


| Basic Information | |
|---|---|
| Family ID | F041533 |
| Family Type | Metagenome |
| Number of Sequences | 159 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VWVTGGSRCRVNQENPPMRIYIIGNDGITLCREAPATVN |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 89.31 % |
| % of genes near scaffold ends (potentially truncated) | 95.60 % |
| % of genes from short scaffolds (< 2000 bps) | 88.05 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (53.459 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (56.604 % of family members) |
| Environment Ontology (ENVO) | Unclassified (76.730 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (53.459 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 19.40% Coil/Unstructured: 80.60% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF06224 | HTH_42 | 1.89 |
| PF07690 | MFS_1 | 1.89 |
| PF00496 | SBP_bac_5 | 1.26 |
| PF02567 | PhzC-PhzF | 1.26 |
| PF13432 | TPR_16 | 1.26 |
| PF03237 | Terminase_6N | 1.26 |
| PF00144 | Beta-lactamase | 1.26 |
| PF02738 | MoCoBD_1 | 1.26 |
| PF08241 | Methyltransf_11 | 1.26 |
| PF01266 | DAO | 1.26 |
| PF01070 | FMN_dh | 1.26 |
| PF03466 | LysR_substrate | 1.26 |
| PF13672 | PP2C_2 | 0.63 |
| PF01925 | TauE | 0.63 |
| PF13191 | AAA_16 | 0.63 |
| PF00106 | adh_short | 0.63 |
| PF00390 | malic | 0.63 |
| PF13561 | adh_short_C2 | 0.63 |
| PF06736 | TMEM175 | 0.63 |
| PF12802 | MarR_2 | 0.63 |
| PF13115 | YtkA | 0.63 |
| PF00583 | Acetyltransf_1 | 0.63 |
| PF00578 | AhpC-TSA | 0.63 |
| PF01464 | SLT | 0.63 |
| PF01156 | IU_nuc_hydro | 0.63 |
| PF02685 | Glucokinase | 0.63 |
| PF07647 | SAM_2 | 0.63 |
| PF13360 | PQQ_2 | 0.63 |
| PF01361 | Tautomerase | 0.63 |
| PF05951 | Peptidase_M15_2 | 0.63 |
| PF13416 | SBP_bac_8 | 0.63 |
| PF13795 | HupE_UreJ_2 | 0.63 |
| PF04828 | GFA | 0.63 |
| PF02690 | Na_Pi_cotrans | 0.63 |
| PF02797 | Chal_sti_synt_C | 0.63 |
| PF10282 | Lactonase | 0.63 |
| PF12760 | Zn_Tnp_IS1595 | 0.63 |
| PF02518 | HATPase_c | 0.63 |
| PF12840 | HTH_20 | 0.63 |
| PF09347 | DUF1989 | 0.63 |
| PF00171 | Aldedh | 0.63 |
| PF01047 | MarR | 0.63 |
| PF11994 | DUF3489 | 0.63 |
| PF05494 | MlaC | 0.63 |
| PF02515 | CoA_transf_3 | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 1.89 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 1.26 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 1.26 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 1.26 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.26 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.26 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.26 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.63 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 0.63 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.63 |
| COG0837 | Glucokinase | Carbohydrate transport and metabolism [G] | 0.63 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.63 |
| COG1283 | Na+/phosphate symporter | Inorganic ion transport and metabolism [P] | 0.63 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.63 |
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.63 |
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 0.63 |
| COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.63 |
| COG3108 | Uncharacterized conserved protein YcbK, DUF882 family | Function unknown [S] | 0.63 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.63 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.63 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.09 % |
| Unclassified | root | N/A | 45.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005447|Ga0066689_10256540 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1077 | Open in IMG/M |
| 3300005764|Ga0066903_102719001 | Not Available | 960 | Open in IMG/M |
| 3300010046|Ga0126384_10044913 | All Organisms → cellular organisms → Bacteria | 3013 | Open in IMG/M |
| 3300010046|Ga0126384_10148970 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
| 3300010046|Ga0126384_11744005 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300010048|Ga0126373_10183729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2014 | Open in IMG/M |
