


| Basic Information | |
|---|---|
| Family ID | F041447 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MVGKNEKEECPAHKCKPFMLMSYLAAVFLILGICAFAKYLFF |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 70.62 % |
| % of genes near scaffold ends (potentially truncated) | 42.50 % |
| % of genes from short scaffolds (< 2000 bps) | 70.62 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.375 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.125 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.125 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.57% β-sheet: 0.00% Coil/Unstructured: 61.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF02734 | Dak2 | 18.12 |
| PF08240 | ADH_N | 8.12 |
| PF02733 | Dak1 | 7.50 |
| PF00939 | Na_sulph_symp | 4.38 |
| PF04134 | DCC1-like | 3.12 |
| PF13641 | Glyco_tranf_2_3 | 3.12 |
| PF04832 | SOUL | 2.50 |
| PF08335 | GlnD_UR_UTase | 1.88 |
| PF11769 | DUF3313 | 1.25 |
| PF13424 | TPR_12 | 1.25 |
| PF03466 | LysR_substrate | 1.25 |
| PF13432 | TPR_16 | 0.62 |
| PF02548 | Pantoate_transf | 0.62 |
| PF00127 | Copper-bind | 0.62 |
| PF07103 | DUF1365 | 0.62 |
| PF13602 | ADH_zinc_N_2 | 0.62 |
| PF02696 | SelO | 0.62 |
| PF00854 | PTR2 | 0.62 |
| PF11741 | AMIN | 0.62 |
| PF14552 | Tautomerase_2 | 0.62 |
| PF03937 | Sdh5 | 0.62 |
| PF04244 | DPRP | 0.62 |
| PF08450 | SGL | 0.62 |
| PF06271 | RDD | 0.62 |
| PF13414 | TPR_11 | 0.62 |
| PF00875 | DNA_photolyase | 0.62 |
| PF04366 | Ysc84 | 0.62 |
| PF03306 | AAL_decarboxy | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG2376 | Dihydroxyacetone kinase | Carbohydrate transport and metabolism [G] | 7.50 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 4.38 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 4.38 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 3.12 |
| COG2844 | UTP:GlnB (protein PII) uridylyltransferase | Signal transduction mechanisms [T] | 1.88 |
| COG0397 | Protein adenylyltransferase (AMPylase) SelO/YdiU (selenoprotein O) | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG0413 | Ketopantoate hydroxymethyltransferase | Coenzyme transport and metabolism [H] | 0.62 |
| COG0415 | Deoxyribodipyrimidine photolyase | Replication, recombination and repair [L] | 0.62 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.62 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.62 |
| COG2938 | Succinate dehydrogenase flavin-adding protein, antitoxin component of the CptAB toxin-antitoxin module | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG3046 | Uncharacterized conserved protein related to deoxyribodipyrimidine photolyase | General function prediction only [R] | 0.62 |
| COG3104 | Dipeptide/tripeptide permease | Amino acid transport and metabolism [E] | 0.62 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.62 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.62 |
| COG3496 | Uncharacterized conserved protein, DUF1365 family | Function unknown [S] | 0.62 |
| COG3527 | Alpha-acetolactate decarboxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.38 % |
| Unclassified | root | N/A | 40.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10020004 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3933 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10170767 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300000167|SI39nov09_120mDRAFT_c1076598 | Not Available | 602 | Open in IMG/M |
| 3300000237|SI34jun09_150mDRAFT_1020778 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300001346|JGI20151J14362_10052742 | Not Available | 1752 | Open in IMG/M |
| 3300001346|JGI20151J14362_10153438 | Not Available | 686 | Open in IMG/M |
| 3300001346|JGI20151J14362_10165927 | Not Available | 641 | Open in IMG/M |
| 3300001348|JGI20154J14316_10091694 | Not Available | 1009 | Open in IMG/M |
| 3300001348|JGI20154J14316_10102366 | Not Available | 908 | Open in IMG/M |
| 3300001352|JGI20157J14317_10006313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8612 | Open in IMG/M |
| 3300001355|JGI20158J14315_10032121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2457 | Open in IMG/M |
| 3300001355|JGI20158J14315_10077791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1230 | Open in IMG/M |
| 3300001589|JGI24005J15628_10004633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 6798 | Open in IMG/M |
| 3300001589|JGI24005J15628_10009107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4639 | Open in IMG/M |
| 3300001947|GOS2218_1023900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1677 | Open in IMG/M |
| 3300003478|JGI26238J51125_1059569 | Not Available | 766 | Open in IMG/M |
| 3300003478|JGI26238J51125_1095966 | Not Available | 562 | Open in IMG/M |
| 3300003494|JGI26240J51127_1000257 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 23703 | Open in IMG/M |
| 3300003495|JGI26244J51143_1000187 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 30245 | Open in IMG/M |
| 3300003593|JGI26259J51720_1009919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1809 | Open in IMG/M |
| 3300004274|Ga0066607_1009577 | All Organisms → cellular organisms → Bacteria | 3041 | Open in IMG/M |
