


| Basic Information | |
|---|---|
| Family ID | F041474 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 47 residues |
| Representative Sequence | ADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFA |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.38 % |
| % of genes near scaffold ends (potentially truncated) | 94.38 % |
| % of genes from short scaffolds (< 2000 bps) | 88.75 % |
| Associated GOLD sequencing projects | 132 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (15.625 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.375 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.375 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.93% β-sheet: 0.00% Coil/Unstructured: 45.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 23.75 |
| PF00005 | ABC_tran | 16.88 |
| PF04072 | LCM | 7.50 |
| PF13442 | Cytochrome_CBB3 | 4.38 |
| PF12911 | OppC_N | 3.75 |
| PF08402 | TOBE_2 | 3.12 |
| PF02627 | CMD | 1.88 |
| PF13416 | SBP_bac_8 | 1.88 |
| PF00296 | Bac_luciferase | 1.88 |
| PF01547 | SBP_bac_1 | 1.88 |
| PF01436 | NHL | 1.25 |
| PF05598 | DUF772 | 0.62 |
| PF00903 | Glyoxalase | 0.62 |
| PF13011 | LZ_Tnp_IS481 | 0.62 |
| PF07681 | DoxX | 0.62 |
| PF01522 | Polysacc_deac_1 | 0.62 |
| PF01556 | DnaJ_C | 0.62 |
| PF00982 | Glyco_transf_20 | 0.62 |
| PF06808 | DctM | 0.62 |
| PF00378 | ECH_1 | 0.62 |
| PF00664 | ABC_membrane | 0.62 |
| PF01497 | Peripla_BP_2 | 0.62 |
| PF00672 | HAMP | 0.62 |
| PF13683 | rve_3 | 0.62 |
| PF12697 | Abhydrolase_6 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 7.50 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.88 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.88 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.88 |
| COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 0.62 |
| COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.62 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.62 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.62 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.62 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.62 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.62 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.00 % |
| Unclassified | root | N/A | 15.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_10848846 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300000550|F24TB_12237523 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300000890|JGI11643J12802_12055432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1617 | Open in IMG/M |
| 3300000891|JGI10214J12806_10374698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 784 | Open in IMG/M |
| 3300000953|JGI11615J12901_10755669 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300004009|Ga0055437_10283369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 549 | Open in IMG/M |
| 3300004114|Ga0062593_102889877 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
| 3300004463|Ga0063356_100853515 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1279 | Open in IMG/M |
| 3300005295|Ga0065707_10597590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 688 | Open in IMG/M |
| 3300005332|Ga0066388_103701196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 780 | Open in IMG/M |
| 3300005332|Ga0066388_104092444 | Not Available | 743 | Open in IMG/M |
| 3300005354|Ga0070675_100102803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2408 | Open in IMG/M |
| 3300005440|Ga0070705_100868935 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 723 | Open in IMG/M |
| 3300005441|Ga0070700_101983640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 505 | Open in IMG/M |
| 3300005457|Ga0070662_101100504 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300005526|Ga0073909_10350690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 684 | Open in IMG/M |
| 3300005545|Ga0070695_101758278 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300005546|Ga0070696_100124261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1871 | Open in IMG/M |
| 3300005547|Ga0070693_101358304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
| 3300005549|Ga0070704_101058243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
| 3300005615|Ga0070702_100428762 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300005616|Ga0068852_101725246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 649 | Open in IMG/M |
| 3300005713|Ga0066905_100087136 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