| 3300010048|Ga0126373_10607626 | Not Available | 1146 | Open in IMG/M |
| 3300010048|Ga0126373_11938173 | Not Available | 652 | Open in IMG/M |
| 3300010341|Ga0074045_10049638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 3046 | Open in IMG/M |
| 3300010343|Ga0074044_10018935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5020 | Open in IMG/M |
| 3300010359|Ga0126376_12086318 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 610 | Open in IMG/M |
| 3300010360|Ga0126372_10577824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1073 | Open in IMG/M |
| 3300010360|Ga0126372_11146460 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300010361|Ga0126378_10443912 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300010361|Ga0126378_11203162 | Not Available | 855 | Open in IMG/M |
| 3300010361|Ga0126378_11446303 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
| 3300010362|Ga0126377_11496102 | Not Available | 749 | Open in IMG/M |
| 3300010366|Ga0126379_13186105 | Not Available | 549 | Open in IMG/M |
| 3300010376|Ga0126381_100271005 | Not Available | 2311 | Open in IMG/M |
| 3300010376|Ga0126381_100309046 | All Organisms → cellular organisms → Bacteria | 2168 | Open in IMG/M |
| 3300012208|Ga0137376_11334857 | Not Available | 607 | Open in IMG/M |
| 3300012210|Ga0137378_11507327 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300012948|Ga0126375_10148552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1474 | Open in IMG/M |
| 3300012948|Ga0126375_10814060 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012971|Ga0126369_11249127 | Not Available | 833 | Open in IMG/M |
| 3300015264|Ga0137403_11322489 | Not Available | 567 | Open in IMG/M |
| 3300016270|Ga0182036_10275526 | Not Available | 1270 | Open in IMG/M |
| 3300016270|Ga0182036_10375943 | Not Available | 1101 | Open in IMG/M |
| 3300016270|Ga0182036_10504211 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300016294|Ga0182041_10664327 | Not Available | 921 | Open in IMG/M |
| 3300016319|Ga0182033_10015347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4487 | Open in IMG/M |
| 3300016319|Ga0182033_10181358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1657 | Open in IMG/M |
| 3300016319|Ga0182033_11235984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
| 3300016357|Ga0182032_10119863 | Not Available | 1896 | Open in IMG/M |
| 3300016357|Ga0182032_10519276 | Not Available | 982 | Open in IMG/M |
| 3300016371|Ga0182034_10151051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1745 | Open in IMG/M |
| 3300016387|Ga0182040_10574687 | Not Available | 910 | Open in IMG/M |
| 3300016387|Ga0182040_10743769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 804 | Open in IMG/M |
| 3300016404|Ga0182037_10216902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1495 | Open in IMG/M |
| 3300016404|Ga0182037_10430445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1093 | Open in IMG/M |
| 3300016404|Ga0182037_10961547 | Not Available | 743 | Open in IMG/M |
| 3300016404|Ga0182037_11879492 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300016422|Ga0182039_10068468 | All Organisms → cellular organisms → Bacteria | 2500 | Open in IMG/M |
| 3300016445|Ga0182038_10036155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3167 | Open in IMG/M |
| 3300016445|Ga0182038_10093915 | All Organisms → cellular organisms → Bacteria | 2158 | Open in IMG/M |
| 3300016445|Ga0182038_10122061 | Not Available | 1937 | Open in IMG/M |
| 3300016445|Ga0182038_10691340 | Not Available | 887 | Open in IMG/M |
| 3300016445|Ga0182038_10997785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 741 | Open in IMG/M |
| 3300020581|Ga0210399_11337817 | Not Available | 562 | Open in IMG/M |
| 3300021178|Ga0210408_11225837 | Not Available | 572 | Open in IMG/M |
| 3300021404|Ga0210389_10532550 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300021405|Ga0210387_10871556 | Not Available | 793 | Open in IMG/M |