| 3300004276|Ga0066610_10056158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1410 | Open in IMG/M |
| 3300004278|Ga0066609_10097466 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300004279|Ga0066605_10028734 | All Organisms → cellular organisms → Bacteria | 2677 | Open in IMG/M |
| 3300005239|Ga0073579_1018336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2027 | Open in IMG/M |
| 3300005239|Ga0073579_1173316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 9109 | Open in IMG/M |
| 3300005239|Ga0073579_1190345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 99587 | Open in IMG/M |
| 3300006164|Ga0075441_10001364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11780 | Open in IMG/M |
| 3300006164|Ga0075441_10009189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4229 | Open in IMG/M |
| 3300006165|Ga0075443_10164236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 787 | Open in IMG/M |
| 3300006190|Ga0075446_10002226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7620 | Open in IMG/M |
| 3300006190|Ga0075446_10017917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → Methylophilales bacterium | 2400 | Open in IMG/M |
| 3300006621|Ga0101441_103331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 43245 | Open in IMG/M |
| 3300006947|Ga0075444_10015271 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4097 | Open in IMG/M |
| 3300006947|Ga0075444_10097146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1294 | Open in IMG/M |
| 3300007863|Ga0105744_1152126 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300008253|Ga0105349_10070224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1468 | Open in IMG/M |
| 3300008950|Ga0102891_1233856 | Not Available | 529 | Open in IMG/M |
| 3300008961|Ga0102887_1043029 | Not Available | 1511 | Open in IMG/M |
| 3300008964|Ga0102889_1083679 | Not Available | 952 | Open in IMG/M |
| 3300009071|Ga0115566_10262141 | Not Available | 1031 | Open in IMG/M |
| 3300009071|Ga0115566_10565846 | Not Available | 639 | Open in IMG/M |
| 3300009071|Ga0115566_10598740 | Not Available | 617 | Open in IMG/M |
| 3300009076|Ga0115550_1036972 | Not Available | 2111 | Open in IMG/M |
| 3300009079|Ga0102814_10264243 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300009086|Ga0102812_10265599 | Not Available | 934 | Open in IMG/M |
| 3300009132|Ga0118730_1050755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3101 | Open in IMG/M |
| 3300009172|Ga0114995_10006057 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7840 | Open in IMG/M |
| 3300009172|Ga0114995_10008874 | All Organisms → cellular organisms → Bacteria | 6337 | Open in IMG/M |
| 3300009172|Ga0114995_10236028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1011 | Open in IMG/M |
| 3300009172|Ga0114995_10351231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 810 | Open in IMG/M |
| 3300009172|Ga0114995_10656961 | Not Available | 573 | Open in IMG/M |
| 3300009193|Ga0115551_1033108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → Methylophilales bacterium | 2623 | Open in IMG/M |
| 3300009193|Ga0115551_1274235 | Not Available | 742 | Open in IMG/M |
| 3300009193|Ga0115551_1373582 | Not Available | 615 | Open in IMG/M |
| 3300009420|Ga0114994_10890914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 577 | Open in IMG/M |
| 3300009425|Ga0114997_10008957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7249 | Open in IMG/M |
| 3300009425|Ga0114997_10035873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3268 | Open in IMG/M |
| 3300009425|Ga0114997_10460809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 681 | Open in IMG/M |
| 3300009437|Ga0115556_1205169 | Not Available | 710 | Open in IMG/M |
| 3300009440|Ga0115561_1320330 | Not Available | 571 | Open in IMG/M |
| 3300009498|Ga0115568_10359972 | Not Available | 635 | Open in IMG/M |
| 3300009526|Ga0115004_10324774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 912 | Open in IMG/M |
| 3300009599|Ga0115103_1775548 | Not Available | 503 | Open in IMG/M |
| 3300009705|Ga0115000_10082709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → unclassified Polynucleobacter → Polynucleobacter sp. es-MAR-4 | 2168 | Open in IMG/M |
| 3300009785|Ga0115001_10679824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 625 | Open in IMG/M |
| 3300010883|Ga0133547_10215515 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4071 | Open in IMG/M |
| 3300012414|Ga0138264_1635648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 608 | Open in IMG/M |
| 3300012417|Ga0138262_1668318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 602 | Open in IMG/M |
| 3300012417|Ga0138262_1839918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 515 | Open in IMG/M |
| 3300012418|Ga0138261_1284018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1082 | Open in IMG/M |
| 3300012419|Ga0138260_10173824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 563 | Open in IMG/M |
| 3300016733|Ga0182042_1403243 | Not Available | 527 | Open in IMG/M |
