


| Basic Information | |
|---|---|
| Family ID | F041441 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNEQTELLLDYQEMAILALREEVERLTLENKLLTLKLKKNEYI |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.75 % |
| % of genes near scaffold ends (potentially truncated) | 13.12 % |
| % of genes from short scaffolds (< 2000 bps) | 81.25 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.750 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine (16.250 % of family members) |
| Environment Ontology (ENVO) | Unclassified (87.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (98.125 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.34% β-sheet: 0.00% Coil/Unstructured: 43.66% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF04466 | Terminase_3 | 18.12 |
| PF08299 | Bac_DnaA_C | 5.62 |
| PF00149 | Metallophos | 1.88 |
| PF13148 | DUF3987 | 1.88 |
| PF08774 | VRR_NUC | 1.25 |
| PF10571 | UPF0547 | 1.25 |
| PF03796 | DnaB_C | 0.62 |
| PF08279 | HTH_11 | 0.62 |
| PF10544 | T5orf172 | 0.62 |
| PF01555 | N6_N4_Mtase | 0.62 |
| PF01507 | PAPS_reduct | 0.62 |
| PF13392 | HNH_3 | 0.62 |
| PF02086 | MethyltransfD12 | 0.62 |
| PF00303 | Thymidylat_synt | 0.62 |
| PF01637 | ATPase_2 | 0.62 |
| PF10145 | PhageMin_Tail | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 18.12 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 5.62 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.62 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.62 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.62 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.62 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.62 |
| COG1373 | Predicted ATPase, AAA+ superfamily | General function prediction only [R] | 0.62 |
| COG1672 | Predicted ATPase, archaeal AAA+ ATPase superfamily | General function prediction only [R] | 0.62 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.62 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.75 % |
| All Organisms | root | All Organisms | 41.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 16.25% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 15.62% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 13.12% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.25% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 10.62% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 7.50% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 5.62% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 