| 3300021559|Ga0210409_11066800 | Not Available | 682 | Open in IMG/M |
| 3300021559|Ga0210409_11114787 | Not Available | 664 | Open in IMG/M |
| 3300021560|Ga0126371_13328489 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Ulvophyceae → TCBD clade → Bryopsidales → Ostreobineae → Ostreobiaceae → Ostreobium → Ostreobium quekettii | 543 | Open in IMG/M |
| 3300021560|Ga0126371_13689963 | Not Available | 516 | Open in IMG/M |
| 3300027376|Ga0209004_1052855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 682 | Open in IMG/M |
| 3300027783|Ga0209448_10093020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1010 | Open in IMG/M |
| 3300031543|Ga0318516_10461784 | Not Available | 730 | Open in IMG/M |
| 3300031543|Ga0318516_10631348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 610 | Open in IMG/M |
| 3300031545|Ga0318541_10175048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1183 | Open in IMG/M |
| 3300031545|Ga0318541_10616341 | Not Available | 607 | Open in IMG/M |
| 3300031546|Ga0318538_10200247 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300031546|Ga0318538_10533607 | Not Available | 636 | Open in IMG/M |
| 3300031546|Ga0318538_10608850 | Not Available | 593 | Open in IMG/M |
| 3300031561|Ga0318528_10178698 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300031564|Ga0318573_10022984 | All Organisms → cellular organisms → Bacteria | 2832 | Open in IMG/M |
| 3300031572|Ga0318515_10015142 | All Organisms → cellular organisms → Bacteria | 3551 | Open in IMG/M |
| 3300031572|Ga0318515_10387536 | Not Available | 748 | Open in IMG/M |
| 3300031640|Ga0318555_10501630 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300031640|Ga0318555_10578678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 200 | 608 | Open in IMG/M |
| 3300031668|Ga0318542_10133572 | Not Available | 1222 | Open in IMG/M |
| 3300031668|Ga0318542_10693455 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300031679|Ga0318561_10296378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 885 | Open in IMG/M |
| 3300031679|Ga0318561_10672257 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300031679|Ga0318561_10746856 | Not Available | 538 | Open in IMG/M |
| 3300031680|Ga0318574_10298038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 937 | Open in IMG/M |
| 3300031682|Ga0318560_10331298 | Not Available | 821 | Open in IMG/M |
| 3300031713|Ga0318496_10406036 | Not Available | 753 | Open in IMG/M |
| 3300031713|Ga0318496_10568786 | Not Available | 626 | Open in IMG/M |
| 3300031713|Ga0318496_10694809 | Not Available | 561 | Open in IMG/M |
| 3300031723|Ga0318493_10637129 | Not Available | 595 | Open in IMG/M |
| 3300031736|Ga0318501_10059167 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300031736|Ga0318501_10192475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1065 | Open in IMG/M |
| 3300031736|Ga0318501_10463773 | Not Available | 688 | Open in IMG/M |
| 3300031747|Ga0318502_10107366 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1554 | Open in IMG/M |
| 3300031747|Ga0318502_10510763 | Not Available | 720 | Open in IMG/M |
| 3300031748|Ga0318492_10749610 | Not Available | 524 | Open in IMG/M |
| 3300031765|Ga0318554_10192251 | Not Available | 1161 | Open in IMG/M |
| 3300031765|Ga0318554_10295028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 922 | Open in IMG/M |
| 3300031765|Ga0318554_10586808 | Not Available | 628 | Open in IMG/M |
| 3300031768|Ga0318509_10176567 | Not Available | 1184 | Open in IMG/M |
| 3300031770|Ga0318521_10195282 | Not Available | 1167 | Open in IMG/M |
| 3300031770|Ga0318521_10375939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 844 | Open in IMG/M |
| 3300031771|Ga0318546_10063899 | All Organisms → cellular organisms → Bacteria | 2332 | Open in IMG/M |
| 3300031777|Ga0318543_10079301 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300031777|Ga0318543_10149356 | Not Available | 1026 | Open in IMG/M |