| 3300016737|Ga0182047_1186630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1387 | Open in IMG/M |
| 3300017729|Ga0181396_1011349 | Not Available | 1778 | Open in IMG/M |
| 3300017735|Ga0181431_1035786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1134 | Open in IMG/M |
| 3300017776|Ga0181394_1272310 | Not Available | 504 | Open in IMG/M |
| 3300020165|Ga0206125_10010539 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6565 | Open in IMG/M |
| 3300020165|Ga0206125_10015493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 4898 | Open in IMG/M |
| 3300020165|Ga0206125_10079499 | Not Available | 1451 | Open in IMG/M |
| 3300020169|Ga0206127_1045183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 2306 | Open in IMG/M |
| 3300020173|Ga0181602_10009726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6660 | Open in IMG/M |
| 3300020185|Ga0206131_10371936 | Not Available | 608 | Open in IMG/M |
| 3300020335|Ga0211690_1070900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 769 | Open in IMG/M |
| 3300020376|Ga0211682_10271338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 643 | Open in IMG/M |
| 3300020376|Ga0211682_10294217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 611 | Open in IMG/M |
| 3300020595|Ga0206126_10373125 | Not Available | 632 | Open in IMG/M |
| 3300020810|Ga0181598_1011507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5975 | Open in IMG/M |
| 3300021085|Ga0206677_10113004 | Not Available | 1262 | Open in IMG/M |
| 3300021087|Ga0206683_10550850 | Not Available | 563 | Open in IMG/M |
| 3300021185|Ga0206682_10317668 | Not Available | 674 | Open in IMG/M |
| 3300021365|Ga0206123_10293343 | Not Available | 694 | Open in IMG/M |
| 3300021959|Ga0222716_10662989 | Not Available | 559 | Open in IMG/M |
| (restricted) 3300022920|Ga0233426_10200572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 818 | Open in IMG/M |
| 3300022921|Ga0255765_1064073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 2074 | Open in IMG/M |
| 3300022921|Ga0255765_1304192 | Not Available | 632 | Open in IMG/M |
| (restricted) 3300022933|Ga0233427_10110206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1307 | Open in IMG/M |
| 3300023685|Ga0228686_1063884 | Not Available | 508 | Open in IMG/M |
| 3300023702|Ga0232119_1075265 | Not Available | 503 | Open in IMG/M |
| 3300024229|Ga0233402_1090191 | Not Available | 639 | Open in IMG/M |
| 3300024248|Ga0228676_1042504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1040 | Open in IMG/M |
| (restricted) 3300024252|Ga0233435_1037851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2008 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10146875 | Not Available | 1016 | Open in IMG/M |
| (restricted) 3300024261|Ga0233439_10322834 | Not Available | 655 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10047473 | All Organisms → cellular organisms → Bacteria | 2605 | Open in IMG/M |
| 3300024292|Ga0228630_1044246 | Not Available | 1065 | Open in IMG/M |
| (restricted) 3300024327|Ga0233434_1009589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 6236 | Open in IMG/M |
| (restricted) 3300024339|Ga0233445_1231911 | Not Available | 532 | Open in IMG/M |
| 3300025138|Ga0209634_1001518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 16837 | Open in IMG/M |
| 3300025138|Ga0209634_1009008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6125 | Open in IMG/M |
| 3300025641|Ga0209833_1048422 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300025680|Ga0209306_1055300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera | 1264 | Open in IMG/M |
| 3300025690|Ga0209505_1089790 | Not Available | 896 | Open in IMG/M |
| 3300025770|Ga0209362_1257783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 561 | Open in IMG/M |
| 3300025870|Ga0209666_1095799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1456 | Open in IMG/M |
| 3300025874|Ga0209533_1380785 | Not Available | 515 | Open in IMG/M |
| 3300025886|Ga0209632_10122197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1479 | Open in IMG/M |
| 3300025886|Ga0209632_10304391 | Not Available | 793 | Open in IMG/M |
| 3300025894|Ga0209335_10264234 | Not Available | 749 | Open in IMG/M |
| 3300026400|Ga0247573_1056424 | Not Available | 532 | Open in IMG/M |
| 3300026420|Ga0247581_1078305 | Not Available | 529 | Open in IMG/M |
| 3300026421|Ga0247569_1094278 | Not Available | 520 | Open in IMG/M |
| 3300026423|Ga0247580_1104708 | Not Available | 520 | Open in IMG/M |
| 3300026447|Ga0247607_1094517 | Not Available | 532 | Open in IMG/M |
| 3300026500|Ga0247592_1165197 | Not Available | 526 | Open in IMG/M |
| 3300026503|Ga0247605_1156466 | Not Available | 547 | Open in IMG/M |
| 3300026504|Ga0247587_1152090 | Not Available | 568 | Open in IMG/M |
| 3300026504|Ga0247587_1182244 | Not Available | 513 | Open in IMG/M |
| 3300027687|Ga0209710_1004505 | All Organisms → cellular organisms → Bacteria | 8994 | Open in IMG/M |
| 3300027687|Ga0209710_1017924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade → Methylophilales bacterium HTCC2181 | 3781 | Open in IMG/M |