4.38% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.12% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.50% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.50% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.88% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.25% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.25% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.25% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.25% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025696 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025860 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300028418 | Seawater microbial communities from Monterey Bay, California, United States - 16D | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100030834 | 3300000115 | Marine | MNTQTELLLDYQEMAIISLREEVERLTLENKLLTLKLKKNEYI* |
| DelMOSum2011_100305941 | 3300000115 | Marine | MDTKTELLLDYQEMAILALREEVNRLTLENQLLTLKLKKNDFI* |
| DelMOSum2011_100694083 | 3300000115 | Marine | MNEQTRLLLDYQEQAILALRAEVERLTTENELLTLKLKRNEFI* |
| DelMOSum2011_100785115 | 3300000115 | Marine | MNEQTRLLLDYQEQAIIALRAEVERLXTENELLTLKLKRNERI* |
| DelMOSum2011_100847173 | 3300000115 | Marine | MNEQTRLLLDYQEQAILALRAEVDRLRTENELLTLKLKRNEYI* |
| DelMOSum2011_100972515 | 3300000115 | Marine | MSEQTRLLLDYQEQAIIALRAEVERLTTENELLTLKLKRNEYI* |
| DelMOSum2011_101035701 | 3300000115 | Marine | MNEQTRLLLDYQEQAIIALRAEIERLTTENELLTLKLKRNEYI* |
| DelMOSum2011_101290932 | 3300000115 | Marine | MDTKTELLLDYQEMAILALREEVERLTKENELLTLKLKRDDFI* |
| DelMOSum2011_101571852 | 3300000115 | Marine | MNEQTRLLLDYQEQAIIALRAEVERLTTENKLLTLKLKRNEYI* |
| DelMOSum2011_101813242 | 3300000115 | Marine | MNEQTRLLLDYQEQAIIALRAEVERLTTENKLLTLKLKRNERI* |
| DelMOSum2011_101884623 | 3300000115 | Marine | MDTKTELLLDYQEMAILALREEVNRLTKENELLTYRLTGNDLQFIQNKEL* |
| DelMOSum2011_101936503 | 3300000115 | Marine | MEHQTPTLNYNTMSEQTRLLLDYQEQAILALRAEVERLTTENELLTLKLKRNEYI* |
| DelMOSum2011_102053421 | 3300000115 | Marine | MNEQTRLLLDYQEQAIIALRAEVERLTLENNLLTLKLKRNEFI* |
| DelMOSum2011_102068712 | 3300000115 | Marine | MNEQTRLLLDYQEQAIIALRAEVERLTTENKLLTLKLKRNEHI* |
| DelMOSum2011_102160973 | 3300000115 | Marine | MNEQTRLLLDYQEQAIIALRAEIDRLTTENELLTLK |
| DelMOSpr2010_100590453 | 3300000116 | Marine | MNEQTRLLLDYQEQAILALRAEVDRLTTENELLTLKLKRNEYI* |
| DelMOSpr2010_100663685 | 3300000116 | Marine | MNEQTRLLLDYQEQAIIALRAEVDRLRTENELLTLKLKRNEYI* |
| DelMOSpr2010_100882643 | 3300000116 | Marine | MNEQTRLLLDYQEQAIIALRAEVERLETENELLTLKLKRNERI* |
| DelMOSpr2010_101174153 | 3300000116 | Marine | MTEQTRLLLDYQEQAIIAXRAEVERLXTENELLTLKLKXNEYI* |
| DelMOSpr2010_101598192 | 3300000116 | Marine | MEHQTPTLNYNTMNEQTRLLLDYQEQAIISLRAEVDRLRTENELLTLKLKKNEFI* |
| DelMOSpr2010_101600872 | 3300000116 | Marine | MNEQTRLLLDYQEQAIIALRAEVERLETENELLTLKLKRNEFI* |
