ga0150985_108687777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 871 | Open in IMG/M |
| 3300012212|Ga0150985_111270296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1334 | Open in IMG/M |
| 3300012212|Ga0150985_113944519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 745 | Open in IMG/M |
| 3300012212|Ga0150985_114228141 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300012212|Ga0150985_115826498 | Not Available | 720 | Open in IMG/M |
| 3300012212|Ga0150985_119637641 | Not Available | 691 | Open in IMG/M |
| 3300012212|Ga0150985_121165118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → unclassified Belnapia → Belnapia sp. F-4-1 | 840 | Open in IMG/M |
| 3300012469|Ga0150984_103276316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia moabensis | 879 | Open in IMG/M |
| 3300012469|Ga0150984_111549901 | Not Available | 536 | Open in IMG/M |
| 3300012469|Ga0150984_114850637 | Not Available | 603 | Open in IMG/M |
| 3300012469|Ga0150984_119721105 | Not Available | 610 | Open in IMG/M |
| 3300012469|Ga0150984_122596039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 1234 | Open in IMG/M |
| 3300013308|Ga0157375_10124501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2691 | Open in IMG/M |
| 3300014487|Ga0182000_10392279 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300014488|Ga0182001_10087971 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300014488|Ga0182001_10178233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 755 | Open in IMG/M |
| 3300014968|Ga0157379_10790286 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300014969|Ga0157376_10738711 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300015262|Ga0182007_10368739 | Not Available | 543 | Open in IMG/M |
| 3300018037|Ga0187883_10327039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 783 | Open in IMG/M |
| 3300018046|Ga0187851_10351164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 848 | Open in IMG/M |
| 3300018431|Ga0066655_11341188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis | 516 | Open in IMG/M |
| 3300018468|Ga0066662_12828241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300018469|Ga0190270_10494044 | Not Available | 1164 | Open in IMG/M |
| 3300018920|Ga0190273_11832568 | Not Available | 554 | Open in IMG/M |
| 3300018946|Ga0193599_1151641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Belnapia → Belnapia mucosa | 746 | Open in IMG/M |
| 3300019377|Ga0190264_10903205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
| 3300020021|Ga0193726_1199596 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300021170|Ga0210400_10260625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1419 | Open in IMG/M |
| 3300021170|Ga0210400_10651841 | Not Available | 867 | Open in IMG/M |
| 3300021362|Ga0213882_10059398 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300021374|Ga0213881_10064696 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300021377|Ga0213874_10046506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1317 | Open in IMG/M |
| 3300021404|Ga0210389_11273597 | Not Available | 564 | Open in IMG/M |
| 3300021404|Ga0210389_11526169 | Not Available | 507 | Open in IMG/M |
| 3300021405|Ga0210387_10254872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1536 | Open in IMG/M |
| 3300021405|Ga0210387_11025647 | Not Available | 722 | Open in IMG/M |
| 3300021405|Ga0210387_11731842 | Not Available | 528 | Open in IMG/M |
| 3300021441|Ga0213871_10133023 | Not Available | 748 | Open in IMG/M |
| 3300025703|Ga0208357_1128508 | Not Available | 727 | Open in IMG/M |
| 3300025878|Ga0209584_10038140 | Not Available | 1677 | Open in IMG/M |