| 3300005764|Ga0066903_102516368 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 997 | Open in IMG/M |
| 3300005843|Ga0068860_100095485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2834 | Open in IMG/M |
| 3300005843|Ga0068860_100363098 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1427 | Open in IMG/M |
| 3300006049|Ga0075417_10523151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 598 | Open in IMG/M |
| 3300006058|Ga0075432_10381832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 604 | Open in IMG/M |
| 3300006163|Ga0070715_10130183 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300006194|Ga0075427_10032327 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300006755|Ga0079222_11077960 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300006794|Ga0066658_10252973 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300006806|Ga0079220_10642613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 765 | Open in IMG/M |
| 3300006847|Ga0075431_101464099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
| 3300006852|Ga0075433_10774218 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 839 | Open in IMG/M |
| 3300006853|Ga0075420_101002171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 719 | Open in IMG/M |
| 3300006854|Ga0075425_101096810 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300006854|Ga0075425_101160595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 878 | Open in IMG/M |
| 3300006871|Ga0075434_100328705 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300006871|Ga0075434_100365231 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300006880|Ga0075429_100866248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 791 | Open in IMG/M |
| 3300006903|Ga0075426_10550109 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300006904|Ga0075424_100575748 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300006904|Ga0075424_102794792 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006969|Ga0075419_10469042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 871 | Open in IMG/M |
| 3300006969|Ga0075419_11538840 | Not Available | 500 | Open in IMG/M |
| 3300007265|Ga0099794_10811098 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300009038|Ga0099829_10870792 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 748 | Open in IMG/M |
| 3300009094|Ga0111539_10649634 | Not Available | 1228 | Open in IMG/M |
| 3300009094|Ga0111539_11657662 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300009098|Ga0105245_12880258 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300009100|Ga0075418_10703395 | Not Available | 1089 | Open in IMG/M |
| 3300009101|Ga0105247_10715583 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300009156|Ga0111538_13865631 | Not Available | 518 | Open in IMG/M |
| 3300009162|Ga0075423_10552577 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1212 | Open in IMG/M |
| 3300009162|Ga0075423_10803852 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 995 | Open in IMG/M |
| 3300010043|Ga0126380_10436935 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 984 | Open in IMG/M |
| 3300010043|Ga0126380_10459049 | Not Available | 965 | Open in IMG/M |
| 3300010047|Ga0126382_11287821 | Not Available | 660 | Open in IMG/M |
| 3300010359|Ga0126376_12474353 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010359|Ga0126376_12593937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300010362|Ga0126377_12966582 | Not Available | 547 | Open in IMG/M |
| 3300010362|Ga0126377_13457438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 511 | Open in IMG/M |
| 3300010371|Ga0134125_12079683 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 617 | Open in IMG/M |
| 3300010398|Ga0126383_11256036 | Not Available | 831 | Open in IMG/M |
| 3300010400|Ga0134122_10069536 | Not Available | 2734 | Open in IMG/M |
| 3300011270|Ga0137391_10750056 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 808 | Open in IMG/M |
| 3300011271|Ga0137393_10236826 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300012096|Ga0137389_11602702 | Not Available | 547 | Open in IMG/M |
| 3300012208|Ga0137376_11319248 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 612 | Open in IMG/M |
| 3300012361|Ga0137360_10965597 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 735 | Open in IMG/M |
| 3300012509|Ga0157334_1024112 | Not Available | 695 | Open in IMG/M |
| 3300012582|Ga0137358_10286419 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1119 | Open in IMG/M |