| 3300031781|Ga0318547_10279751 | Not Available | 1010 | Open in IMG/M |
| 3300031782|Ga0318552_10657551 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031793|Ga0318548_10157258 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1109 | Open in IMG/M |
| 3300031794|Ga0318503_10208530 | Not Available | 633 | Open in IMG/M |
| 3300031795|Ga0318557_10128568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1137 | Open in IMG/M |
| 3300031796|Ga0318576_10165279 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300031797|Ga0318550_10628310 | Not Available | 515 | Open in IMG/M |
| 3300031798|Ga0318523_10244224 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300031805|Ga0318497_10124013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 1400 | Open in IMG/M |
| 3300031821|Ga0318567_10058529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2009 | Open in IMG/M |
| 3300031821|Ga0318567_10288878 | Not Available | 924 | Open in IMG/M |
| 3300031821|Ga0318567_10436679 | Not Available | 742 | Open in IMG/M |
| 3300031832|Ga0318499_10100085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1121 | Open in IMG/M |
| 3300031846|Ga0318512_10671573 | Not Available | 530 | Open in IMG/M |
| 3300031859|Ga0318527_10087183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1269 | Open in IMG/M |
| 3300031879|Ga0306919_11237457 | Not Available | 566 | Open in IMG/M |
| 3300031890|Ga0306925_11248637 | Not Available | 741 | Open in IMG/M |
| 3300031893|Ga0318536_10566275 | Not Available | 569 | Open in IMG/M |
| 3300031894|Ga0318522_10014004 | All Organisms → cellular organisms → Bacteria | 2487 | Open in IMG/M |
| 3300031910|Ga0306923_10072044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661 | 3857 | Open in IMG/M |
| 3300031910|Ga0306923_10716744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron | 1112 | Open in IMG/M |
| 3300031912|Ga0306921_10204714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2312 | Open in IMG/M |
| 3300031912|Ga0306921_11893696 | Not Available | 638 | Open in IMG/M |
| 3300031941|Ga0310912_10161830 | Not Available | 1695 | Open in IMG/M |
| 3300031945|Ga0310913_10097091 | All Organisms → cellular organisms → Bacteria | 1988 | Open in IMG/M |
| 3300031946|Ga0310910_10625971 | Not Available | 853 | Open in IMG/M |
| 3300031947|Ga0310909_10632647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 892 | Open in IMG/M |
| 3300031947|Ga0310909_10856567 | Not Available | 748 | Open in IMG/M |
| 3300031947|Ga0310909_11674361 | Not Available | 503 | Open in IMG/M |
| 3300031954|Ga0306926_10721364 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300031954|Ga0306926_11070548 | Not Available | 955 | Open in IMG/M |
| 3300031954|Ga0306926_11446287 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300031959|Ga0318530_10059704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1455 | Open in IMG/M |
| 3300031959|Ga0318530_10096147 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300031959|Ga0318530_10368224 | Not Available | 595 | Open in IMG/M |
| 3300032001|Ga0306922_10312286 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300032001|Ga0306922_10666758 | Not Available | 1097 | Open in IMG/M |
| 3300032009|Ga0318563_10691072 | Not Available | 548 | Open in IMG/M |
| 3300032025|Ga0318507_10102817 | Not Available | 1193 | Open in IMG/M |
| 3300032035|Ga0310911_10148609 | Not Available | 1317 | Open in IMG/M |
| 3300032039|Ga0318559_10289929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300032042|Ga0318545_10253055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM1743 | 632 | Open in IMG/M |
| 3300032042|Ga0318545_10384647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 506 | Open in IMG/M |
| 3300032043|Ga0318556_10490208 | Not Available | 643 | Open in IMG/M |
| 3300032044|Ga0318558_10400945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis | 682 | Open in IMG/M |
| 3300032052|Ga0318506_10553676 | Not Available | 509 | Open in IMG/M |