| 3300025878|Ga0209584_10326331 | Not Available | 591 | Open in IMG/M |
| 3300025900|Ga0207710_10088699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 1445 | Open in IMG/M |
| 3300025901|Ga0207688_10213528 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300025901|Ga0207688_10362358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 895 | Open in IMG/M |
| 3300025916|Ga0207663_11705521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300025929|Ga0207664_10570014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1016 | Open in IMG/M |
| 3300025941|Ga0207711_10875761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 835 | Open in IMG/M |
| 3300025972|Ga0207668_12098493 | Not Available | 509 | Open in IMG/M |
| 3300026035|Ga0207703_10148888 | Not Available | 2039 | Open in IMG/M |
| 3300026041|Ga0207639_11542190 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300026067|Ga0207678_10743793 | Not Available | 864 | Open in IMG/M |
| 3300026075|Ga0207708_11386829 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300026089|Ga0207648_10364770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1304 | Open in IMG/M |
| 3300026118|Ga0207675_102514114 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300027619|Ga0209330_1092337 | Not Available | 689 | Open in IMG/M |
| 3300027750|Ga0209461_10146531 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300027812|Ga0209656_10342585 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300027903|Ga0209488_11155409 | Not Available | 524 | Open in IMG/M |
| 3300028587|Ga0247828_10589703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300028705|Ga0307276_10221072 | Not Available | 504 | Open in IMG/M |
| 3300028798|Ga0302222_10044322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 1810 | Open in IMG/M |
| 3300029999|Ga0311339_11450768 | Not Available | 614 | Open in IMG/M |
| 3300030523|Ga0272436_1031256 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3205 | Open in IMG/M |
| 3300030545|Ga0210271_10665149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1010 | Open in IMG/M |
| 3300031058|Ga0308189_10511131 | Not Available | 519 | Open in IMG/M |
| 3300031091|Ga0308201_10327709 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300031231|Ga0170824_109143487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 812 | Open in IMG/M |
| 3300031234|Ga0302325_10965216 | Not Available | 1171 | Open in IMG/M |
| 3300031234|Ga0302325_13141437 | Not Available | 529 | Open in IMG/M |
| 3300031449|Ga0272429_1076600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2178 | Open in IMG/M |
| 3300031449|Ga0272429_1237500 | Not Available | 670 | Open in IMG/M |
| 3300031449|Ga0272429_1247033 | Not Available | 640 | Open in IMG/M |
| 3300031451|Ga0272426_1177904 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300031453|Ga0272425_1033535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3207 | Open in IMG/M |
| 3300031453|Ga0272425_1184847 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300031454|Ga0272427_1091496 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300031454|Ga0272427_1099770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1068 | Open in IMG/M |
| 3300031454|Ga0272427_1135406 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300031454|Ga0272427_1199446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → unclassified Caballeronia → Caballeronia sp. AZ10_KS36 | 564 | Open in IMG/M |
| 3300031460|Ga0272430_1066768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2055 | Open in IMG/M |
| 3300031470|Ga0272432_1063519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 2063 | Open in IMG/M |