| 3300012683|Ga0137398_10136254 | Not Available | 1582 | Open in IMG/M |
| 3300012685|Ga0137397_10983813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 622 | Open in IMG/M |
| 3300012897|Ga0157285_10382121 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012930|Ga0137407_10945667 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 816 | Open in IMG/M |
| 3300012931|Ga0153915_10263560 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
| 3300012951|Ga0164300_11042742 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300012971|Ga0126369_12302532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. G22 | 625 | Open in IMG/M |
| 3300015201|Ga0173478_10521023 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300015245|Ga0137409_10044765 | All Organisms → cellular organisms → Bacteria | 4229 | Open in IMG/M |
| 3300015371|Ga0132258_10011616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 18451 | Open in IMG/M |
| 3300015371|Ga0132258_10559083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2868 | Open in IMG/M |
| 3300015371|Ga0132258_10655101 | All Organisms → cellular organisms → Bacteria | 2641 | Open in IMG/M |
| 3300015371|Ga0132258_12397657 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1322 | Open in IMG/M |
| 3300015372|Ga0132256_101903665 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 702 | Open in IMG/M |
| 3300016270|Ga0182036_10237586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1357 | Open in IMG/M |
| 3300017927|Ga0187824_10019827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1980 | Open in IMG/M |
| 3300017930|Ga0187825_10014620 | All Organisms → cellular organisms → Bacteria | 2626 | Open in IMG/M |
| 3300018058|Ga0187766_11408545 | Not Available | 512 | Open in IMG/M |
| 3300018060|Ga0187765_10869374 | Not Available | 607 | Open in IMG/M |
| 3300018422|Ga0190265_13182541 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300019377|Ga0190264_11132875 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300019881|Ga0193707_1021739 | All Organisms → cellular organisms → Bacteria | 2122 | Open in IMG/M |
| 3300020004|Ga0193755_1024842 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300025538|Ga0210132_1044480 | Not Available | 648 | Open in IMG/M |
| 3300025580|Ga0210138_1080900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 775 | Open in IMG/M |
| 3300025711|Ga0207696_1181969 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
| 3300025899|Ga0207642_10578993 | Not Available | 696 | Open in IMG/M |
| 3300025908|Ga0207643_10692938 | Not Available | 658 | Open in IMG/M |
| 3300025916|Ga0207663_10347691 | Not Available | 1122 | Open in IMG/M |
| 3300025922|Ga0207646_10761750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 863 | Open in IMG/M |
| 3300025923|Ga0207681_10009287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6006 | Open in IMG/M |
| 3300025927|Ga0207687_11788015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300025933|Ga0207706_10592524 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 953 | Open in IMG/M |
| 3300025933|Ga0207706_10630276 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300025981|Ga0207640_10009557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5434 | Open in IMG/M |
| 3300025981|Ga0207640_10701141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 868 | Open in IMG/M |
| 3300026035|Ga0207703_10725832 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 946 | Open in IMG/M |
| 3300026345|Ga0257148_1004393 | Not Available | 975 | Open in IMG/M |
| 3300026475|Ga0257147_1027279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
| 3300026482|Ga0257172_1075783 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 618 | Open in IMG/M |
| 3300027646|Ga0209466_1098343 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 592 | Open in IMG/M |
| 3300027695|Ga0209966_1125931 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 590 | Open in IMG/M |
| 3300027787|Ga0209074_10363319 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300027873|Ga0209814_10046624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1806 | Open in IMG/M |
| 3300027880|Ga0209481_10045170 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
| 3300027903|Ga0209488_10074567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Alcanivoracaceae → Alcanivorax | 2519 | Open in IMG/M |