| BBAY92_122608252 | 3300000947 | Macroalgal Surface | MNTRTELLLDYQEMAILALREEVAKLTKENELLTLKLKNNE* |
| BBAY94_100177193 | 3300000949 | Macroalgal Surface | MNELLTDYQEAAIIALRAEVERLTLENRLLTLKLQKNELDK* |
| JGI20152J14361_100132436 | 3300001344 | Pelagic Marine | MNTKTELLLDYQEMAIVALREEVERLTTENQLLTLKLKANEYI* |
| Ga0065861_10694894 | 3300004448 | Marine | MDTKTELLLDYQEMAILALREEVERLTLENKLLTLKLKKNDFI* |
| Ga0065861_11387853 | 3300004448 | Marine | MTEQTELLLDYQEMAILALREEVNRLTLENQLLTLKLKANDFI* |
| Ga0065861_11486652 | 3300004448 | Marine | MNEQTELLLDYQEMAILALREEVNRLTLENKLLTLKLKANEFI* |
| Ga0066224_10824418 | 3300004457 | Marine | MDTKTELLLDYQEMAILALREEVNRLTLENQLLTLKLKANDFI* |
| Ga0066222_10911843 | 3300004460 | Marine | MNEQTELLLDYQEMAILALREEVERLTLENKLLTLKLKKNDFI* |
| Ga0066222_11838771 | 3300004460 | Marine | QTELLLDYQEMAILALREEVNRLTLENQLLTLKLKANDFI* |
| Ga0066222_12312572 | 3300004460 | Marine | MNEQTELLLDYQEMAILALREEVNRLTLENQLLTLKLKANEFI* |
| Ga0075466_10124973 | 3300006029 | Aqueous | MNEQTRLLLDYQEQAIIALRAEVERLKTENELLTLKLKRNEYI* |
| Ga0075466_10460702 | 3300006029 | Aqueous | MNEQTRLLLDYQEQAIIALRAEVERLTTENELLTLKLKRNEFI* |
| Ga0075443_100776784 | 3300006165 | Marine | MNTQNELLLDYQEMAILALREEVERLTIENKLLTLKLQRND* |
| Ga0070744_100642493 | 3300006484 | Estuarine | MDTKTELLLDYQEIAILALREEVERLTLENKLLTLKLKRNELL* |
| Ga0070744_101940652 | 3300006484 | Estuarine | MDTKTELLLDYQEMAISALREEVERLTLENQLLTLKLKKNEFI* |
| Ga0075467_100860693 | 3300006803 | Aqueous | MDTKTELLLDYQEAAIVALRKEVERLTLENKLLTLKLKKNDFI* |
| Ga0070748_10394724 | 3300006920 | Aqueous | MNEQTRLLLDYQEQAIISLRTEVDRLRTENELLTLKLKRNERI* |
| Ga0070748_10477473 | 3300006920 | Aqueous | MDTKTELLLDYQEMAILALREEVERLTLENKLLTLKLKKNEFV* |
| Ga0070748_10508153 | 3300006920 | Aqueous | MDTKTELLLDYQEAAIVALRKEVERLTLENKLLTLKLKRNEFV* |
| Ga0070748_12186212 | 3300006920 | Aqueous | LLKRNTMNEQTRLLLDYQEQAIIALRTEVERLKTENELLTLKLKRNEYI* |
| Ga0070747_10818691 | 3300007276 | Aqueous | NHYIMDTKTELLLDYQEAAIVALRKEVERLTLENKLLTLKLKKNDFI* |
| Ga0099847_10235983 | 3300007540 | Aqueous | MNTQTELLLDYQEMAILALREEVERLTTENELLTLKLKRNERI* |
| Ga0115549_12229082 | 3300009074 | Pelagic Marine | MDTKTELLLDYQEVAILALREEVERLTLENKLLTLKLKRNEFI* |
| Ga0114995_101879732 | 3300009172 | Marine | MDTKTELLLDYQEMAILALREEVNRLTLENQILTLKLKANDFI* |
| Ga0114993_103516263 | 3300009409 | Marine | MDTKTELLLDYQEMAILALREEVNRLALENQILTLKLKANDFI* |
| Ga0114994_101859203 | 3300009420 | Marine | MNEQTELLLDYQEMAILALREEVERLTLENKLLTLKLKSNDYI* |
| Ga0114994_102087303 | 3300009420 | Marine | MNTQTELLLDYQEMAILALREEVERLTLENKLLTLKLKRNEFV* |
| Ga0114994_106753491 | 3300009420 | Marine | TKTELLLDYQEMAILALREEVERLTLENRLLTLKLKSNDFI* |