| 3300027687|Ga0209710_1076675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1396 | Open in IMG/M |
| 3300027704|Ga0209816_1026579 | All Organisms → cellular organisms → Bacteria | 2941 | Open in IMG/M |
| 3300027752|Ga0209192_10007745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6215 | Open in IMG/M |
| 3300027752|Ga0209192_10115414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1094 | Open in IMG/M |
| 3300027779|Ga0209709_10001531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade → Methylophilales bacterium HTCC2181 | 21213 | Open in IMG/M |
| 3300027788|Ga0209711_10319515 | Not Available | 664 | Open in IMG/M |
| 3300027791|Ga0209830_10128586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter duraquae | 1232 | Open in IMG/M |
| 3300027801|Ga0209091_10007799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 7831 | Open in IMG/M |
| 3300027801|Ga0209091_10131705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade → Methylophilales bacterium HTCC2181 | 1309 | Open in IMG/M |
| 3300027801|Ga0209091_10235057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 897 | Open in IMG/M |
| 3300028008|Ga0228674_1120457 | Not Available | 898 | Open in IMG/M |
| 3300028102|Ga0247586_1099172 | Not Available | 546 | Open in IMG/M |
| 3300028189|Ga0257127_1157608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 620 | Open in IMG/M |
| 3300028194|Ga0257106_1221044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 643 | Open in IMG/M |
| 3300028290|Ga0247572_1183933 | Not Available | 525 | Open in IMG/M |
| 3300028336|Ga0247583_1089055 | Not Available | 670 | Open in IMG/M |
| 3300028338|Ga0247567_1138717 | Not Available | 509 | Open in IMG/M |
| 3300028391|Ga0233394_1014662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 2224 | Open in IMG/M |
| 3300028416|Ga0228614_1058076 | Not Available | 801 | Open in IMG/M |
| 3300031510|Ga0308010_1065423 | Not Available | 1460 | Open in IMG/M |
| 3300031519|Ga0307488_10190539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1399 | Open in IMG/M |
| 3300031569|Ga0307489_10558085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 786 | Open in IMG/M |
| 3300031579|Ga0308134_1085599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
| 3300031588|Ga0302137_1063691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 1485 | Open in IMG/M |
| 3300031596|Ga0302134_10232878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300031599|Ga0308007_10294083 | Not Available | 541 | Open in IMG/M |
| 3300031638|Ga0302125_10013333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3022 | Open in IMG/M |
| 3300031659|Ga0307986_10443941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 509 | Open in IMG/M |
| 3300031702|Ga0307998_1025405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → unclassified Nitrosomonadales → OM43 clade → Methylophilales bacterium HTCC2181 | 2495 | Open in IMG/M |
| 3300031766|Ga0315322_10446416 | Not Available | 856 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 20.00% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 13.12% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.00% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 8.12% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 7.50% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 6.25% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 5.00% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 4.38% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.12% |
| Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 3.12% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.75% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.50% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.50% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.50% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.88% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.25% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.25% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.62% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.62% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.62% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.62% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.62% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000167 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 120m | Environmental | Open in IMG/M |
| 3300000237 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 150m | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001348 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 | Environmental | Open in IMG/M |
| 3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
| 3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
| 3300003494 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_150m_DNA | Environmental | Open in IMG/M |
| 3300003495 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_150m_DNA | Environmental | Open in IMG/M |
| 3300003593 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_100m_DNA | Environmental | Open in IMG/M |