| 3300032054|Ga0318570_10147422 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300032055|Ga0318575_10082124 | Not Available | 1537 | Open in IMG/M |
| 3300032059|Ga0318533_10129743 | Not Available | 1770 | Open in IMG/M |
| 3300032060|Ga0318505_10018266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2690 | Open in IMG/M |
| 3300032063|Ga0318504_10583261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300032076|Ga0306924_11864651 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300032091|Ga0318577_10097653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1372 | Open in IMG/M |
| 3300032180|Ga0307471_102091967 | Not Available | 711 | Open in IMG/M |
| 3300032261|Ga0306920_100050570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 6038 | Open in IMG/M |
| 3300032261|Ga0306920_102077891 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300032261|Ga0306920_102353575 | Not Available | 736 | Open in IMG/M |
| 3300032261|Ga0306920_104253817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Ensifer → unclassified Ensifer → Ensifer sp. MPMI2T | 515 | Open in IMG/M |
| 3300033290|Ga0318519_10143638 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300033290|Ga0318519_10182189 | Not Available | 1190 | Open in IMG/M |
| 3300033290|Ga0318519_10458235 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300033290|Ga0318519_11006398 | Not Available | 518 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 56.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.21% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.89% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.26% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066689_102565402 | 3300005447 | Soil | VWVTGGGRRRVNQENPPMRIYIIGNDGITLCREAPAAVNEGEIAVASN |
| Ga0066903_1027190011 | 3300005764 | Tropical Forest Soil | VWVTGGTGCRANQETPPMRIYIIGNDGVALSREAP |
| Ga0126384_100449131 | 3300010046 | Tropical Forest Soil | VWVTGGTGRQVDQENPSMRIYIIGNDGITLCREAPATIS |
| Ga0126384_101489703 | 3300010046 | Tropical Forest Soil | VWVTDGSRRRVDQENPSMRIYIIGNDGITLCREAPATVNDGEIAVDTSRH* |
| Ga0126384_117440051 | 3300010046 | Tropical Forest Soil | VRVTGGSGRRVNQETPPMRIYIIGNDGITLCREAPVPVNEGEIA |
| Ga0126373_101837291 | 3300010048 | Tropical Forest Soil | VWVTGGTRRRANLENPPMRIYIIGNDGITLCREAPATVDEGEIAV |
| Ga0126373_106076261 | 3300010048 | Tropical Forest Soil | VWVTGGTRRRVDQENPPMRNYIIGNDGITLCREAPATVNE |
| Ga0126373_119381731 | 3300010048 | Tropical Forest Soil | VWVTGGSRCRVNQENPPMRIYLIGNDGITLCREAPAT |
| Ga0074045_100496381 | 3300010341 | Bog Forest Soil | VWATGGSRCRADQENPPMRIYIIGNDGITLCREPPA |
| Ga0074044_100189351 | 3300010343 | Bog Forest Soil | VWATGGSRCRADQENPPMRIYIIGNDGITLCREPPAAVN |
| Ga0126376_120863181 | 3300010359 | Tropical Forest Soil | VWVTDGNRRPVNQENPPMHIYIIGNDGITLCREAPAAIGEGEIVV |
| Ga0126372_105778242 | 3300010360 | Tropical Forest Soil | VWVTGGTRCRSNQEHPPMRIYIIGNDGITLSREAP |
| Ga0126372_111464602 | 3300010360 | Tropical Forest Soil | VWVTGGRRRVKQENPPMRIYIIGNDGITLCREAPAQ* |
| Ga0126378_104439121 | 3300010361 | Tropical Forest Soil | VWVTGGNRCRVYQENPPMRIYIIGNDGITLSREAPTALNE |
| Ga0126378_112031621 | 3300010361 | Tropical Forest Soil | VWVTGGTRCRVNQENPPMRIYIIGNDGITLSREAP |
| Ga0126378_114463031 | 3300010361 | Tropical Forest Soil | VWVTDGNRRPVNQENPPMRIYIIGNDGITLCREAPAAIGEGE |
| Ga0126377_114961021 | 3300010362 | Tropical Forest Soil | VRVTGGSRCRVNQETPLMRTYIIGNDGITLGREAPA |
| Ga0126379_131861051 | 3300010366 | Tropical Forest Soil | MEWLGLRREREWVTGGSRCRINQETVRIYIIGNDGITLCRGALATVNEGE |
| Ga0126381_1002710054 | 3300010376 | Tropical Forest Soil | VWVTGGTRRRVNLENPPMRIYIIGNDGITLCREAPATVNQDEIA |
| Ga0126381_1003090461 | 3300010376 | Tropical Forest Soil | VWVTRGSGHGINQETPPMRIYIIGNDGITLCREAPASVTDGEIAVVSQ |
| Ga0137376_113348571 | 3300012208 | Vadose Zone Soil | VWVTGGSRRRVNQENPPMRIYIIGNDGITLYRQAPTTVNEGEITVA |
| Ga0137378_115073271 | 3300012210 | Vadose Zone Soil | VWVTGGGRRRVNKETPPMRIYIIGNDGITLCREPPATVNNGEVAVA |
| Ga0126375_101485521 | 3300012948 | Tropical Forest Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGITLCREAPATVNQGE |
| Ga0126375_108140602 | 3300012948 | Tropical Forest Soil | VWVTGGSGRRVNQETPPMRIYIIGNDGITLSREAPVTVNEGEIAVASN |
| Ga0126369_112491272 | 3300012971 | Tropical Forest Soil | VWVTGGTRRRVNLENPPMRIYIIGNDGITLCREAPATVD |
| Ga0137403_113224891 | 3300015264 | Vadose Zone Soil | VWVTGGGRRRVNQENPPMRIYIIGNDGITLCREAP |
| Ga0182036_102755261 | 3300016270 | Soil | VWVTGNTRCRANQETPPMRIYIIGNDGVALSREAP |
| Ga0182036_103759432 | 3300016270 | Soil | EESFSVVTGGSRCRVNQENPPMRIYIIGNDGITLCHEAPATVNGG |
| Ga0182036_105042111 | 3300016270 | Soil | VWVTGGTRRRVNQENPPLRIYIIGNDGITLCRKAPATVDEGEIAV |
| Ga0182041_106643272 | 3300016294 | Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGITLCREAPATVNDG |
| Ga0182033_100153471 | 3300016319 | Soil | VWVTGGSRCRIYQENPPMRIYIIGNDGITLCHEAPATVNEG |
| Ga0182033_101813581 | 3300016319 | Soil | VWVTGGTRRRVNQENPPMRIYIIGNDGITLCREAPAMVN |
| Ga0182033_112359841 | 3300016319 | Soil | VSVTGGSGRRVNQETPPMRIYIIGNDGITLCREAPATV |
| Ga0182032_101198635 | 3300016357 | Soil | GGSRCRVNQENPPMRIYIIGNDGITLCHEAPATVNGG |
| Ga0182032_105192761 | 3300016357 | Soil | VWVTGGTRRRSNQENPPMRIYIIGNDGITLSREAPT |
| Ga0182034_101510511 | 3300016371 | Soil | VWVTGGTRRRVNQENPPLRIYIIGNDGITLCRKAPATVD |
| Ga0182040_105746872 | 3300016387 | Soil | VWVTGGTRRRVHQENPAMRIYIIGNDGITLCREAPATVNE |
| Ga0182040_107437692 | 3300016387 | Soil | VWVTGGGGRWVNQENPPMRIYIIGNDGITLCREAPAP |
| Ga0182037_102169022 | 3300016404 | Soil | VWVTDGSRCRVNQENPPMRIYIIGNDGIRLCREAPATVNDG |
| Ga0182037_104304451 | 3300016404 | Soil | VWVTGGSRRRVYQENPPMRVYIIGNDGIRLCHEAPATVNE |
| Ga0182037_109615472 | 3300016404 | Soil | VWVTGGTRCRSDQENPPVRIYIIGNDGITLCREAP |
| Ga0182037_118794921 | 3300016404 | Soil | VRVTRDSGCGINQENPPMRIYIIGNDGITLCREAP |
| Ga0182039_100684682 | 3300016422 | Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGIALCREAPATVNDG |
| Ga0182038_100361553 | 3300016445 | Soil | VWVTGGTRRRVHQENPAMRIYIIGNDGITLCREAPA |
| Ga0182038_100939152 | 3300016445 | Soil | VWVTGGSRRRVNQENPPMRIYIIGNDGITLCREAPATINDG |
| Ga0182038_101220614 | 3300016445 | Soil | ESVSVVTGGSRCRVNQENPPMRIYIIGNDGITLCHEAPATVNGG |
| Ga0182038_106913403 | 3300016445 | Soil | VWVTGGSRRRVNQENPSMRIYIIGNDGITLCREAPATVNDG |
| Ga0182038_109977851 | 3300016445 | Soil | VWVTGGTGCRSNQENPPVRIYIIGNDGITLSRTAPAALNEG |
| Ga0210399_113378172 | 3300020581 | Soil | VWVTGGSRCRVNQENPPVRIYIIGSDGITLCRKAPATVK |
| Ga0210408_112258372 | 3300021178 | Soil | VWVTGGNRCRVYQENPPMRIYIIGNDGITLCREAPA |
| Ga0210389_105325501 | 3300021404 | Soil | VWVTGGSRRRVNQENPPMRIYIIGKDGITLCRQAPAT |
| Ga0210387_108715562 | 3300021405 | Soil | VWVTGGSRRRVNQENPPMRIYIIGNDGIRLCREASAT |
| Ga0210409_110668001 | 3300021559 | Soil | VWVTGGSRRRVNQENAPMRIYIIGNDGITLCREAPAAVN |
| Ga0210409_111147871 | 3300021559 | Soil | VWVTGGSRRRVKRENPPMRIYIIGNDGITLYREAPATVNEG |
| Ga0126371_133284891 | 3300021560 | Tropical Forest Soil | VWVTGGTRRRVNQENPPMRIYIIGNDGITLCREAPATV |
| Ga0126371_136899632 | 3300021560 | Tropical Forest Soil | VGHRCSGCGLNQKNPPMRIYIIGNDGITLCREAPA |
| Ga0209004_10528552 | 3300027376 | Forest Soil | VWVTGGSSRRANQENPPMRIYIIGNDGITLCREAPATVD |
| Ga0209448_100930203 | 3300027783 | Bog Forest Soil | VWVPGGSRRRVNQENPPMRIYIIGNDGITLCREPPTAVSKG |
| Ga0318516_104617841 | 3300031543 | Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGIALCREPPAAVSK |
| Ga0318516_106313482 | 3300031543 | Soil | VWVTGGTRCRSNQENPPVRIYIIGNDGITLSRTAPAAL |
| Ga0318541_101750481 | 3300031545 | Soil | VWVTGGNRCRVNQENPPMRIYIIGHDGITLCREAP |
| Ga0318541_106163411 | 3300031545 | Soil | VWVTDSSRCRVNEENLPMRIYIIGNDGITLCREAP |
| Ga0318538_102002471 | 3300031546 | Soil | VWVIGGSRRRVNQETPPMRIYIIGNDGITLYGEAPATLND |
| Ga0318538_105336072 | 3300031546 | Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGITLCREAPATVND |
| Ga0318538_106088501 | 3300031546 | Soil | LWVTGGSRRRVNQENPPMRIYIIGNDGITLCREAPATINDG |
| Ga0318528_101786981 | 3300031561 | Soil | VWVTGGSRRRVNQENPPMRIYIIGNDGITLYREARPQ |
| Ga0318573_100229841 | 3300031564 | Soil | VWVTGGACRRVNQENPPMRIYIIGNDGITLCGEMPAAVND |
| Ga0318515_100151424 | 3300031572 | Soil | VWVTGGSRCRANQENPPMRIYIIGNDGITLCDKAPATVND |