| 3300031470|Ga0272432_1064012 | Not Available | 2049 | Open in IMG/M |
| 3300031470|Ga0272432_1090839 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300031472|Ga0272437_1058307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3104 | Open in IMG/M |
| 3300031472|Ga0272437_1149583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum lipoferum | 1379 | Open in IMG/M |
| 3300031474|Ga0170818_106857655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium indicum → Sphingobium indicum BiD32 | 788 | Open in IMG/M |
| 3300031520|Ga0272428_1035702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4406 | Open in IMG/M |
| 3300031520|Ga0272428_1176765 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300031520|Ga0272428_1211108 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300031520|Ga0272428_1404599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300031902|Ga0302322_102464810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 641 | Open in IMG/M |
| 3300031938|Ga0308175_103192000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 508 | Open in IMG/M |
| 3300032126|Ga0307415_101556390 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300032162|Ga0272424_1271267 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300033168|Ga0272423_1020070 | All Organisms → cellular organisms → Bacteria | 5262 | Open in IMG/M |
| 3300033168|Ga0272423_1060203 | All Organisms → cellular organisms → Bacteria | 2501 | Open in IMG/M |
| 3300033181|Ga0272431_10208090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium plurifarium | 1106 | Open in IMG/M |
| 3300033181|Ga0272431_10371622 | Not Available | 656 | Open in IMG/M |
| 3300033887|Ga0334790_057314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1418 | Open in IMG/M |
| 3300034000|Ga0334918_064204 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300034007|Ga0334936_112846 | Not Available | 568 | Open in IMG/M |
| 3300034358|Ga0370485_0193695 | Not Available | 635 | Open in IMG/M |
| 3300034377|Ga0334931_143605 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 16.35% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 11.95% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 6.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.03% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.14% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 3.14% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.52% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.26% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.26% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.26% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.26% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.26% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.26% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 1.26% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.63% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.63% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.63% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.63% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.63% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.63% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.63% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.63% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.63% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2209111000 | Soil microbial communities from Colorado Plateau, Greene Butte sample - Dark Crust, Colorado Plateau, Green Butte | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005506 | Soil microbial communities from Colorado Plateau, USA - Soil Crust after dry out 3A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009400 | Soil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858 | Environmental | Open in IMG/M |