| 3300004274 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_120m | Environmental | Open in IMG/M |
| 3300004276 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_165m | Environmental | Open in IMG/M |
| 3300004278 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_150m | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006621 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ07 time point | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300008253 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300008961 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 | Environmental | Open in IMG/M |
| 3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009132 | Combined Assembly of Gp0139359, Gp0139510 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012414 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012417 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012418 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012419 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016733 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011501AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016737 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020335 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035) | Environmental | Open in IMG/M |
| 3300020376 | Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
| 3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
| 3300022933 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MG | Environmental | Open in IMG/M |
| 3300023685 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023702 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 82R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024229 | Seawater microbial communities from Monterey Bay, California, United States - 54D | Environmental | Open in IMG/M |
| 3300024248 | Seawater microbial communities from Monterey Bay, California, United States - 48D_r | Environmental | Open in IMG/M |
| 3300024252 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_135_MG | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024261 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024292 | Seawater microbial communities from Monterey Bay, California, United States - 37D | Environmental | Open in IMG/M |
| 3300024327 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_120_MG | Environmental | Open in IMG/M |
| 3300024339 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_100_MG | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300025690 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes) | Environmental | Open in IMG/M |
| 3300025770 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300026400 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 26R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026420 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026421 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 20R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026423 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 39R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026447 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026500 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026504 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028102 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028189 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_135m | Environmental | Open in IMG/M |
| 3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
| 3300028290 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028336 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 42R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028338 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 15R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028391 | Seawater microbial communities from Monterey Bay, California, United States - 24D | Environmental | Open in IMG/M |
| 3300028416 | Seawater microbial communities from Monterey Bay, California, United States - 15D | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031579 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031588 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_SCM | Environmental | Open in IMG/M |
| 3300031596 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCM | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300031638 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_surface | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300031702 | Marine microbial communities from David Island wharf, Antarctic Ocean - #37 | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100200045 | 3300000101 | Marine | MVGKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFSKYLFF* |
| DelMOSum2010_101707672 | 3300000101 | Marine | MVNKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFAKYLFF* |
| SI39nov09_120mDRAFT_10765982 | 3300000167 | Marine | MDVKNKKEECPAHKCKPFMLMSYLAAVFLILGICAFAKYLFF* |
| SI34jun09_150mDRAFT_10207782 | 3300000237 | Marine | MVMVSKSKSKREECPAHRCKPMMLMSYLAAVFLVLGICALVKYYSFNLVKFLH |
| JGI20151J14362_100527421 | 3300001346 | Pelagic Marine | KNEKEECPAHKCKPFMLMSYVAAVFLILGICAFAKYLFF* |