| Ga0114994_108037962 | 3300009420 | Marine | MDTKTELLLDYQEMAILALREEVDRLTLENKLLTLKLKANEYI* |
| Ga0114998_101795733 | 3300009422 | Marine | MNTQTELLLDYQEMAILALREEVERLTLENKLLTLKLKKN |
| Ga0115548_11468991 | 3300009423 | Pelagic Marine | MDDKTKLLLDYQEMAILALREEVERLTLENKLLTLKLKRNEFI* |
| Ga0115548_11761082 | 3300009423 | Pelagic Marine | MDTKTELLLDYQEMAILALREEVERLTLENKLLTLKLKRNEFV* |
| Ga0115548_12915381 | 3300009423 | Pelagic Marine | MNKQTELLLDYQEAAIIALRAEVERLTLENKLLTLKLKKNEYI* |
| Ga0115547_10595982 | 3300009426 | Pelagic Marine | MNEQTKLLLDYQEMAIIALREEVERLTKENELLTLKLKKNETI* |
| Ga0115547_11560381 | 3300009426 | Pelagic Marine | MDTKTELLLDYQEMAILALREEVNRLTLENQLLTLKLKANEYI* |
| Ga0114915_10127833 | 3300009428 | Deep Ocean | MNKRTELLLDYQEMAILSLRKELERLTLENELLTIKLKLNEQDYHTTTT* |
| Ga0114915_10613255 | 3300009428 | Deep Ocean | MNTQTELLLDYQEMAIVALREEVERLTIENRLLTLK |
| Ga0114915_11158882 | 3300009428 | Deep Ocean | MNTQTELLLDYQEMAIVALREEVERLTMENRLLTLKLQKNEFI* |
| Ga0114915_11739781 | 3300009428 | Deep Ocean | MNTQTELLLDYQEVAIVALREEVERLTMENKLLTLKLQKND* |
| Ga0114915_12248382 | 3300009428 | Deep Ocean | MNTQTELLLDYQEMAIVALREEVERLTMENRLLTLKLQKN |
| Ga0114915_12278871 | 3300009428 | Deep Ocean | MNTQTELLLDYQEMAIVSLREEVERLTMENKLLTLKLQKNEFI* |
| Ga0115562_10595302 | 3300009434 | Pelagic Marine | MNTQTELLLDYQEMAILALRAEVERLTTENQLLTLKLKVNEFI* |
| Ga0115562_10972912 | 3300009434 | Pelagic Marine | MNEQTELLLDYQEAAIVALRAEVERLTLENKLLTLKLKKNEYI* |
| Ga0115562_11334963 | 3300009434 | Pelagic Marine | MNEQTELLLDYQEAAIEALRAEVERLTLENKLLTLKLKKNEFI* |
| Ga0115546_12619012 | 3300009435 | Pelagic Marine | MNTQTELLLDYQEMAIIALREEVERLTKENELLTYRLTGNDLQFIQNKEL* |
| Ga0115546_13044342 | 3300009435 | Pelagic Marine | MDTKTELLLDYQEMAILALREEVERLTLENKLLTLKLKRNEFI* |
| Ga0115008_101470003 | 3300009436 | Marine | MNTQTELLLDYQEMAILALREEVERLTLENKLLTLKLKRNEYV* |
| Ga0115561_10895553 | 3300009440 | Pelagic Marine | MNEQTELLLDYQEAAIEALRAEVERLTLENKLLTLKLKKNEYI* |
| Ga0115563_13721481 | 3300009442 | Pelagic Marine | MNEQTELLLDYLEMAILALREEVERLILENQLLTLKLKRNEFV* |
| Ga0115560_11415551 | 3300009447 | Pelagic Marine | MDTKTELLLDYQEMAILALREEVERLTLENKLLTLKLKRNEYI* |
| Ga0115565_100496642 | 3300009467 | Pelagic Marine | MNTQTELLLDYQDMAILALREEVERLTLENKLLTLKLKRNEYI* |
| Ga0115565_102817083 | 3300009467 | Pelagic Marine | MDDKTKLLLDYQEMAILALREEVERLTLENKLLTLKLKRN |
| Ga0115571_11522385 | 3300009495 | Pelagic Marine | MDTKTELLLDYQEMAILALREEVERLTLENQLLTLKLKANEYV* |
| Ga0115570_101394071 | 3300009496 | Pelagic Marine | KQTELLLDYQEMAILALRAEVERLTLENKLLTLKLKKNEYI* |
| Ga0115564_104643792 | 3300009505 | Pelagic Marine | MDDKTKLLLDYQEMAILALREEVERLTLENKLLTLKLKRNEFV* |