| 3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300018946 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, 0 min after wetting v1 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300025703 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030523 | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak white sandstone | Environmental | Open in IMG/M |
| 3300030545 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031449 | Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt sud | Environmental | Open in IMG/M |
| 3300031451 | Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak nord | Environmental | Open in IMG/M |
| 3300031453 | Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte sud | Environmental | Open in IMG/M |
| 3300031454 | Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak sud | Environmental | Open in IMG/M |
| 3300031460 | Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace nord | Environmental | Open in IMG/M |
| 3300031470 | Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley nord | Environmental | Open in IMG/M |
| 3300031472 | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak red sandstone | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031520 | Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt nord | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032162 | Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte nord | Environmental | Open in IMG/M |
| 3300033168 | Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand sud | Environmental | Open in IMG/M |
| 3300033181 | Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace sud | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300034000 | Biocrust microbial communities from Mojave Desert, California, United States - 14HMC | Environmental | Open in IMG/M |
| 3300034007 | Biocrust microbial communities from Mojave Desert, California, United States - 32SMC | Environmental | Open in IMG/M |
| 3300034358 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_16 | Environmental | Open in IMG/M |
| 3300034377 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2210023648 | 2209111000 | Soil | VPKLVWRVKLVAELEPGVATETEVARIERGEEVGLADLGLRLEEAKLELWPKLGDG |
| C688J18823_110938671 | 3300001686 | Soil | VKLVAELRPGVMTETEVARIERDEQAGLADLGLRLAE |
| JGI26341J46601_102097111 | 3300003219 | Bog Forest Soil | MPKMVWRVKLVAELEPGSTTEVEVARLERDEQAGLANLGLR |
| JGI26340J50214_100934392 | 3300003368 | Bog Forest Soil | VPKLVWRVKLVAEPRPGVMTETEVARIERDEQAGLADLGLRL |
| Ga0062386_1009671431 | 3300004152 | Bog Forest Soil | VAKLVWRVKLVTELRAGETTEVEVARIERDEQVDLSDLGL |
| Ga0066671_102035241 | 3300005184 | Soil | VPKLVWRVKLVAELRPGVTTETEVARIERGAEAGLADLGLRLDEAKQL |
| Ga0070659_1017291161 | 3300005366 | Corn Rhizosphere | VAKLVWRVKLVAELEPGVATETEVARFERDEVVGLADLGLRL |
| Ga0068912_111706672 | 3300005506 | Soil | VPKLVWRVRLVAELRPGVTTETEVASIERGEEINPAELGLRLDE |
| Ga0068853_1017002472 | 3300005539 | Corn Rhizosphere | VSKLVWRVKLVAELEPGVTTETEVARIERGEEAGLADLGLRL |
| Ga0070762_107811111 | 3300005602 | Soil | VAKLVWRVKLVSELPAGVTTEVEIAHLERDEQAGVAELGLRLAEAKQLT |
| Ga0068864_1025647121 | 3300005618 | Switchgrass Rhizosphere | VPKLVWRVKLVAELRPGVTTETEVARIERGAEAGLAELGLRLDEAKQLT |
| Ga0068866_105052492 | 3300005718 | Miscanthus Rhizosphere | LVTELQTGETTEVEVARIERDEQAGLSDLGLRLAEAKQLT |
| Ga0075521_100679771 | 3300006642 | Arctic Peat Soil | VPKLAWRVKVVAEFESGETTEVEVAHLERDVQVGLADLG |