| 3300027903|Ga0209488_10755589 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300027909|Ga0209382_11579214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium macuxiense | 650 | Open in IMG/M |
| 3300028380|Ga0268265_10049335 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3165 | Open in IMG/M |
| 3300028380|Ga0268265_11572494 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300028828|Ga0307312_11026169 | Not Available | 546 | Open in IMG/M |
| 3300031198|Ga0307500_10226862 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
| 3300031538|Ga0310888_10672645 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 633 | Open in IMG/M |
| 3300031547|Ga0310887_10138812 | Not Available | 1259 | Open in IMG/M |
| 3300031548|Ga0307408_100485961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1078 | Open in IMG/M |
| 3300031572|Ga0318515_10136507 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300031640|Ga0318555_10064331 | All Organisms → cellular organisms → Bacteria | 1885 | Open in IMG/M |
| 3300031679|Ga0318561_10514298 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300031719|Ga0306917_10493220 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 961 | Open in IMG/M |
| 3300031736|Ga0318501_10206187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1030 | Open in IMG/M |
| 3300031740|Ga0307468_100859741 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300031782|Ga0318552_10527339 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 603 | Open in IMG/M |
| 3300031796|Ga0318576_10186928 | Not Available | 973 | Open in IMG/M |
| 3300031820|Ga0307473_10787995 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300031892|Ga0310893_10098890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1067 | Open in IMG/M |
| 3300031892|Ga0310893_10550504 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 523 | Open in IMG/M |
| 3300031940|Ga0310901_10043153 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300031962|Ga0307479_10269298 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1683 | Open in IMG/M |
| 3300032001|Ga0306922_10413442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1444 | Open in IMG/M |
| 3300032002|Ga0307416_100190403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1934 | Open in IMG/M |
| 3300032002|Ga0307416_101778977 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300032043|Ga0318556_10020776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2934 | Open in IMG/M |
| 3300032055|Ga0318575_10138440 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1204 | Open in IMG/M |
| 3300032059|Ga0318533_10391820 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1014 | Open in IMG/M |
| 3300032064|Ga0318510_10509435 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300032094|Ga0318540_10640225 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300032180|Ga0307471_102951012 | Not Available | 604 | Open in IMG/M |
| 3300032205|Ga0307472_100314248 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300032205|Ga0307472_100538158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1016 | Open in IMG/M |
| 3300032770|Ga0335085_11736791 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300033412|Ga0310810_10002782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 18916 | Open in IMG/M |
| 3300033433|Ga0326726_10006486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10525 | Open in IMG/M |
| 3300033502|Ga0326731_1017826 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300033551|Ga0247830_10223525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1415 | Open in IMG/M |
| 3300034659|Ga0314780_225606 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300034668|Ga0314793_007484 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300034674|Ga0314799_009609 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 15.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.12% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.50% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.88% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.25% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.25% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.25% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.25% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.25% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.25% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.62% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.62% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026345 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-A | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034674 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_108488461 | 3300000363 | Soil | YQQFVMVDALAQFCTDKLDLEQTVKWGEEKIKAIYAKFA* |