| Ga0115572_103103873 | 3300009507 | Pelagic Marine | MDEQTELLLDYQEAAILALREEVERLTKENELLTYRLTGNDLQFIQNKEL* |
| Ga0115004_106987362 | 3300009526 | Marine | MNTQTELLLDYQEMAILALREEVERLTLENKLLTLKLKKNDFI* |
| Ga0115103_10386471 | 3300009599 | Marine | MDDKTELLLDYQEMAILALRKEVERLTLENEILTLKLKANEHLQ* |
| Ga0114999_110095722 | 3300009786 | Marine | MNEQTELLLDYQEMAILALREEVERLTLENKLLTLKLKRNEFV* |
| Ga0151669_1532372 | 3300011128 | Marine | MDTKTELLLDYQEMAILALREEVERLTLENQLLTLKLKKNEFI* |
| Ga0151671_10237908 | 3300011253 | Marine | MDTKTELLLDYQEMAILALREEVERLTLENKLLTLKLKKNEFI* |
| Ga0129327_102878233 | 3300013010 | Freshwater To Marine Saline Gradient | MNTQTELLLDYQEMAILALREEVNRLTLENQLLTLKLKANDFI* |
| Ga0129327_104498132 | 3300013010 | Freshwater To Marine Saline Gradient | NEQTRLLLDYQEQAIIALRAEVERLTTENELLTLKLKRNERI* |
| Ga0180120_103206171 | 3300017697 | Freshwater To Marine Saline Gradient | MDTKTELLLDYQEMAILALREEVERLTTENKLLTYRLTGNDLQFIQNKEL |
| Ga0180120_103584072 | 3300017697 | Freshwater To Marine Saline Gradient | MNEQTELLLDYQEMAILALREEVERLTLENKLLTLKLKRNEFV |
| Ga0181390_10201134 | 3300017719 | Seawater | MDTKTELLLDYQEMAILALREEVAKLTKENELLTLKLKKNEYI |
| Ga0181390_10562733 | 3300017719 | Seawater | MNKQTELLLDYQEMAIIALREEVERLTLENKLLTLKLKKNEYI |
| Ga0181390_10580671 | 3300017719 | Seawater | MDTKTELLLDYQEMAILALREEVAKLTKENKLLTLKLKKNEYI |
| Ga0181390_10753982 | 3300017719 | Seawater | MDTKTELLLDYQEMAILALREEVNRLTIENQLLTLKLKKNEFI |
| Ga0181419_10188533 | 3300017728 | Seawater | MDTKTELLLDYQEMAILALREEVERLTLENKLLTLKLKRNERI |
| Ga0181431_11299262 | 3300017735 | Seawater | MNTQTELLLDYQEAAIVALRAEVERLTLENKLLTLKLKKNEYI |
| Ga0187219_10678324 | 3300017751 | Seawater | MDTKTELLLDYQEMAILALREEVNRLTLENQLLTLKLKKNEFI |
| Ga0181400_10586312 | 3300017752 | Seawater | MDTKTELLLDYQEMAIIALREEVERLTLENQLLTLKLKKNEFI |
| Ga0181407_11010073 | 3300017753 | Seawater | MDTKTELLLDYQEMAIIALREEVAKLTKENELLTLK |
| Ga0181407_11063463 | 3300017753 | Seawater | MDTRTELLLDYQEMAIISLREEVERLTKLNKELLTKLSKDD |
| Ga0181420_11879542 | 3300017757 | Seawater | MNTRTELLLDYQEMAILALREEVERLTKENKELLTKLNKDD |
| Ga0181409_10170638 | 3300017758 | Seawater | MNTQTELLLDYQEMAILALREEVAKLTKENELLTLKLKNNERI |
| Ga0181430_10010633 | 3300017772 | Seawater | MDTKTELLLDYQEMAILALREEVERLTLENKLLTLKLKKNEYI |
| Ga0181430_10063828 | 3300017772 | Seawater | MDTKTELLLDYQEMAILALREEVAKLTKENELLTLKLKNNERI |
| Ga0181430_10210283 | 3300017772 | Seawater | MNEQTELLLDYQEMAILALREEVERLTLENKLLTLKLKKNEYI |
| Ga0181430_10667002 | 3300017772 | Seawater | MNTRTELLLDYQEMAIISLREEVERLTKLNKELLTKLSKDD |
| Ga0181430_11951151 | 3300017772 | Seawater | QTELLLDYQEAAIVALRAEVERLTLENKLLTLKLKKNEYI |
| Ga0181386_11698972 | 3300017773 | Seawater | MDTKTELLLDYQEMAILALREEVERLTTENELLTLKLKKNEYI |