| Ga0318515_103875362 | 3300031572 | Soil | VWVTGGSRCRIYQENPPMRIYIIGNDGITLCHEAPATVNE |
| Ga0318555_105016302 | 3300031640 | Soil | LGGEESVCVWVTGGARRGVNQENPPMRIYIIGNDGITLCREAPATVN |
| Ga0318555_105786781 | 3300031640 | Soil | VWVTGGSRRRVNQENPPMRIYIIGNDGITLCREAPATISD |
| Ga0318542_101335722 | 3300031668 | Soil | LWVTGGSRRQVNQENPPMRIYIIGNDGITLCREAPA |
| Ga0318542_106934552 | 3300031668 | Soil | VWVTGGSRCRVNEENPPMRIYIIGNDGITLCREAPATVNDGNCGRVKR |
| Ga0318561_102963782 | 3300031679 | Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGITLCREARA |
| Ga0318561_106722571 | 3300031679 | Soil | VWVTGGSRRRVNQENPSMRIYIIGNDGITLCREAPATIN |
| Ga0318561_107468561 | 3300031679 | Soil | VWVTDGTGRRVHQENPPMRIYIIGNEGITLCHEAPATVN |
| Ga0318574_102980381 | 3300031680 | Soil | VWATGGSRRRVNQENPPMRIYIIGNDRITLCHEAPAPV |
| Ga0318560_103312981 | 3300031682 | Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGITLCREAPATV |
| Ga0318496_104060362 | 3300031713 | Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGITLCRKAPAIVS |
| Ga0318496_105687862 | 3300031713 | Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGITLCREAPA |
| Ga0318496_106948092 | 3300031713 | Soil | VWVTGGTRCRTNHETPFMRIYIIGNDGVALSREAPG |
| Ga0318493_106371291 | 3300031723 | Soil | VWVTGGSRCRVNQENPPMRVYIIGNDGITLCDKAPATVND |
| Ga0318501_100591671 | 3300031736 | Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGIALCREAPATVND |
| Ga0318501_101924751 | 3300031736 | Soil | VWVTGGSRRRVNQENPSMRIYIIGNDGITLCREAPATIND |
| Ga0318501_104637732 | 3300031736 | Soil | VWVTGGSRCRVNQENPPMRVYIIGNDGITLCDKAPATVN |
| Ga0318502_101073661 | 3300031747 | Soil | VWVTGGSSRRANQEHPPMRIYIIGNDGITLCREAPA |
| Ga0318502_105107632 | 3300031747 | Soil | VWVTDGSRRRVNQENPSMRIYIIGNDGITLCREAPAT |
| Ga0318492_107496101 | 3300031748 | Soil | VWVTGGTRRRVNQENPPLRIYIIGNDGITLCRKAPATVDEG |
| Ga0318554_101922511 | 3300031765 | Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGITLCDKAPATVND |
| Ga0318554_102950283 | 3300031765 | Soil | VWVTGGTRCRSNQENPPVRIYIIGNDGITLSRKAPAALNE |
| Ga0318554_105868081 | 3300031765 | Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGITLCREAPATLS |
| Ga0318509_101765671 | 3300031768 | Soil | LVREESVSVVTGGRRCRVNQENPPMRIYIIGNDGITLCHEAPATVNGG |
| Ga0318521_101952821 | 3300031770 | Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGITLCREAPATLSDD |
| Ga0318521_103759391 | 3300031770 | Soil | LWVTGGSRRRVNQENPPMRIYIIGNDGITLCREAPATI |
| Ga0318546_100638991 | 3300031771 | Soil | LVREESVSVVTGGSRCRVNQENPPMRIYIIGNDGITLCHEAPATVNGG |
| Ga0318543_100793012 | 3300031777 | Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGITLCREAPATVN |
| Ga0318543_101493561 | 3300031777 | Soil | VWVTGGTRCRANQETPPMRIYIIGNDGVALSREAP |
| Ga0318547_102797511 | 3300031781 | Soil | VWVTGGSRCRVNQENPPMRIYIIGDDGITLCHEAPATVNE |
| Ga0318552_106575512 | 3300031782 | Soil | LWVTGGSRRRVNQENPPMRIYIIGNDGITLCREAPATIND |
| Ga0318548_101572583 | 3300031793 | Soil | VWVTSGGRRRVNQENLPMRVYIIASDGIMLCREAPA |
| Ga0318503_102085301 | 3300031794 | Soil | VWVTGGSRRRVNQENPPMRIYIIGNDGITLCREAPATI |
| Ga0318557_101285681 | 3300031795 | Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGITLCRKAPAI |
| Ga0318576_101652791 | 3300031796 | Soil | VWVTGGSRCRFNQENPPMRIYIIGHDGITLCREAPAT |
| Ga0318550_106283101 | 3300031797 | Soil | VWVTGGSRRRVNQENPSMRIYIIGNDGITLCREAPAT |
| Ga0318523_102442243 | 3300031798 | Soil | VWVTGDSRRAKPENPPMRIYIIGNDGITLCREVPA |
| Ga0318497_101240132 | 3300031805 | Soil | VWVTGGGGRWVNQENPPMRIYIIGNDGITLCREAPA |
| Ga0318567_100585291 | 3300031821 | Soil | VWVTGGSRRRVNQENPLMRVYIIGNDGIRLCHEATAIS |
| Ga0318567_102888782 | 3300031821 | Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGITLCREAPAT |
| Ga0318567_104366791 | 3300031821 | Soil | VWVTGGSGRRVNQETPPMRIYIIGNDGITLCRDAPAT |
| Ga0318499_101000851 | 3300031832 | Soil | VWVTGDSRRRVNQENPHMRIYIIGNDGITLCRKAPAT |
| Ga0318512_106715733 | 3300031846 | Soil | VWVTGGSRRRVNQENPPMRIYIIGNDGIKLCREAPATINN |
| Ga0318527_100871832 | 3300031859 | Soil | VWVTGGSRCRFNQENPPMRIYIIGNDGITLCREPPAAVSKG |