| F24TB_122375232 | 3300000550 | Soil | FVMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKFV* |
| JGI11643J12802_120554322 | 3300000890 | Soil | TTGYPGPLTPAADEVYQQFIMIDTVAQFCSDRLDLEAAMKWGEDKMKS |
| JGI10214J12806_103746982 | 3300000891 | Soil | DEVYQQFIMVDALAQFCTDKMDLEQTVKWADEKIKAIYAKF* |
| JGI11615J12901_107556692 | 3300000953 | Soil | MIDTVAQFCSDRLDLEAAVKWGEEKIKGIYAKFA* |
| Ga0055437_102833691 | 3300004009 | Natural And Restored Wetlands | DEVYQQFVMVDALAQFCTDKMDLEQTIKWGEDKIKAIHAKFA* |
| Ga0062593_1028898771 | 3300004114 | Soil | GPVTAASDEVYQQFVMIDACAQFCSDKMDLEQTVKWAEEKIKGIYAKFV* |
| Ga0063356_1008535152 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VYQQFVMIDAVAQFCADKMDLEQTVKWAEEKLKSIYAKFV* |
| Ga0065707_105975902 | 3300005295 | Switchgrass Rhizosphere | TPAADEVYQQFVMVDALAQYCVDKLDLEAAVKWGEEKIKAIHAKFA* |
| Ga0066388_1037011962 | 3300005332 | Tropical Forest Soil | ADEVYQQFVMVDALAQFCVDKLDLEGAVKWGEEKIKAIYAKFA* |
| Ga0066388_1040924441 | 3300005332 | Tropical Forest Soil | VYQQFVMVDALAQFCTDKMDLEQTVKWGEDKIKAIHAKFA* |
| Ga0070675_1001028031 | 3300005354 | Miscanthus Rhizosphere | PAADEVYQQFVMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFA* |
| Ga0070705_1008689352 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GYPGPCSAAADEVYQQFIMIDAVAQFCTDKMDLEQTVKWGEDKLKAIYSKFV* |
| Ga0070700_1019836402 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | ADEVYQQFVMVDALAQFATDKMDLEQTVKWGEEKIKAIHAKFA* |
| Ga0070662_1011005042 | 3300005457 | Corn Rhizosphere | YQQFVMVDALAQFCTDKLDLEQTVKWGEEKIKGIYSKFA* |
| Ga0073909_103506902 | 3300005526 | Surface Soil | PAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV* |
| Ga0070695_1017582782 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | EVYQQFVLVDALAQYCVDKLDLEAAVKWGEEKIKAIHAKFA* |
| Ga0070696_1001242613 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VYQQFIMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFV* |
| Ga0070693_1013583041 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | PEYHFTQGYPGPVTAASDEVYQQFVMIDACAQFCSDKMDLEQTVKWAEEKIKGIYAKFV* |
| Ga0070704_1010582431 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTIKWGEEKIKAIYAKFV* |
| Ga0070702_1004287621 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | PAADEVYQQFIMVDALAQFATDKMDLEQTVKWAEDKIKAVYAKYV* |
| Ga0068852_1017252461 | 3300005616 | Corn Rhizosphere | PAADEVYQQFVMVDALAQFCADKLDLEGAVRWGEEKIKSIYGKFA* |
| Ga0066905_1000871361 | 3300005713 | Tropical Forest Soil | MVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV* |
| Ga0066903_1025163681 | 3300005764 | Tropical Forest Soil | YPGPVTAASDEVYQQFVLIDTVAQFCVGKMDLEQAMKWSGDKLHEIYAKFV* |
| Ga0068860_1000954854 | 3300005843 | Switchgrass Rhizosphere | GPLTPAADEVYQQFIMVDALAQFATDKMDLEQTIKWAEEKIKAIYAKFV* |
| Ga0068860_1003630981 | 3300005843 | Switchgrass Rhizosphere | EVYQQFIMVDALAQYCTDKLDLEATVKWAEEKIKAVYAKFA* |
| Ga0075417_105231512 | 3300006049 | Populus Rhizosphere | TPAADEVYQQFVMIDTVAQFCSDRLDLEAAVKWGDEKIKSIYAKFA* |
| Ga0075432_103818322 | 3300006058 | Populus Rhizosphere | VYQQFVMVDALAQFCTDKMDLEQTVKWAEEKIKAIYAKFA* |
| Ga0070715_101301832 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | PGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKYV* |
| Ga0075427_100323272 | 3300006194 | Populus Rhizosphere | TPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV* |
| Ga0079222_110779601 | 3300006755 | Agricultural Soil | AEYHFTTGYPGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTVKWAEDKIKAVYAKYV* |
| Ga0066658_102529731 | 3300006794 | Soil | DAEYHFTTGYPGQVTPAADEVYQQFAMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFV |
| Ga0079220_106426131 | 3300006806 | Agricultural Soil | DEVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFV* |
| Ga0075431_1014640991 | 3300006847 | Populus Rhizosphere | DEVYQQFVMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKFA* |
| Ga0075433_107742181 | 3300006852 | Populus Rhizosphere | YQQFVMIDAVAQFCTDKMDLETTIKWGEDRIKAIYAKFA* |
| Ga0075420_1010021712 | 3300006853 | Populus Rhizosphere | DEVYQQFVMIDTVAQFCSDRLDLEAAVKWGDEKIKSIYAKFA* |
| Ga0075425_1010968101 | 3300006854 | Populus Rhizosphere | ADEVYQQFIMVDALAQFATDKMDLEQTVKWAEDKIKAVYAKYV* |
| Ga0075425_1011605952 | 3300006854 | Populus Rhizosphere | PLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFV* |