| JGI20151J14362_101534381 | 3300001346 | Pelagic Marine | MVGKNEKEECPAHKCKPFMLMSYLAAXFLILGIGAFAKYLFF* |
| JGI20151J14362_101659271 | 3300001346 | Pelagic Marine | MVGKNEKEECPAHKCKPFMLMSYLAAVFLILGISAFAKYLFF* |
| JGI20154J14316_100916943 | 3300001348 | Pelagic Marine | MVSKSEKEECPAHKCKPFMLMSYLAAVFLILGICAFAKYLFF* |
| JGI20154J14316_101023663 | 3300001348 | Pelagic Marine | MVGKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFFKYLFF* |
| JGI20157J14317_100063137 | 3300001352 | Pelagic Marine | MVKKNEKEECPAHKCKPFMLMSYLAAIFLVLGICAFTKYLFF* |
| JGI20158J14315_100321215 | 3300001355 | Pelagic Marine | NEKEECPAHKCKPFMLMSYVAAVFLILGICAFSKYLFF* |
| JGI20158J14315_100777914 | 3300001355 | Pelagic Marine | MVSKNEKEECPAHKCKPFMLMSYXAAIFLILGIGAFAKYLFF* |
| JGI24005J15628_100046334 | 3300001589 | Marine | MVGKNEKEECPAHKCKPVMLMSYLAAVFLVLGICAFAKYLFF* |
| JGI24005J15628_100091073 | 3300001589 | Marine | MVGKNEKEECPAHKCKPLMLMSYLGAVFLVLGICAFAKYIFF* |
| GOS2218_10239003 | 3300001947 | Marine | MVGKSEKEECPAHKCKPLMLMSYLAAVFLVLGICAFAKFLFF* |
| JGI26238J51125_10595692 | 3300003478 | Marine | MVGKNEKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF* |
| JGI26238J51125_10959662 | 3300003478 | Marine | MDVKNKKEECPAHKCKPFMLMSYLAAVFLTLGICAFAKYLFF* |
| JGI26240J51127_100025710 | 3300003494 | Marine | MVMVSKSKSKREECPAHRCKPMMLMSYLAAVFLVLGICALVKYLFF* |
| JGI26244J51143_100018729 | 3300003495 | Marine | SKSKREECPAHRCKPMMLMSYLAAVFLVLGICALVKYLFF* |
| JGI26259J51720_10099193 | 3300003593 | Marine | MVMVSKSKSKREECPAHRCKPMMLMSYLAAVFLVLGICALVK |
| Ga0066607_10095771 | 3300004274 | Marine | MVMVSKSKREECPAHRCKPMMLMSYLAAVFLVLGICALVKYIFF* |
| Ga0066610_100561584 | 3300004276 | Marine | RITMDVKNKKEECPAHKCKPFMLMSYLAAVFLTLGICAFAKYLFF* |
| Ga0066609_100974662 | 3300004278 | Marine | MVKKSEKEECPAHKCKPFMLMSYLAAIFLVLAFARLQNIFFSKI |
| Ga0066605_100287343 | 3300004279 | Marine | MVKKSEKEECPAHKCKPFMLMSYLAAIFLVLGICAFTKYLFF* |
| Ga0073579_10183364 | 3300005239 | Marine | MLTNKTEEECPAHKCKPFMALCYLAALFLILGIVSFVKYLFN* |
| Ga0073579_11733162 | 3300005239 | Marine | MEKNNQKEDCPAHKCKPFMILSYLAALFLVLGIAAFIKYLFI* |
| Ga0073579_119034512 | 3300005239 | Marine | MVGKNEKEECPAHKCKPLMLMSYLAAVFLVLGICAFAKYLFF* |
| Ga0075441_100013647 | 3300006164 | Marine | MTSKDEKEECPAHKCKPFMLMSYVAAIFLVLGICAFAKYLFF* |
| Ga0075441_100091896 | 3300006164 | Marine | MVSKSEKDECPAHKCKPFMFMSYLAALFLLLGIGAFAKYLFF* |
| Ga0075443_101642362 | 3300006165 | Marine | MLGKNEKEECPAHKCKPFMLMSYVAAVFLVLGICAFAKYLFF* |
| Ga0075446_100022265 | 3300006190 | Marine | MATSNQKEECPAHKCKPFMALCYVSVIFFILGIASFIKYLFN* |
| Ga0075446_100179174 | 3300006190 | Marine | MTIDKKEEECQAHKCKPFMALCYLAALFLILGIASFVRYLFN* |
| Ga0101441_10333136 | 3300006621 | Marine Surface Water | MVSKNEKEECPAHKCKPFMLMSYLAAVFLVLGICAFSRYLFF* |
| Ga0075444_100152715 | 3300006947 | Marine | MVSKSEKDECPAHKCKPFMFMSYLAALFLLLGIGAFAKYHFF* |
| Ga0075444_100971462 | 3300006947 | Marine | MATNNEQEECPAHKCKPLMALSYLAAFFLILGVASFVKYLFN* |
| Ga0105744_11521262 | 3300007863 | Estuary Water | MVGKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFAKYLFF* |
| Ga0105349_100702244 | 3300008253 | Methane Seep Mesocosm | MVSKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFAKYLFF* |
| Ga0102891_12338561 | 3300008950 | Estuarine | MVGKNEKEECPAHKCKPFMLMSYVAAVFLILGISAFAKYLFF* |
| Ga0102887_10430291 | 3300008961 | Estuarine | MVGKNEKEECPAHKCKPFMLLSYLAAIFLILGIGAFAKYLFF* |
| Ga0102889_10836791 | 3300008964 | Estuarine | KNEKEECPAHKCKPFMLMSYLAAVFLILGICAFAKYLFF* |
| Ga0115566_102621411 | 3300009071 | Pelagic Marine | MVGKNEKEECPAHKCKPFMLMSYLAAIFMILGIGAFAKYLFF* |
| Ga0115566_105658461 | 3300009071 | Pelagic Marine | IDMVGKNEKEECPAHKCKPFMLMSYLAVVFLILGISAFAKYLFF* |
| Ga0115566_105987401 | 3300009071 | Pelagic Marine | MVGKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFSK |
| Ga0115550_10369724 | 3300009076 | Pelagic Marine | MVGKNEKEDCPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF* |
| Ga0102814_102642431 | 3300009079 | Estuarine | MVGKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFTKYLFF |
| Ga0102812_102655991 | 3300009086 | Estuarine | MVNKNEKEECPAHKCKPFMLMSYMAAIFLILGIGAFAKYLFF* |
| Ga0118730_10507555 | 3300009132 | Marine | MVSKNEKEECPAHKCKPFMLMSYLAAAFLVLGICAFSKYLFF* |
| Ga0114995_100060574 | 3300009172 | Marine | MATNKEKEECPAHKCKPFMVLSYIGALFLILGISSFIKYLLN* |
| Ga0114995_100088742 | 3300009172 | Marine | MAKNNQIEECPAHKCKPFMILSYILALFLILGIASFIKYLLIL* |
| Ga0114995_102360282 | 3300009172 | Marine | MVSKNEKEECPAHKCKPFMLMSYIAAIFLVLGICAFAKYLFF* |
| Ga0114995_103512312 | 3300009172 | Marine | MTKKKKEEEECPAHKCKPFMALCYLASLFLILGIVSFVKYLFN* |
| Ga0114995_106569612 | 3300009172 | Marine | MVGKNEKEECPAHKCKPLMLMSYIGAVFLVLGICAFAKYLFF* |
| Ga0115551_10331083 | 3300009193 | Pelagic Marine | MSECKAHECKPLMILSCLAAIFLVLGIISFVKYLFF* |
| Ga0115551_12742352 | 3300009193 | Pelagic Marine | MVGKNEKEECPAHKCKPFMLMSYLAAVFLILGIGAFAKYLFF* |
| Ga0115551_13735821 | 3300009193 | Pelagic Marine | MVAKNEKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF* |
| Ga0114994_108909141 | 3300009420 | Marine | MVSKNEKEECPAHKCKPFMLMSYIAAVFLVLGICAFAKYLFF* |