| Ga0306919_112374572 | 3300031879 | Soil | VWVTGGARRRVNQENPPMRIYIIGNDGITLCREAPAMVN |
| Ga0306925_112486371 | 3300031890 | Soil | VREESFSVVTGGSRCRVNQENPPMRIYIIGNDGITLCHEAPATVNGG |
| Ga0318536_105662753 | 3300031893 | Soil | VWVTGGSRHRVNQENPPMRIYIIGNDGITLCREAPATINN |
| Ga0318522_100140041 | 3300031894 | Soil | VWVTGGSRCRANQENPPMRIYIIGNDGITLCDKAPATV |
| Ga0306923_100720441 | 3300031910 | Soil | VWVTDGTRCRANQETPPMRIYIIGNDGVALSREAPG |
| Ga0306923_107167441 | 3300031910 | Soil | VWVTGGACRRVNQENPPMRIYIIGNDGITLCREMPAAVNDG |
| Ga0306921_102047144 | 3300031912 | Soil | VWVTGGSGRRVNQENPPMRIYIIGNDGITLCREAPAT |
| Ga0306921_118936962 | 3300031912 | Soil | LVREESFSVVTGGSRCRVNQENPPMRIYIIGNDGITLCHEAPATVNGG |
| Ga0310912_101618301 | 3300031941 | Soil | GSRCRVNQENPPMRIYIIGNDGITLCHEAPATVNGG |
| Ga0310913_100970912 | 3300031945 | Soil | VWVTGGTRCRANQETPPMRIYIIGNDGIALSREAP |
| Ga0310910_106259711 | 3300031946 | Soil | VWVTSGTRRRIHQENPMRIYIIGNDGITLCREAPVTVNRG |
| Ga0310909_106326471 | 3300031947 | Soil | VWVTGGSRRRVNQENPSMRIYIIGNDGITLCREAPATINDG |
| Ga0310909_108565671 | 3300031947 | Soil | VWVTGGTRRRVHQENPAMRIYIIGNDGITLCREAPATVNEG |
| Ga0310909_116743612 | 3300031947 | Soil | MGQGGSRCRVNQKHPPMRIYIIGNDGITLARKAPATVNEG |
| Ga0306926_107213644 | 3300031954 | Soil | VWVTGGSRRRVNQEDPTMRIYIIGNDGIMLCGEAPATVNE |
| Ga0306926_110705481 | 3300031954 | Soil | VVTGGSRCRVNQENPPMRIYIIGNDGITLCHEAPATVNGG |
| Ga0306926_114462872 | 3300031954 | Soil | VWVTGGSRCRVNQENSPMRIYTIGNDGITLCREPPA |
| Ga0318530_100597043 | 3300031959 | Soil | VWVTGGSRRRVNQETPSMPIYIIGNDGITLCREAPAT |
| Ga0318530_100961471 | 3300031959 | Soil | VWVTGGGRRRVNQENPPMRIYIIGNDGIMLCREAPATVNE |
| Ga0318530_103682241 | 3300031959 | Soil | VWVTGGSRRRVNQENPPMRIYIIGNDGITLCREAPA |
| Ga0306922_103122861 | 3300032001 | Soil | VRVTRDSGCGINQENPPMRIYIIGNDGITLCREAPATVNE |
| Ga0306922_106667582 | 3300032001 | Soil | VWVTGGRRRVKQENPPMRIYIIGNDGITLCREAPAT |
| Ga0318563_106910721 | 3300032009 | Soil | VWVTGGACRRVNQENPPMRIYIIGNDGITLCREMPAA |
| Ga0318507_101028172 | 3300032025 | Soil | VWVTGGSRRRVNQENPTMRIYIIGNDGIMLCGEAPA |
| Ga0310911_101486092 | 3300032035 | Soil | EESVSVVTGGRRCRVNQENPPMRIYIIGNDGITLCHEAPATGNGG |
| Ga0318559_102899292 | 3300032039 | Soil | VWVTGGSRCRVNQENPPMRIYIIGNDGITQCREAP |
| Ga0318545_102530551 | 3300032042 | Soil | VWVTGGSGRRVNQENPPMRIYIIGNDGITLCRGAPT |
| Ga0318545_103846472 | 3300032042 | Soil | MRRRNQEGPLMRIYIIGNDGITLCREAPATVDEGEIAV |
| Ga0318556_104902081 | 3300032043 | Soil | VWVTGGSRCRVNQETPPMRIYIIGNDGITLSREAPGTVNE |
| Ga0318558_104009452 | 3300032044 | Soil | VWVTRGTRCRANQETPPMRIYIIGNDGIALSREAP |
| Ga0318506_105536761 | 3300032052 | Soil | VWVTGGSRCWVNQENPPMRIYIIGNDGITLCREAPATVNEG |
| Ga0318570_101474221 | 3300032054 | Soil | VWVTGDSRRAKPENPPMRIYIIGNDGITLCREVPAS |
| Ga0318575_100821243 | 3300032055 | Soil | VWVTGGARRRVKSGEPMRIYIIGNDGITLCREAPAAL |
| Ga0318533_101297431 | 3300032059 | Soil | VWVTGGTRRPVDQENPPMRIYIIGNDGITLCREAP |
| Ga0318505_100182661 | 3300032060 | Soil | VWVTGGSRRRVNQENPPMRIYIIGNDGIRLCREASATVND |
| Ga0318504_105832612 | 3300032063 | Soil | VWVTGGSRRRVNQENPPMRIYIIGNDGITLCHEAP |
| Ga0306924_118646511 | 3300032076 | Soil | VWVTGGSRRRVNQENPSMRIYIIGNDGITLCRVAPAT |
| Ga0318577_100976531 | 3300032091 | Soil | VWVTGGSRRRVNQENPTMRIYIIGNDGIMLCGEAPATVN |
| Ga0307471_1020919671 | 3300032180 | Hardwood Forest Soil | VWVTGGSRCRVNHENPPMRIYIIGNDGITLCDKAPATVNDG |
| Ga0306920_1000505708 | 3300032261 | Soil | VWVTGGSRRRVNQENPPMRIYIIGNDGIRLCREASATVN |
| Ga0306920_1020778912 | 3300032261 | Soil | VWVTGGSRCRVNQENSPMRIYTIGNDGITLCREPPAAV |
| Ga0306920_1023535751 | 3300032261 | Soil | VWVTGGTRCRSNQENPPVRIYIIGNDGITLSRKAPAALD |
| Ga0306920_1042538172 | 3300032261 | Soil | VWVIDGTRCRSNQENPPMRIYIIGNDGIRLSGEAPA |
| Ga0318519_101436382 | 3300033290 | Soil | VWVTGGSRCRFNQENPPMRIYIIGHDGITLCREAPATV |
| Ga0318519_101821891 | 3300033290 | Soil | VWVTGGACRRVNQENPRMRIYIIGNDGITLCREMPAAVND |
| Ga0318519_104582351 | 3300033290 | Soil | VWVTGGTRCRANQETPPMRIYIIGNEGVALSRKAPG |
| Ga0318519_110063981 | 3300033290 | Soil | VWATGGSRCRVKSGDPPMRIYIIGDNGIRLCRAAP |
| ⦗Top⦘ |