| Ga0075434_1003287051 | 3300006871 | Populus Rhizosphere | QFVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFV* |
| Ga0075434_1003652313 | 3300006871 | Populus Rhizosphere | EYHFTMGYPGPCTPAADEVYQQFVMVDALAQFCTDKMDLETTIKWGEDKIKAIYAKFA* |
| Ga0075429_1008662482 | 3300006880 | Populus Rhizosphere | GPLTPAADEVYQQFVMVDALAQFCADKLDLEQAVKWGEEKIKSIYAKFA* |
| Ga0075426_105501091 | 3300006903 | Populus Rhizosphere | QQFIMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKYV* |
| Ga0075424_1005757482 | 3300006904 | Populus Rhizosphere | YHFTTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAVYAKYV* |
| Ga0075424_1027947922 | 3300006904 | Populus Rhizosphere | ADEVYQQFIMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKYV* |
| Ga0075419_104690422 | 3300006969 | Populus Rhizosphere | TTGYPGPLTPAADEVYQQFVMVDALAQFCTDKLDLEQTVKWGEEKIKAIYAKFA* |
| Ga0075419_115388401 | 3300006969 | Populus Rhizosphere | DEVYQQFIMVDALAQYCTDKLDLEAAVKWAEEKIKAVYAKFA* |
| Ga0099794_108110982 | 3300007265 | Vadose Zone Soil | AEYHFTTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKFA* |
| Ga0099829_108707922 | 3300009038 | Vadose Zone Soil | PAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKFV* |
| Ga0111539_106496341 | 3300009094 | Populus Rhizosphere | PGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWADEKIKAIYAKFA* |
| Ga0111539_116576622 | 3300009094 | Populus Rhizosphere | YQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV* |
| Ga0105245_128802581 | 3300009098 | Miscanthus Rhizosphere | VYQQFVMVDALAQYCVDKLDLEAAVKWGEEKIKAIHAKFA* |
| Ga0075418_107033951 | 3300009100 | Populus Rhizosphere | DEVYQQFVLIDAAAQFCADKMDLEQTIKWGEDKLKSIYAKFV* |
| Ga0105247_107155831 | 3300009101 | Switchgrass Rhizosphere | DEVYQQFVMVDALAQFCTDKMDLEQTVKWGEDKIKAIYAKSA* |
| Ga0111538_138656311 | 3300009156 | Populus Rhizosphere | YQQFVMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFA* |
| Ga0075423_105525771 | 3300009162 | Populus Rhizosphere | HFTTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFA* |
| Ga0075423_108038522 | 3300009162 | Populus Rhizosphere | MVDALAQFATDKMDLEQTVKWAEEKIKAIYAKYV* |
| Ga0126380_104369351 | 3300010043 | Tropical Forest Soil | VRPDAVRLHQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV* |
| Ga0126380_104590492 | 3300010043 | Tropical Forest Soil | YHFTTGYPGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWADEKIKAIYAKFA* |
| Ga0126382_112878211 | 3300010047 | Tropical Forest Soil | HFTTGYPGPLTPAADEVYQQFVMVDALAQYATDKMDLEQTVKWADEKIKAIYAKFA* |
| Ga0126376_124743532 | 3300010359 | Tropical Forest Soil | GYPGPLTPAADEIYQQFIMVDALAQYCVDKLDLEAAVKWGEEKIKAIHAKFA* |
| Ga0126376_125939371 | 3300010359 | Tropical Forest Soil | PLTPAADEVYQQFIMVDTLAQFCVDKLDLEGAVKWGEEKIKQIYAKFA* |
| Ga0126377_129665822 | 3300010362 | Tropical Forest Soil | MVDALAQFCTDKMDLEQTVKWGEEKIKAVYAKSA* |
| Ga0126377_134574382 | 3300010362 | Tropical Forest Soil | VSADEVYQQFVMVDGLAQFCTDKMDLEQTVKWGEDKIKAIYAKSA* |
| Ga0134125_120796831 | 3300010371 | Terrestrial Soil | SPEYHYTIGYPGPLTVAADEVYQQFVLIDAAAQFCTDKMDLEQTIKWGEDKLKAIYSKFV |
| Ga0126383_112560361 | 3300010398 | Tropical Forest Soil | LTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWADEKIRAIYAKFA* |
| Ga0134122_100695361 | 3300010400 | Terrestrial Soil | EVYQQFVMIDACAQFCSDKMDLEQTVKWAEEKIKGIYAKFV* |
| Ga0137391_107500562 | 3300011270 | Vadose Zone Soil | YHFTTGYPGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFV* |
| Ga0137393_102368263 | 3300011271 | Vadose Zone Soil | EYHFTTGYPGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFV* |
| Ga0137389_116027021 | 3300012096 | Vadose Zone Soil | PGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTIKWGEEKIKAIYAKFV* |
| Ga0137376_113192482 | 3300012208 | Vadose Zone Soil | FTTGYPGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTIKWGEEKIKAIYAKFV* |
| Ga0137360_109655971 | 3300012361 | Vadose Zone Soil | HYTMDYPGPSSPAADEVYQQCVMIDPTAQFCTEKMDLETTVKWGEDKIRAIYAKFA* |
| Ga0157334_10241122 | 3300012509 | Soil | MVDALAQFCTDKMDLEQTVKWGEEKIKGVHAKFA* |
| Ga0137358_102864191 | 3300012582 | Vadose Zone Soil | PGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFV* |
| Ga0137398_101362543 | 3300012683 | Vadose Zone Soil | PLTPAADEVYQQFIMVDALAQFATDKMDLEQTIKWGEEKIKAIYAKFV* |
| Ga0137397_109838132 | 3300012685 | Vadose Zone Soil | VTTLSKQFVMVDALAQYCVDRLDLEAAVKWGEEKIKAIHAKFA* |
| Ga0157285_103821212 | 3300012897 | Soil | PGQLTPAADEVYQQFVLVDALAQFCADKLDLEGAVKWGEEKIKSIYAKFA* |
| Ga0137407_109456671 | 3300012930 | Vadose Zone Soil | QFVMVDALAQFATDKMDLEQTVKWAEDKIKAVYAKYV* |