| Ga0075521_105033771 | 3300006642 | Arctic Peat Soil | MGSRDEGELVPKLVWRVKLVAELESGETTEVEVAHLERDVQVGLADLGL |
| Ga0066658_101131211 | 3300006794 | Soil | VPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLAELG |
| Ga0079221_110759821 | 3300006804 | Agricultural Soil | VSRVELVAEPEPGVAIETELARIERDPQAGLADLGL |
| Ga0079220_100330721 | 3300006806 | Agricultural Soil | VPKLVWRVKLVAELQPGVMTETEVARIERDAGANLAEL |
| Ga0079220_107163912 | 3300006806 | Agricultural Soil | VTKLVWRLKVVAELRPGVVRETEVARIERDEQADLADLGLRLA |
| Ga0068865_1018932392 | 3300006881 | Miscanthus Rhizosphere | MWRVKVVAEVQSGVTAETEVARIERDEEANLAELGLRLD |
| Ga0073928_110487781 | 3300006893 | Iron-Sulfur Acid Spring | MVWRVKLVAAVQAGEPTEVELARFERDEQAGLAGLGLRLAEAKHG* |
| Ga0105245_106792531 | 3300009098 | Miscanthus Rhizosphere | VPKLVWRVKLVAELQAGVTTETEVARIERGEEAGLADLGL |
| Ga0105241_113039632 | 3300009174 | Corn Rhizosphere | VVKLRWRVKLVAEWPSGVITETELACIERDQQTGLADFGLSLAEA |
| Ga0116854_10992591 | 3300009400 | Soil | VGKVVLRVKPVAELPAGEPTEVELACFERDEQVGLADLGLSLAEAKQLT |
| Ga0116228_111815692 | 3300009701 | Host-Associated | LVAKLVWRIKLVTELQAGETTEVEVARFERYEQVGLSDLGLRLAEAK |
| Ga0116227_107694382 | 3300009709 | Host-Associated | VPKLVWRVKLVAEFESGETTEVEVAHLERDVQVGLADLGLRLAEAK |
| Ga0126307_105823052 | 3300009789 | Serpentine Soil | VPKLVWRVKLVAELQAGVTTETEVACIERDEEALLADLGLRLAE |
| Ga0126307_115185451 | 3300009789 | Serpentine Soil | VPKLVWRVKLVAELRPGVTTETEVARIERGEAVGLAELGL |
| Ga0126313_105797942 | 3300009840 | Serpentine Soil | LVSKLVWRVKLVVKLVAELEPGVTTETEVACLERGEEAGLADL |
| Ga0126313_111910272 | 3300009840 | Serpentine Soil | VPKRVWRVKLVAELQPGVTTETEVARLERGEEAGLADLGL |
| Ga0126305_109039992 | 3300010036 | Serpentine Soil | VLKLVWRVKLVAEPRPGVMTATEVARIERGAEAGLA |
| Ga0126304_100764951 | 3300010037 | Serpentine Soil | VPKLVWRVKLVVELHAGATTETEVARIERGEEAGLADLGLRLDDVNGP* |
| Ga0126304_110518591 | 3300010037 | Serpentine Soil | VPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLAELGL |
| Ga0126304_112248681 | 3300010037 | Serpentine Soil | VPKLVWRVKLVAELEPGVATETEVGRFERGEEVGLAD |
| Ga0126315_102241971 | 3300010038 | Serpentine Soil | VAKLVWRVKLVAELQAGVTTETEVARIERGEEAGLADLGL |
| Ga0126308_108069672 | 3300010040 | Serpentine Soil | VAKLVWRVKLVAELQPGVTTETEVARIGRDADANLAELGLRLE |
| Ga0126312_103810471 | 3300010041 | Serpentine Soil | VPKLVWRVRLVAELRPGVATETEVACIERGGEINPAEL |
| Ga0126312_104331702 | 3300010041 | Serpentine Soil | VPKLVWRLKLVAELAPGVATETEVGRFERGEEVGLA |
| Ga0126314_102683111 | 3300010042 | Serpentine Soil | LVWRVKLVAELETGVATETEVARFERDEVAGLADLGLSARLERVTGLA* |
| Ga0126310_114354841 | 3300010044 | Serpentine Soil | VPKLVWRVKLVAELRPGVMTETEIARIERGAAVGVAELGLRLDEAKQLTA |
| Ga0126310_114655421 | 3300010044 | Serpentine Soil | VPKLVWRVKLVAELEPGVTTETEVACLERGEEAGL |
| Ga0126310_116286262 | 3300010044 | Serpentine Soil | VAKLVWRVKLVAELEPGVVTETELARIERDAQAGL |
| Ga0126311_104931531 | 3300010045 | Serpentine Soil | VPKLVWRVKLVAELQPGVMTETEVARMERSEAVGLAELGLRLDEAKQLTAA |
| Ga0126311_107410432 | 3300010045 | Serpentine Soil | VPKLVWRVKLVAELEPGVTTETEVACLERNEEAGLADLGLRLD |
| Ga0126320_10004032 | 3300010146 | Soil | VPKLVWRVKLVAELRPGVTTETEGARIERSEAGGLAEL |
| Ga0126320_10945721 | 3300010146 | Soil | VTKLVWRVKLVTELQAEEPTEVELTCFERDEQVGLADLGLSLAEAKQLTATQAG |
| Ga0126306_102909131 | 3300010166 | Serpentine Soil | VPKLVWRVKLVAELQTGVTTETEVARIERGEEAGLADLGLRLD |
| Ga0074045_100618271 | 3300010341 | Bog Forest Soil | MVWRVKLVAEQEFGFTTEVEVARLERDEQAGLADLGLR |
| Ga0134128_121568272 | 3300010373 | Terrestrial Soil | VPKLVWRVKLVAELQAGVTTETEVALIERGEEAGLADLGLRLDEAKQ |
| Ga0105239_108048471 | 3300010375 | Corn Rhizosphere | VVKLRWRVKLVAEWPSGVITETELACIERDQQTGLADF |