| Ga0114997_100089574 | 3300009425 | Marine | MATNNEKEECPARKCKPFMILSYIAALFLILGIASFIKYLLN* |
| Ga0114997_100358735 | 3300009425 | Marine | MATNNEKKECPAHKCKPFMALCYMAAFFLILGIASFVKYLYN* |
| Ga0114997_104608091 | 3300009425 | Marine | MAMNNQKEECPAHKCKPFMILSYILALFLILGIASFIKYLLI |
| Ga0115556_12051691 | 3300009437 | Pelagic Marine | MVTKNEKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF* |
| Ga0115561_13203302 | 3300009440 | Pelagic Marine | VGKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFFKYLFF* |
| Ga0115568_103599721 | 3300009498 | Pelagic Marine | NEKEECPAHKCKPFMLMSYVAAVFLILGICAFAKYLFF* |
| Ga0115004_103247743 | 3300009526 | Marine | MVSKNEKEECPAHKCKTFMLMSYIGAVFLVLGICAFAKYLF |
| Ga0115103_17755482 | 3300009599 | Marine | VSKNEKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF* |
| Ga0115000_100827093 | 3300009705 | Marine | MAKNNQKEECPAHKCKPFMILSYILALFLILGIASFIKYLLIL |
| Ga0115001_106798241 | 3300009785 | Marine | ECPAHKCKPLMLMSYLAAVFLVLGICAFAKYLFF* |
| Ga0133547_102155151 | 3300010883 | Marine | MAKNNQIEECPAHKCKPFMILSYILALFLILGIAS |
| Ga0138264_16356481 | 3300012414 | Polar Marine | ISMAKNNQKEECPAHKCKPFMILSYILALFLILGIASFIKYLLIL* |
| Ga0138262_16683181 | 3300012417 | Polar Marine | IYMVSKDEKEECPAHKCKPFMLMSYIGAVFLVLGIGAFAKYLFF* |
| Ga0138262_18399181 | 3300012417 | Polar Marine | LMKTNNKEDECPAHKCKPFMALCYVSALFLILGIASFIKYLFN* |
| Ga0138261_12840183 | 3300012418 | Polar Marine | VSKDEKEECPAHKCKPFMLMSYIGAVFLVLGIGAFAKYLFF* |
| Ga0138260_101738242 | 3300012419 | Polar Marine | MVSKDEKEECPAHKCKPFMLMSYIGAVFLVLGIGAFAKYLFF* |
| Ga0182042_14032432 | 3300016733 | Salt Marsh | EMVSKNEKEECPAHKCKPFMLMSYLAAVFLVLGICAFSKYLFF |
| Ga0182047_11866301 | 3300016737 | Salt Marsh | IFMSECKAHECKPLMILSCLAAIFLVLGIISFVKYLFF |
| Ga0181396_10113492 | 3300017729 | Seawater | MVGKDKKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF |
| Ga0181431_10357863 | 3300017735 | Seawater | MVGKNEKEECPAHKCKPFMLMSYVAAVFLILGISAFAKYLFF |
| Ga0181394_12723101 | 3300017776 | Seawater | MVGKNEKEECPAHKCKPFMLMSYLAAVFLILGICAFAKYLFF |
| Ga0206125_100105395 | 3300020165 | Seawater | MVGKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFSKYLFF |
| Ga0206125_100154934 | 3300020165 | Seawater | MVGKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFAKYLFF |
| Ga0206125_100794992 | 3300020165 | Seawater | MVGKNEKEDCPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF |
| Ga0206127_10451831 | 3300020169 | Seawater | MVKKSEKEECPAHKCKPFMLMSYLAAIFLVLGICAFTKYLFF |
| Ga0181602_100097264 | 3300020173 | Salt Marsh | MSECKAHECKPLMILSCLAAIFLVLGIISFVKYLFF |
| Ga0206131_103719361 | 3300020185 | Seawater | NEKEDCPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF |
| Ga0211690_10709002 | 3300020335 | Marine | MVGKNEKEECPAHKCKPFMLMSYIAAVFLVLGICAFAKYLFF |
| Ga0211682_102713381 | 3300020376 | Marine | MATNNEKEECPAHKCKPFMALCYMAAFFLILGIASFVKYLYN |
| Ga0211682_102942172 | 3300020376 | Marine | ISMKKNNPKEECPAHKCKPFMILSYISALFLILGIAAFIKYLIN |
| Ga0206126_103731251 | 3300020595 | Seawater | MVGKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFSKYLF |
| Ga0181598_101150711 | 3300020810 | Salt Marsh | MVSKNEKEECPAHKCKPFMLMSYLAAIFLVLGICTFSKYL |
| Ga0206677_101130042 | 3300021085 | Seawater | MVTKNEKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF |
| Ga0206683_105508502 | 3300021087 | Seawater | MVSKNEKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF |
| Ga0206682_103176682 | 3300021185 | Seawater | MVTKNEKEECPAHKCKPFMLMSYLAAIFLILGIGA |
| Ga0206123_102933432 | 3300021365 | Seawater | MVAKNEKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF |
| Ga0222716_106629892 | 3300021959 | Estuarine Water | MVGKNEKEECPAHKCKPFMLMSYLAAVFLILGISAFAKYLFF |
| (restricted) Ga0233426_102005722 | 3300022920 | Seawater | MVGKNENEECPAHKCKPLMLMSYLAAVFLVLGICAFAKYLFF |
| Ga0255765_10640731 | 3300022921 | Salt Marsh | MVSKNEKEECPAHKCKPFMLMSYLAAVFLVLGICAFSKYL |
| Ga0255765_13041921 | 3300022921 | Salt Marsh | LKGWNEMVSKNEKEECPAHKCKPFMLMSYLAAVFLVLGICAFSKYLFF |
| (restricted) Ga0233427_101102061 | 3300022933 | Seawater | NEKEECPAHKCKPFMLMSYVAAVFLILGICAFAKYLFF |
| Ga0228686_10638841 | 3300023685 | Seawater | IDMVGKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFAKYLFL |
| Ga0232119_10752651 | 3300023702 | Seawater | KKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF |
| Ga0233402_10901911 | 3300024229 | Seawater | MVSKNKKEECPAHKCKPFMLMSYLAAVFLILGISAFAKY |
| Ga0228676_10425041 | 3300024248 | Seawater | MVTKNEKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLF |
| (restricted) Ga0233435_10378513 | 3300024252 | Seawater | MVGKNEKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF |
| (restricted) Ga0233438_101468752 | 3300024255 | Seawater | MVSKNEKEECPAHKCKPFMLMSYMAAIFLILGIGAFAKYLFF |
| (restricted) Ga0233439_103228341 | 3300024261 | Seawater | MVSKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFAKYLF |
| (restricted) Ga0233444_100474732 | 3300024264 | Seawater | MVNKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFAKYLFF |
| Ga0228630_10442462 | 3300024292 | Seawater | MVGKNEKEECPAHKCKPFMLMSYIAAVFLILGICAFSKYLFF |