| Ga0153915_102635604 | 3300012931 | Freshwater Wetlands | YQQFVMVDALAQFATDKMDLEQTIKWGDERIKAIYAKFA* |
| Ga0164300_110427421 | 3300012951 | Soil | DEVYQQFVLVDALAQFCADKLDLEGAVKWGEEKIKAIHAKFA* |
| Ga0126369_123025321 | 3300012971 | Tropical Forest Soil | GFPGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWADEKIKAIYAKFA* |
| Ga0173478_105210231 | 3300015201 | Soil | MVDALAQFCTDKMDLEQTVKWAEEKIKAIYAKFA* |
| Ga0137409_100447655 | 3300015245 | Vadose Zone Soil | DEVYQQFIMVDALAQFATDKMDLEQTIKWAEEKIKAIYAKFV* |
| Ga0132258_1001161614 | 3300015371 | Arabidopsis Rhizosphere | YHFTTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV* |
| Ga0132258_105590834 | 3300015371 | Arabidopsis Rhizosphere | AADEVYQQFIMVDALAQFCTDKMDLEQTVKWGEEKIKGVHAKFA* |
| Ga0132258_106551011 | 3300015371 | Arabidopsis Rhizosphere | PAADEVYQQFIMVDALAQYCTDKLDLEATVKWGEEKIKAVYAKFA* |
| Ga0132258_123976572 | 3300015371 | Arabidopsis Rhizosphere | VYQQFIMVDALAQYCTDKLDLEAAVKWAEEKIKAVYAKFA* |
| Ga0132256_1019036652 | 3300015372 | Arabidopsis Rhizosphere | AADEVYQQFVLIDAAAQFCTDKMDLEQTIKWGEDKLKAIYAKFI* |
| Ga0182036_102375863 | 3300016270 | Soil | YHFTTGYPGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKGIHAKFA |
| Ga0187824_100198271 | 3300017927 | Freshwater Sediment | QFVMVDALAQFATDKMDLEQTIKWGEERIKAIYAKFV |
| Ga0187825_100146201 | 3300017930 | Freshwater Sediment | PLTPAADEVYQQFVMVDALAQFATDKMDLEQTIKWGEERIKAIYAKFV |
| Ga0187766_114085451 | 3300018058 | Tropical Peatland | YQQFIMVDALAQYCTDKLDLEATVRWADDKIKAVYAKFA |
| Ga0187765_108693741 | 3300018060 | Tropical Peatland | LTPAADEVYQQFVMVDALAQFCTDKLDLEQAVKWGEERIKGIYSKFV |
| Ga0190265_131825411 | 3300018422 | Soil | TTGYPGPLTPAADEVYQQFVMVDALAQFCADKMDLEQTVKWGEDKIKAIYAKFA |
| Ga0190264_111328751 | 3300019377 | Soil | PGPLTQAADEVYQQFVMVDALAQFCTDKMDLEQTVKWAEDKIKAIYAKF |
| Ga0193707_10217393 | 3300019881 | Soil | VYQQFVMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKFA |
| Ga0193755_10248423 | 3300020004 | Soil | VTRRNGERVDALAQFCVDKLDLEGAVKWGEDKIKAVYAKFA |
| Ga0210132_10444802 | 3300025538 | Natural And Restored Wetlands | EVYQQFVMVDALAQFCTDKMDLEQTIKWADEKIKAIHAKFA |
| Ga0210138_10809001 | 3300025580 | Natural And Restored Wetlands | FTTGHPGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTIKWGEDKIKAIHAKFA |
| Ga0207696_11819691 | 3300025711 | Switchgrass Rhizosphere | QDAEYHFTTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAVYAKY |
| Ga0207642_105789932 | 3300025899 | Miscanthus Rhizosphere | ADEVYQQFIMVDALAQFCTDKMDLEATIKWGEDKIKAVYAKYA |
| Ga0207643_106929381 | 3300025908 | Miscanthus Rhizosphere | GPFNPAADEVYQQFIMVDALAQYCTDKLDLEATVKWAEEKIKAVYAKFA |
| Ga0207663_103476911 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | DAEYHFTTGYPGPLTPAADEVYQQFIMVDALAQFCTDKMDLEQTVKWGEEKIKGVHAKFA |
| Ga0207646_107617502 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFV |
| Ga0207681_100092871 | 3300025923 | Switchgrass Rhizosphere | YQQFVMVDALAQYCVDKLDLEAAVKWGEEKIKAIHAKFA |
| Ga0207687_117880152 | 3300025927 | Miscanthus Rhizosphere | QQFVMVDALAQYCVDKLDLEAAVKWGEEKIKAIHAKFA |
| Ga0207706_105925241 | 3300025933 | Corn Rhizosphere | YTIGYPGPLTVAADEVYQQFILIDAAAQFCTDKMDLEQTIKWGEDKLKAIYAKFI |
| Ga0207706_106302761 | 3300025933 | Corn Rhizosphere | GPCSAAADEVYQQFIMIDAVAQFCTDKMDLEQTVKWGEDKLKAIYSKFV |
| Ga0207640_100095576 | 3300025981 | Corn Rhizosphere | EYHFTTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFA |
| Ga0207640_107011411 | 3300025981 | Corn Rhizosphere | GYPGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTIKWAEEKIKAIYAKFV |
| Ga0207703_107258321 | 3300026035 | Switchgrass Rhizosphere | EVYQQFIMVDALAQYCTDKLDLEATVKWAEEKIKAVYAKFA |
| Ga0257148_10043932 | 3300026345 | Soil | EVYQQFVMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKFV |
| Ga0257147_10272792 | 3300026475 | Soil | GYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKFV |
| Ga0257172_10757832 | 3300026482 | Soil | AADEVYQQFVMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKFV |
| Ga0209466_10983431 | 3300027646 | Tropical Forest Soil | MRPDAVRLHQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV |
| Ga0209966_11259311 | 3300027695 | Arabidopsis Thaliana Rhizosphere | PLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFA |
| Ga0209074_103633192 | 3300027787 | Agricultural Soil | AEYHFTTGYPGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTVKWAEDKIKAVYAKYV |
| Ga0209814_100466243 | 3300027873 | Populus Rhizosphere | EYHFTTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV |
| Ga0209481_100451701 | 3300027880 | Populus Rhizosphere | PAADEVYQQFVMVDALAQFCTDKLDLEQTVKWGEEKIKAIYAKFA |
| Ga0209488_100745673 | 3300027903 | Vadose Zone Soil | GPLTPAADEVYQQFIMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFV |
| Ga0209488_107555892 | 3300027903 | Vadose Zone Soil | GPLTPAADEVYQQFIMVDALAQFATDKMDLEQTIKWGEEKIKAIYAKFV |
| Ga0209382_115792141 | 3300027909 | Populus Rhizosphere | YPGPLTPAADEVYQQFVMVDALAQFCSDKLDLEQTIKWGEEKIKAIYAKFA |
| Ga0268265_100493355 | 3300028380 | Switchgrass Rhizosphere | YHFTIGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWGEEKIKAIYAKFA |
| Ga0268265_115724941 | 3300028380 | Switchgrass Rhizosphere | GALTPAADEVYQQFVMVDALAQFWTDKMDLEATIKWGEDKIKAVYAKFV |
| Ga0307312_110261691 | 3300028828 | Soil | VYQQFIMVDALAQFATDKMDLEQTIKWGEEKIKAIYAKFV |
| Ga0307500_102268621 | 3300031198 | Soil | VYQQFVMVDALAQFCTDKMDLEMTIKWGEDKIRAIYAKFA |
| Ga0310888_106726452 | 3300031538 | Soil | FIMIDAVAQFCTDKMDLEQTVKWGEDKLKAIYSKFV |
| Ga0310887_101388123 | 3300031547 | Soil | YQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAVYAKYV |
| Ga0307408_1004859611 | 3300031548 | Rhizosphere | TGYPGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFA |
| Ga0318515_101365072 | 3300031572 | Soil | VYQQFIMVDALAQFCTDKLDLERAIKWGEEKIKAVYATVA |
| Ga0318555_100643313 | 3300031640 | Soil | EYHFTMGYPGPCSPAADEVYQQFVMIDAVAQFCTDKMDLETTIKWGEDKIKAIYAKFA |
| Ga0318561_105142981 | 3300031679 | Soil | IMVDALAQFCTDKLDLERAIKWGEEKIKAVYTTVA |
| Ga0306917_104932201 | 3300031719 | Soil | DEVYQQFVMVDALAQFCTDKLDLEQAVKWGEEKIKAIHAKFV |
| Ga0318501_102061871 | 3300031736 | Soil | MGYPGPCSPAADEVYQQFVMIDAVAQFCTDKMDLETTIKWGEDKIKAIYAKFA |
| Ga0307468_1008597412 | 3300031740 | Hardwood Forest Soil | DAEYHFTTGYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV |
| Ga0318552_105273392 | 3300031782 | Soil | LTPAADEVYQQFVMVDALAQFCTDKLDLEQAVKWGEEKIKAIHAKFV |
| Ga0318576_101869281 | 3300031796 | Soil | VYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKGIHAKFA |
| Ga0307473_107879952 | 3300031820 | Hardwood Forest Soil | PADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEDKIKAIYAKSA |
| Ga0310893_100988901 | 3300031892 | Soil | GPLTPAADEVYQQFVMVDALAQFATDKMDLEQTVKWAEDKIKAIYAKFV |
| Ga0310893_105505042 | 3300031892 | Soil | DEVYQQFIMIDAVAQFCTDKMDLEQTVKWGEDKLKAIYSKFV |
| Ga0310901_100431532 | 3300031940 | Soil | LTPAADEVYQQFILVDALAQYCVDKLDLEAAVKWGEEKIKAIHAKFA |
| Ga0307479_102692983 | 3300031962 | Hardwood Forest Soil | TTGYPGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEERIKAIYAKFV |
| Ga0306922_104134421 | 3300032001 | Soil | QDAEYHFTTGYPGPLTPAADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKGIHAKF |
| Ga0307416_1001904033 | 3300032002 | Rhizosphere | VMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFA |
| Ga0307416_1017789772 | 3300032002 | Rhizosphere | ADEVYQQFVMVDALAQFCTDKMDLEQTVKWGEEKIKAIYAKFA |
| Ga0318556_100207761 | 3300032043 | Soil | DYHFTTGYPGPLTPAADEVYQQFVMVDALAQFCTDKLDLEQAVKWGEEKIKAIHAKFV |
| Ga0318575_101384402 | 3300032055 | Soil | PGPCSPAADEVYQQFVMIDAVAQFCTDKMDLETTIKWGEDKIKAIYAKFA |
| Ga0318533_103918202 | 3300032059 | Soil | VMVDALAQFCTDKLDLEQAVKWGEEKIKAIHAKFV |
| Ga0318510_105094352 | 3300032064 | Soil | PGPLTPAADEVYQQFVMVDALAQFCTDKLDLEQAVKWGEEKIKAIHAKFV |
| Ga0318540_106402252 | 3300032094 | Soil | VYQQFIMVDALAQFCTDKLDLERAIKWGEEKIKAVYTTVA |
| Ga0307471_1029510122 | 3300032180 | Hardwood Forest Soil | PAADEVYQQFVLIDAAAQFCADKMDLEQTIKWGEDKLKSIYAKFV |
| Ga0307472_1003142481 | 3300032205 | Hardwood Forest Soil | GYPGPLTPAADEVYQQFIMVDALAQFATDKMDLEQTVKWAEEKIKAIYAKYV |
| Ga0307472_1005381581 | 3300032205 | Hardwood Forest Soil | GYPGPLTPAADEVYQQFVMVDALAQFATDKMDLEQTIKWAEEKIKAIYAKFV |
| Ga0335085_117367911 | 3300032770 | Soil | EQFVLIDAVAQYCADRMDLEHTVKWADDKLNRIYAKFA |
| Ga0310810_1000278219 | 3300033412 | Soil | QDAEYHFTTGYPGQLTPAADEVYQQFVMVDALAQFCTDKLDLEGAVKWGEEKIKQIYAKF |
| Ga0326726_1000648610 | 3300033433 | Peat Soil | FIMVDALAQFATDKMDLEQTIKWGEEKIKAIYAKFV |
| Ga0326731_10178261 | 3300033502 | Peat Soil | QFIMVDALAQFATDKMDLEQTIKWGEEKIKAIYAKFV |
| Ga0247830_102235252 | 3300033551 | Soil | GPLTPAADEVYQQFVMVDALAQFCTDKLDLEATVKWGEEKIKSIYAKFA |
| Ga0314780_225606_2_145 | 3300034659 | Soil | LTPAADEVYQQFVMVDALAQFCADKMDLEQTVKWGEDKIKAIYAKFA |
| Ga0314793_007484_1269_1448 | 3300034668 | Soil | AEYHFTTGYPGPLTPAADEVYQQFILVDALAQYCVDKLDLEAAVKWGEEKIKAIHAKFA |
| Ga0314799_009609_9_152 | 3300034674 | Soil | LTPAADEVYQQFAMVDALAQFCADKLDLEGAVRWGEEKIKSIYGKFA |
| ⦗Top⦘ |