| Ga0134123_132944432 | 3300010403 | Terrestrial Soil | VPKLVWRVKLVAELRPGVMTETEVARIERDEQTGLADLGLRLDEAK |
| Ga0151489_11916452 | 3300011106 | Soil | VWRVKLVTELEAGETTEIEVARIERDEQASLGALVHMQD* |
| Ga0105246_100366481 | 3300011119 | Miscanthus Rhizosphere | VAKLVWRVKLAAELEPGVATETEVARFERDEVVGLADLGLR |
| Ga0150985_1006448151 | 3300012212 | Avena Fatua Rhizosphere | VPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLA |
| Ga0150985_1014194873 | 3300012212 | Avena Fatua Rhizosphere | VAKLVWRVKLVAELQAGVTTETEVARIKRGEEAGLADLGLRLNEAKQLTGA |
| Ga0150985_1034923983 | 3300012212 | Avena Fatua Rhizosphere | VPKLVWRVKLVAELQAGVTTETEVARIERGEEAGLAD |
| Ga0150985_1086877771 | 3300012212 | Avena Fatua Rhizosphere | VGVRGATPVPKLVWRVKLVTELEPGVATETEVARIERGEAAGLADLGLR |
| Ga0150985_1112702962 | 3300012212 | Avena Fatua Rhizosphere | VAKLVWRVKLVAELQAGVTTETEVARIERREEAGLADLGLRLDE |
| Ga0150985_1139445192 | 3300012212 | Avena Fatua Rhizosphere | MQGYVLGSRNESKLARKMVWRVKLVAELEPGSTTEVEVACLERDGRAGLADLGLRLAESLTRID* |
| Ga0150985_1142281412 | 3300012212 | Avena Fatua Rhizosphere | VAKLVWRVKLVAELEPGVATETEVARFERDEVVGLADLGLRLEEAKRRSG* |
| Ga0150985_1158264981 | 3300012212 | Avena Fatua Rhizosphere | VPKLVWRVKLVTELQPGVTTETEVACLERNDEADLA |
| Ga0150985_1196376411 | 3300012212 | Avena Fatua Rhizosphere | VSKLVWRVKLVAELQPGVTTETEVARIERDEQANLAELVPEFA |
| Ga0150985_1211651181 | 3300012212 | Avena Fatua Rhizosphere | VSKLVWRVKLVAELEPGMTTETEVAWIERGERPAWRTSGS |
| Ga0150984_1032763162 | 3300012469 | Avena Fatua Rhizosphere | VAKLVWRVKLVAELEPGVVTETELARIERDAQAGLAELGLQLDEAKRLT |
| Ga0150984_1115499011 | 3300012469 | Avena Fatua Rhizosphere | LGSRDEDERVAKLLWRVKLVAELQPGVTTETEVARIERDEQANLA |
| Ga0150984_1148506373 | 3300012469 | Avena Fatua Rhizosphere | VAKLVWRVKLVAELQPGVTTETEVARIERTEEAGLAELGLRLEEAKQL |
| Ga0150984_1197211051 | 3300012469 | Avena Fatua Rhizosphere | VLKLVWRVKLVAELQAGVTTETEVARIERGEEAGLA |
| Ga0150984_1225960392 | 3300012469 | Avena Fatua Rhizosphere | VPNLVWRVKLVAELEPGVATETEVARIERGEAIGLADLGL |
| Ga0157375_101245014 | 3300013308 | Miscanthus Rhizosphere | VPKLVWRVKLVAELEPGVTSETEVARLERGEEAGL |
| Ga0182000_103922791 | 3300014487 | Soil | VAKLVWRVKLVAELRPGAETEVEVARIERGVEAGLADLGLRLDEAKESMQTSGG* |
| Ga0182001_100879711 | 3300014488 | Soil | VPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLAELGLQLAEAK |
| Ga0182001_101782332 | 3300014488 | Soil | VPKLVWRVKLVAELQAGVTTETEVACIERGEEASLADLGLRLDEA |
| Ga0157379_107902861 | 3300014968 | Switchgrass Rhizosphere | VPKLVWRVKLVAELRPGVTTEIEVARIERGEAVGLAELG |
| Ga0157376_107387111 | 3300014969 | Miscanthus Rhizosphere | VWRVKLVAELQPGVTTETEVARIERDDEVRPAELG |
| Ga0182007_103687392 | 3300015262 | Rhizosphere | VPKLVWRVKLVAELQAGVTTETEVTRIERSEEAGLADLGLRL |
| Ga0187883_103270393 | 3300018037 | Peatland | MWRVNWVAEFESGETTEVEVARLERDEQAVRADFGLRL |
| Ga0187851_103511641 | 3300018046 | Peatland | VPKLVWRVKLVAEFRAGATTEVEVARIERDEQAGLYDLGLHL |
| Ga0066655_113411881 | 3300018431 | Grasslands Soil | LSSRDEGGLVPKLVWRVKLVAELEPGLTTEVEVARRERDAQAGLADLGLRLAEAKRL |
| Ga0066662_128282411 | 3300018468 | Grasslands Soil | VPKLVWRIKLVPELRLGVVTGTEVARIDRDPQADLADLGL |
| Ga0190270_104940443 | 3300018469 | Soil | VAKLVWQVKLVAELEPGVATETEVARFERDEVAGLADLGL |
| Ga0190273_118325682 | 3300018920 | Soil | VPKLVWRVKLMAEPGPGVATETEVARIERGEEVGLAGL |
| Ga0193599_11516411 | 3300018946 | Soil | GRRGPVPKLVWRVKLVAELEPGVATETEVARIERGEEVGLAELGLRL |
| Ga0190264_109032053 | 3300019377 | Soil | VAKLVWRVKLVAELEPGVATETEVARLERGEEAGLADLGLRLEEAKRLTA |
| Ga0193726_11995962 | 3300020021 | Soil | VTKLVWRVKLVTELEAGETTEIEVARIERDEQATLADLGLRLS |
| Ga0210400_102606251 | 3300021170 | Soil | VPKPVWWVKLVTELRPGEVTETKVARVQRDEHAGIADLGLRLTET |
| Ga0210400_106518411 | 3300021170 | Soil | VPKLVWRRVKLVADLRPGEVTETEVARVERDEHAGI |