| Ga0206125_101417693 | 3300020165 | Seawater | MNTQTELLLDYQEAAIESLRAEVERLTLENKLLTLKLKKNEYI |
| Ga0206125_101611931 | 3300020165 | Seawater | MNEQTELLLDYQEAAILALREEVERLTKENELLTYRLTGNDLQFIQNKEL |
| Ga0206127_10040849 | 3300020169 | Seawater | MDTKTELLLDYQEMAILALREEVERLTKENELLTYRLTGNDLQFIKNKEL |
| Ga0206127_101494010 | 3300020169 | Seawater | MDTKTELLLDYQEMAILALREEVERLTLENKLLTLKLKRNEFV |
| Ga0206127_11695311 | 3300020169 | Seawater | MNTQTELLLDYQEVAIEALRAEVERLTLENKLLTLKLKKNE |
| Ga0206127_11859972 | 3300020169 | Seawater | MNEQTELLLDYQEAAIEALRAEVERLTLENKLLTLKLKKNEYI |
| Ga0206126_1001555913 | 3300020595 | Seawater | TELLLDYQEVAIEALRAEVERLTLENKLLTLKLKKNEYI |
| Ga0206126_100426184 | 3300020595 | Seawater | MNEQTELLLDYQEAAIVALRAEVERLTLENKLLTLKLKKNEYI |
| Ga0206126_100766173 | 3300020595 | Seawater | MDTKTELLLDYQEMAILALREEVERLTKENELLTYRLTGNDLQFIK |
| Ga0206678_101433103 | 3300021084 | Seawater | MDTKTELLLDYQEMAILALREEVERLTLENKLLTLKLKRNEFI |
| Ga0206683_101709082 | 3300021087 | Seawater | MDTKTELLLDYQEMAILALREEVERLTLENQLLTLKLKKNEFI |
| Ga0206682_100641753 | 3300021185 | Seawater | MNEQTELLLDYQEMAILALREEVERLTTENQLLTLKLKKNEHL |
| Ga0206682_102418241 | 3300021185 | Seawater | MNEQTELLLDYQEMAILALREEVNRLTIENQLLTLKLKKNEFI |
| Ga0213868_101375532 | 3300021389 | Seawater | MNTRTELLLDYQEMAIISLREEVERLTLENKLLTLKLKKNEYI |
| Ga0212030_10211014 | 3300022053 | Aqueous | MNEQTRLLLDYQEQAIIALRAEVERLKTENELLTLKLKRN |
| Ga0212030_10483683 | 3300022053 | Aqueous | TELLLDYQEMAILALREEVERLTLENKLLTLKLKANDFI |
| Ga0212030_10526521 | 3300022053 | Aqueous | MNEQTRLLLDYQEQAIIALRAEVERLTTENELLTLKLKRNEYI |
| Ga0212023_10001834 | 3300022061 | Aqueous | MNEQTRLLLDYQEQAIIALRAEVERLTTENELLTLKLKRNEFI |
| Ga0212023_10009373 | 3300022061 | Aqueous | MNEQTRLLLDYQEQAIIALRAEVERLKTENELLTLKLKRNEYI |
| Ga0196889_10593302 | 3300022072 | Aqueous | MNEQTRLLLDYQEQAIIALRTEVERLKTENELLTLKLKRNEYI |
| Ga0212022_10387053 | 3300022164 | Aqueous | MDTKTELLLDYQEAAIVALRKEVERLTLENKLLTLKLKRNEFV |
| Ga0196887_10341892 | 3300022178 | Aqueous | MNEQTRLLLDYQEQAIIALRAEVDRLTTENELLTLKLKRNEYI |
| Ga0244775_104627553 | 3300024346 | Estuarine | MDTKTELLLDYQEIAILALREEVERLTLENKLLTLKLKRNELL |
| Ga0244775_107450362 | 3300024346 | Estuarine | MDTKTELLLDYQEMAISALREEVERLTLENQLLTLKLKKNEFI |
| Ga0209634_11064621 | 3300025138 | Marine | MDTKTELLLDYQEMAILALREEVNRLTLENQILTLKLKANELL |
| Ga0208814_10028026 | 3300025276 | Deep Ocean | MNKRTELLLDYQEMAILSLRKELERLTLENELLTIKLKLNEQDYHTTTT |
| Ga0208814_10347353 | 3300025276 | Deep Ocean | MNTKTELLLDYQEMAIVALREEVERLTLENRLLTLKLKRNEFI |
| Ga0208814_10797591 | 3300025276 | Deep Ocean | MNTQTELLLDYQEMAILALREEVERLTMENRLLTLKLQKNEFI |