| (restricted) Ga0233434_100958910 | 3300024327 | Seawater | MVSKSKSKREECPAHRCKPMMLMSYLAAVFLVLGICALVKYLFF |
| (restricted) Ga0233445_12319112 | 3300024339 | Seawater | MVGKNEKEECPAHKCKPFMLMSYLAAIFLILGIGAFA |
| Ga0209634_100151811 | 3300025138 | Marine | MVGKNEKEECPAHKCKPVMLMSYLAAVFLVLGICAFAKYLFF |
| Ga0209634_100900810 | 3300025138 | Marine | MVGKNEKEECPAHKCKPLMLMSYLGAVFLVLGICAFAKYIFF |
| Ga0209833_10484221 | 3300025641 | Pelagic Marine | VMVKKSEKEECPAHKCKPFMLMSYLAAIFLVLGICAFTKYLFF |
| Ga0209306_10553003 | 3300025680 | Pelagic Marine | MVGKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFAKYL |
| Ga0209505_10897901 | 3300025690 | Pelagic Marine | MVGKNEKEECPAHKCKPFMLMSYVAAVFLILGICAF |
| Ga0209362_12577831 | 3300025770 | Marine | MNTDKQEEECPAHKCKPFMALSYIAAIFLILGIASFTKYLLN |
| Ga0209666_10957991 | 3300025870 | Marine | MVKKNEKEECPAHKCKPFMLMSYLAAIFLVLGICAF |
| Ga0209533_13807851 | 3300025874 | Pelagic Marine | INMVGKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFSKYLFF |
| Ga0209632_101221972 | 3300025886 | Pelagic Marine | MASKNEKEECPAHKCKPFMLMSYLAAIFLVLGIGALTKYLFF |
| Ga0209632_103043911 | 3300025886 | Pelagic Marine | MVGKNEKEECPAHKCKPFMLMSYLAAVFLILGIGAFAKYLFF |
| Ga0209335_102642343 | 3300025894 | Pelagic Marine | KNEKEECPAHKCKPFMLMSYVAAVFLILGICAFSKYLFF |
| Ga0247573_10564241 | 3300026400 | Seawater | NMVSKNEKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF |
| Ga0247581_10783051 | 3300026420 | Seawater | MVGKNEKEECPAHKCKPFMLMSYLASVFLILGIGAFAKYLFF |
| Ga0247569_10942781 | 3300026421 | Seawater | KNEKEECPAHKCKPFMLMSYLAAVFLILGIGAFAKYLFF |
| Ga0247580_11047081 | 3300026423 | Seawater | KNEKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF |
| Ga0247607_10945172 | 3300026447 | Seawater | MVGKNEKEECPAHKCKPFMLMSYLAAVFLILGICAFSKYLFF |
| Ga0247592_11651972 | 3300026500 | Seawater | KNEKEECPAHKCKPFMLMSYVAAVFLILGISAFAKYLFF |
| Ga0247605_11564661 | 3300026503 | Seawater | MVGKNKKEECPAHKCKPFMLMSYVAAVFLILGICAFAKYLFF |
| Ga0247587_11520902 | 3300026504 | Seawater | MVSKNEKEECPAHKCKPFMLMSYVAAVFLILGISAFAKYLFF |
| Ga0247587_11822441 | 3300026504 | Seawater | VSKNEKEDCPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF |
| Ga0209710_10045054 | 3300027687 | Marine | MATNKEKEECPAHKCKPFMVLSYIGALFLILGISSFIKYLLN |
| Ga0209710_10179244 | 3300027687 | Marine | MAMNNQKEECPAHKCKPFMILSYILALFLILGIASFIKYLLIL |
| Ga0209710_10766751 | 3300027687 | Marine | MVGKNEKEECPAHKCKPLMLMSYLAAVFLVLGICAFAKYLFF |
| Ga0209816_10265793 | 3300027704 | Marine | MATNNEQEECPAHKCKPLMALSYLAAFFLILGVASFVKYLFN |
| Ga0209192_1000774511 | 3300027752 | Marine | MAKNNQIEECPAHKCKPFMILSYILALFLILGIASFIKYLLIL |
| Ga0209192_101154141 | 3300027752 | Marine | MTTNNQKEECPAHKCKPFMILSYILALFLILGIASFIK |
| Ga0209709_1000153120 | 3300027779 | Marine | MATNNEKEECPARKCKPFMILSYIAALFLILGIASFIKYLLN |
| Ga0209711_103195152 | 3300027788 | Marine | MAKNNQIEECPAHKCKPFMILSYILALFLILGIASFIKYL |
| Ga0209830_101285863 | 3300027791 | Marine | MTTNNQKEECPAHKCKPFMILSYILALFLILGIASFIKYLLIL |
| Ga0209091_100077994 | 3300027801 | Marine | MVSKNEKEECPAHKCKPFMLMSYTAAVFLVLGICAFAKYLFF |
| Ga0209091_101317051 | 3300027801 | Marine | IKNNQKEECPAHKCKPFMILCYILALYLILGIVSFIKYLFA |
| Ga0209091_102350571 | 3300027801 | Marine | MAMNNQKEECPAHKCKPFMILSYILALFLILGIAS |
| Ga0228674_11204572 | 3300028008 | Seawater | MVTKNKKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF |
| Ga0247586_10991722 | 3300028102 | Seawater | NMVTKNEKEECPAHKCKPFMLMSYLAAIFLILGIGAFGKYLFF |
| Ga0257127_11576081 | 3300028189 | Marine | MDVKNKKEECPAHKCKPFMLMSYLAAVFLILGICAFAKYLFF |
| Ga0257106_12210442 | 3300028194 | Marine | MATNKEKEECPAHKCKPFMVLSYVGALFLILGISSFIKYLFN |
| Ga0247572_11839331 | 3300028290 | Seawater | KMVTKNKKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF |
| Ga0247583_10890552 | 3300028336 | Seawater | MVGKNENEKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF |
| Ga0247567_11387172 | 3300028338 | Seawater | IDMVNKNEKEECPAHKCKPFMLMSYLAAVFLILGITAFAKYLFF |
| Ga0233394_10146623 | 3300028391 | Seawater | MVSKNEKEECPAHKCKPFMLMSYIAAVFLILGISAFAKYLFF |
| Ga0228614_10580762 | 3300028416 | Seawater | MITKNEKEECPAHKCKPFMLMSYLAAIFLILGIGAFAKYLFF |
| Ga0308010_10654232 | 3300031510 | Marine | MKTNNKEDECPAHKCKPFMALCYVSALFLILGIASFI |
| Ga0307488_101905393 | 3300031519 | Sackhole Brine | MVGKNEKEECPAHKCKPFMLMSYAASVFLVLGISAFTKYLFF |
| Ga0307489_105580851 | 3300031569 | Sackhole Brine | GKNEKEECPAHKCKPLMLMSYLAAVFLVLGICAFAKYLFF |
| Ga0308134_10855993 | 3300031579 | Marine | SMAMNNQKEECPAHKCKPFMILSYILALFLILGIASFIKYLLIL |
| Ga0302137_10636912 | 3300031588 | Marine | MVSKNEKEECPAHKCKPLMLMSYLAAVFLVLGICAFAKYLFF |
| Ga0302134_102328782 | 3300031596 | Marine | MVGKNEKEECPAHKCKPLMLMSYLAAVFLVLGICA |
| Ga0308007_102940831 | 3300031599 | Marine | MGKNNEKQECPAHKCKPFMLLSYTAAIFLILGIISFIK |
| Ga0302125_100133334 | 3300031638 | Marine | MAKNNQIEECPAHKCKPFMILSYILALFLILGIASFIKYLL |
| Ga0307986_104439411 | 3300031659 | Marine | MATNNQKEECPAHKCKPFMALSYVAAIFLILGIAAFIKYLFN |
| Ga0307998_10254051 | 3300031702 | Marine | MITNKEKECPAYKCKPFMTLSYVAAIFLILGIVAFIKYLL |
| Ga0315322_104464162 | 3300031766 | Seawater | MVSKNEKEECPAHKCKPFMLMSYVAAVFLILGICAFAKYLFF |
| ⦗Top⦘ |