| Ga0213882_100593981 | 3300021362 | Exposed Rock | VANLVWRVRLVAELEPGVVSETEVARIVRDEQASLAKL |
| Ga0213881_100646962 | 3300021374 | Exposed Rock | VANLVWRVRLVAELEPGVVSETELARIVRDEQASLAELGL |
| Ga0213874_100465061 | 3300021377 | Plant Roots | VAKLVWRVKLVAERQPGVTTETELARIERPEQAALAELGLLDRLISTR |
| Ga0210389_112735971 | 3300021404 | Soil | VPNLVWRVKLVAELEPGLTTEVEVARLERDEQPGLADLGL |
| Ga0210389_115261691 | 3300021404 | Soil | VPKLVWRVKLEAELRPGEVTETEVARVERDEHAGIADLGLRLTETK |
| Ga0210387_102548722 | 3300021405 | Soil | VPNLVWRVKLVAELEPGLTTEVEVARLERDEQASLA |
| Ga0210387_110256472 | 3300021405 | Soil | VPKLVWRVTLVAELRPGEVTETEVARIERDEQADTADLGLRLTET |
| Ga0210387_117318422 | 3300021405 | Soil | AELVWRVKLVAELRPGEVTETEVARVERDEQAGIRCRRYR |
| Ga0213871_101330232 | 3300021441 | Rhizosphere | VAKLVWRVKLVAETRPGVTTETEVARTERDEEAGLAG |
| Ga0208357_11285082 | 3300025703 | Arctic Peat Soil | MGSRDEGERVPKLVWRVKLVAEFETGERSEVEVARLERDEQAGLADLGLRLAE |
| Ga0209584_100381401 | 3300025878 | Arctic Peat Soil | MGSRDEGELVPKLAWRVKVVAEFESGETTEVEVAHLERDVQVGLADLGPRLADRWLRVSAFP |
| Ga0209584_103263311 | 3300025878 | Arctic Peat Soil | MGSRDEGELVPKLVWRVKLVAELESGETTEVEVAHLERDVQVGLADLGLRLAEAKQLDDQADP |
| Ga0207710_100886993 | 3300025900 | Switchgrass Rhizosphere | VPKLMWRVKLVAELRPGVMTETEVARIERDEQAGLAELGLQLAEA |
| Ga0207688_102135281 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VSKLVWRVKLVAELEPGVTTETEVACLKRGEEAGLADL |
| Ga0207688_103623581 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VPKLVWRVKLVAELQAGVTTETEVTRVERSEEAGL |
| Ga0207663_117055212 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VAKLVWRVKLVAELQPGVATETEVARIERYEEAGLADLGL |
| Ga0207664_105700141 | 3300025929 | Agricultural Soil | VAKLVWRVKLVAELQPGVATETEVARIERDEEAGLAD |
| Ga0207711_108757612 | 3300025941 | Switchgrass Rhizosphere | VPKLVWRVKLVAELQAGVTTETEVARIERGEEAGLAELGLRLDEAKQ |
| Ga0207668_120984932 | 3300025972 | Switchgrass Rhizosphere | VAKLVWRVKLVAELQAGVTTETEVARIERGEEAGL |
| Ga0207703_101488881 | 3300026035 | Switchgrass Rhizosphere | VPKLVWRVKLVAELQAGVTTETEVARIERGEEAGLAELGLRLDEAK |
| Ga0207639_115421902 | 3300026041 | Corn Rhizosphere | LVWRVKLVAELEPGVATETEVVRFERDEVVGLADLGLRV |
| Ga0207678_107437931 | 3300026067 | Corn Rhizosphere | VPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLAELGLQLAEAKQL |
| Ga0207708_113868292 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VPKLVWRVKLVAELQAGVTTETEVARIERGEEAGLAELGLRL |
| Ga0207648_103647701 | 3300026089 | Miscanthus Rhizosphere | VPKLVWRVKLVAELQAGVTTETEVARIERGEEAGLA |
| Ga0207675_1025141141 | 3300026118 | Switchgrass Rhizosphere | VPKLVWRVKLVAELRPGVITETEVARIERDEQAGLAEL |
| Ga0209330_10923372 | 3300027619 | Forest Soil | VGLVQLVWRVKLVAELRPGVMIESEVARIERDEHAGLA |
| Ga0209461_101465311 | 3300027750 | Agave | MDLVPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLADLGLQ |
| Ga0209656_103425852 | 3300027812 | Bog Forest Soil | MGYVWSSRDEGELMPKMVWRVKLVAEPEPGLTTEVEVARFERDEQAGLADLGLRLA |
| Ga0209488_111554091 | 3300027903 | Vadose Zone Soil | VPNLVWRVKLVAEFETGETTEVEVARLERDEQAGLADLG |
| Ga0247828_105897032 | 3300028587 | Soil | VPKLVWRVKLVAELEPGVATETEVARIERGEEVGLAELGLRLEEAKAKRCWTP |
| Ga0307276_102210722 | 3300028705 | Soil | VPKLVWRVKLVAELEPGVTTETEVACLERGEEAGLADLGLRLD |
| Ga0302222_100443221 | 3300028798 | Palsa | MGSRDEGKLVPKLVWRVKLVAEFETGETTEVEVARLERDEQAGLADLGLRLDEAADSRDT |
| Ga0311339_114507681 | 3300029999 | Palsa | MGSRDEGKLVPKLVWRVKLVAEFETGETTEVEVARLERDEQAVLADLGLR |
| Ga0272436_10312565 | 3300030523 | Rock | VAKLVWRVKLVTERQPGVTTETELACIERDEQAGLADLGLSL |
| Ga0210271_106651494 | 3300030545 | Soil | AKMVWRLKLVAELGAGSTAEVEVARFERDEQAGLADLGLRLAEAKQIEGMQTCGGASG |