| Ga0208814_11063742 | 3300025276 | Deep Ocean | MNTQTELLLDYQEMAIVALREEVERLTMENKLLTLKLQRND |
| Ga0208814_11158402 | 3300025276 | Deep Ocean | HMNTQTELLLDYQEMAIVALREEVERLTMENKLLTLKLQKND |
| Ga0208814_11316542 | 3300025276 | Deep Ocean | MNTQTELLLDYQEMAIVALREEVERLTIENKLLTLKLKRNEFI |
| Ga0208303_10071088 | 3300025543 | Aqueous | MNEQTELLLDYQEMAILALREEVNRLTLENQLLTLKLKANDFI |
| Ga0208303_10139454 | 3300025543 | Aqueous | MNTQTELLLDYQEMAILALREEVNRLTLENQLLTLKLKANDFI |
| Ga0208303_10148124 | 3300025543 | Aqueous | MNTQTELLLDYQEMAILALREEVERLTTENELLTLKLKRNERI |
| Ga0208303_10198631 | 3300025543 | Aqueous | MDTKTELLLDYQEMAILALREEVERLTLENKLLTLKLKKNDFI |
| Ga0209195_11058842 | 3300025590 | Pelagic Marine | MNEQTKLLLDYQEMAIIALREEVERLTKENELLTLKLKKNETI |
| Ga0209195_11162592 | 3300025590 | Pelagic Marine | MDTKTELLLDYQEMAILALREEVNRLTLENQLLTLKLKANEYI |
| Ga0209194_10014408 | 3300025632 | Pelagic Marine | MNTKTELLLDYQEMAIVALREEVERLTTENQLLTLKLKANEYI |
| Ga0209194_11209312 | 3300025632 | Pelagic Marine | MNKQTELLLDYQEMAILALRAEVERLTLENKLLTLKLKKNEYI |
| Ga0208643_10136175 | 3300025645 | Aqueous | MDTKTELLLDYQEAAIVALRKEVERLTLENKLLTLKLKKNDFI |
| Ga0208643_10467984 | 3300025645 | Aqueous | MNEQTRLLLDYQEQAIISLRTEVDRLRTENELLTLKLKRNERI |
| Ga0208643_11405212 | 3300025645 | Aqueous | MDTKTELLLDYQEMAILALREEVERLTLENKLLTLKLKKNEFV |
| Ga0209532_10317343 | 3300025696 | Pelagic Marine | MNTQTELLLDYQEMAIIALREEVERLTKENELLTYRLTGNDLQFIQNKEL |
| Ga0208545_10430815 | 3300025806 | Aqueous | MNEQTRLLLDYQEQAIIALRAEVERLRTENELLTLKLKRNEYI |
| Ga0209199_12383852 | 3300025809 | Pelagic Marine | MDDKTKLLLDYQEMAILALREEVERLTLENKLLTLKLKRNEFV |
| Ga0209193_11081361 | 3300025816 | Pelagic Marine | MNEQTKLLLDYQEMAIIALREEVERLTTENQLLTLKLKANEYI |
| Ga0209119_13060551 | 3300025860 | Pelagic Marine | MNTQTELLLDYQEMAILALREEVERLTLENKLLTLKLKRNEFV |
| Ga0209710_10296925 | 3300027687 | Marine | MDTKTELLLDYQEMAILALREEVNRLTLENQILTLKLKANDFI |
| Ga0209709_102940782 | 3300027779 | Marine | MNTQTELLLDYQEMAILALREEVERLTLENRLLTLKLKSNEYI |
| Ga0209090_1000809413 | 3300027813 | Marine | MDTKTELLLDYQEMAILALREEVNRLALENQILTLKLKANDFI |
| Ga0209090_102604952 | 3300027813 | Marine | MNEQTELLLDYQEMAILALREEVERLTLENKLLTLKLKSNDYI |
| Ga0209092_100891134 | 3300027833 | Marine | MNTQTELLLDYQEMAILALREEVERLTLENKLLTLKLKRNEYV |
| Ga0209092_103348112 | 3300027833 | Marine | MDTKTELLLDYQEMAILALREEVERLTTENKLLTLKLKRNEYI |
| Ga0257110_100155623 | 3300028197 | Marine | MNEQTELLLDYQEMAILALRKEVERLKLENKLLTLKLKTNELL |
| Ga0228615_11271502 | 3300028418 | Seawater | MDTKTELLLDYQEMAILALREEVERLTLENKLLTLKLKKNEFI |
| Ga0315331_109645521 | 3300031774 | Seawater | MDTKTELLLDYQEMAILALREEVAKLTKENELLTLKLKRNERI |
| ⦗Top⦘ |