| Ga0308189_105111311 | 3300031058 | Soil | VPKLVWRVKLVAELEPGVATETEVARIERDEEAGLADLGLRLEE |
| Ga0308201_103277091 | 3300031091 | Soil | VAKLLWRVKLVAELQPGMTTETEVARIERDEDANLAELGLR |
| Ga0170824_1091434872 | 3300031231 | Forest Soil | MGSRDEGELVPKLVWRVRLVAEFETGETTEVEVARLERDEHAGLAGSVRARAKQV |
| Ga0302325_109652162 | 3300031234 | Palsa | MGSRDEGELVPKLVWRVKLVAEFETGETTEVEVARLERDEQAGLADLGLRLAEAKQMT |
| Ga0302325_131414372 | 3300031234 | Palsa | VVLVAKLVWRVKLVAQLRPGVSTETEVARIERDDRVGLA |
| Ga0272429_10766003 | 3300031449 | Rock | VLKLVWRVKLEAELPAGVTTEVEVARLERDEQAGLAELGLRLAEAKQ |
| Ga0272429_12375001 | 3300031449 | Rock | VPKLAWRVKLVAELRPGVTTETEVAQIEREEQAGVAELGCQVTG |
| Ga0272429_12470331 | 3300031449 | Rock | VAKLVWRVKLVTERQPGVTTETELACIERDEQAGLAD |
| Ga0272426_11779041 | 3300031451 | Rock | VPKLVWRVKLVAELRPGVTTETEVARIERDEQAGLAELGLRLAE |
| Ga0272425_10335354 | 3300031453 | Rock | VPKLVWRVKLVAELRPGVTTETEVACIERDEQAGLAELELPLV |
| Ga0272425_11848471 | 3300031453 | Rock | VAKLKWRVRLVTERHPGAVTETELACIERDEGIGVADLGLRLD |
| Ga0272427_10914961 | 3300031454 | Rock | VTKLMWRVMLVAELHPGMTTETELACIERDEEVGLA |
| Ga0272427_10997701 | 3300031454 | Rock | VAKLVWQVKLAAELEPGVVTETELARIERDEQAGL |
| Ga0272427_11354062 | 3300031454 | Rock | VPKLVWRVKLVAELEPGVATETEVARFERDEEAGLADLGLRLEETKRLTA |
| Ga0272427_11994462 | 3300031454 | Rock | VSKLLWRVKLAAERQPGVTTETELACIERDAQAGLADLGLSL |
| Ga0272430_10667681 | 3300031460 | Rock | VSKLLWRVKLVAERQPGVTTDIEFAGIERDAQAGLADLGVCK |
| Ga0272432_10635191 | 3300031470 | Rock | VPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLAE |
| Ga0272432_10640122 | 3300031470 | Rock | MAKLVWRVKLVAELQAEVTTEAEVGRLERDEQAVRDR |
| Ga0272432_10908396 | 3300031470 | Rock | VPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLAELGLR |
| Ga0272437_10583071 | 3300031472 | Rock | VPKLVWRVKLIAELRPGVMTEAEVARIERDELACLAELGLRLDETKQ |
| Ga0272437_11495831 | 3300031472 | Rock | VSKLLWRVKLVAERQPGVTTETELACIERDAQAGLAD |
| Ga0170818_1068576551 | 3300031474 | Forest Soil | RDEGELVPKLVWRVRLVAEFETGETTEVEVARLERDEHAGLAGSVRARAKQV |
| Ga0272428_10357021 | 3300031520 | Rock | VAKLKWRVKLVAERHPGVTTKTELACIGRDEDVGLADLGLRLGE |
| Ga0272428_11767651 | 3300031520 | Rock | VAKLVWRVKLVAELRPGVTTETEVARIERDEQAGLAELGLRLA |
| Ga0272428_12111082 | 3300031520 | Rock | VKLVAELRPGVMTETEVARIERDEQAGLAELGLRLAEAKQ |
| Ga0272428_14045991 | 3300031520 | Rock | VAKLVWRVKLVAELRPGVMTETEVARIERDEQASVAEL |
| Ga0302322_1024648101 | 3300031902 | Fen | MGSRDEGERVPKLVWRVNLVAEFETGETTEVEVARLERDEQAGLADLGLRLAEAK |
| Ga0308175_1031920001 | 3300031938 | Soil | VAKLVWRVRLVAELEPGVVTETELARIERDAQASLAELGLRRDEA |
| Ga0307415_1015563902 | 3300032126 | Rhizosphere | MQISNPPGSRKEGGLVPKLVWRVKLVAELEPGVTEETEVACLERGEEAGLADLGL |
| Ga0272424_12712671 | 3300032162 | Rock | LPKLVWRVKLIAELRPGVMTETEVARIERDEQAGLAELGLRL |
| Ga0272423_10200701 | 3300033168 | Rock | VPKLVWRVKLVAELRPGVTTETEVTRIERDEQAGLVEL |
| Ga0272423_10602033 | 3300033168 | Rock | VPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLAEL |
| Ga0272431_102080902 | 3300033181 | Rock | VPKLVWRVKLVAELRPGVMTETEVARIERDEQAGL |
| Ga0272431_103716221 | 3300033181 | Rock | VPKLVWRVKLDAELRPGVTTETEVACIERDEQAGLA |
| Ga0334790_057314_1266_1418 | 3300033887 | Soil | LGSRDEGELVAKLVWRVKLVTELEAGETTEVEVARIECDEQAGLADLGLRL |
| Ga0334918_064204_1_135 | 3300034000 | Hypolithic Biocrust | VPKLVWRVKLVAELEPGVATETEVARIERGEEAGLAELGLGLEEV |
| Ga0334936_112846_3_110 | 3300034007 | Biocrust | VPKLLWRVKLVAELEPGVATETEVARIERGEEAGLA |
| Ga0370485_0193695_2_124 | 3300034358 | Untreated Peat Soil | MPKVVWRVKLVAELHAGEPTEVELACFERDEQVGLADLGLS |
| Ga0334931_143605_1_132 | 3300034377 | Sub-Biocrust Soil | MGLVPKLVWRVKLVAELRPGVMTETEVARIERDEQAGLADLGLR |
| ⦗Top⦘ |