


| Basic Information | |
|---|---|
| Family ID | F041349 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AVALHRVGRQADAQATLETLLGSGASFSDKAEAEKLLQELKRG |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.62 % |
| % of genes near scaffold ends (potentially truncated) | 97.50 % |
| % of genes from short scaffolds (< 2000 bps) | 88.75 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.625 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.125 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.625 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.875 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.89% β-sheet: 0.00% Coil/Unstructured: 52.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF03950 | tRNA-synt_1c_C | 7.50 |
| PF07589 | PEP-CTERM | 4.38 |
| PF03901 | Glyco_transf_22 | 1.25 |
| PF07683 | CobW_C | 1.25 |
| PF09334 | tRNA-synt_1g | 0.62 |
| PF03167 | UDG | 0.62 |
| PF01738 | DLH | 0.62 |
| PF02615 | Ldh_2 | 0.62 |
| PF14319 | Zn_Tnp_IS91 | 0.62 |
| PF08388 | GIIM | 0.62 |
| PF14559 | TPR_19 | 0.62 |
| PF02954 | HTH_8 | 0.62 |
| PF13414 | TPR_11 | 0.62 |
| PF01381 | HTH_3 | 0.62 |
| PF04909 | Amidohydro_2 | 0.62 |
| PF10282 | Lactonase | 0.62 |
| PF13437 | HlyD_3 | 0.62 |
| PF06262 | Zincin_1 | 0.62 |
| PF02515 | CoA_transf_3 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 7.50 |
| COG0523 | Zinc metallochaperone YeiR/ZagA and related GTPases, G3E family | General function prediction only [R] | 1.25 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.62 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.62 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.62 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.62 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.62 |
| COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.62 % |
| All Organisms | root | All Organisms | 49.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003219|JGI26341J46601_10162188 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300004080|Ga0062385_10102217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1390 | Open in IMG/M |
| 3300004082|Ga0062384_100094705 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300004082|Ga0062384_100214676 | Not Available | 1144 | Open in IMG/M |
| 3300004635|Ga0062388_100420035 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1169 | Open in IMG/M |
| 3300005179|Ga0066684_10013518 | All Organisms → cellular organisms → Bacteria | 4049 | Open in IMG/M |
| 3300005332|Ga0066388_100196436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2635 | Open in IMG/M |
| 3300005332|Ga0066388_102982457 | Not Available | 865 | Open in IMG/M |
| 3300005468|Ga0070707_101778456 | Not Available | 584 | Open in IMG/M |
| 3300005559|Ga0066700_10923963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 578 | Open in IMG/M |
| 3300006046|Ga0066652_100204615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1700 | Open in IMG/M |
| 3300006058|Ga0075432_10457548 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006175|Ga0070712_100287048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1327 | Open in IMG/M |
| 3300006175|Ga0070712_101325258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300009792|Ga0126374_11400586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300010043|Ga0126380_12217687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phreatobacteraceae → Phreatobacter | 508 | Open in IMG/M |
| 3300010047|Ga0126382_11293522 | Not Available | 659 | Open in IMG/M |
| 3300010048|Ga0126373_12723924 | Not Available | 552 | Open in IMG/M |
| 3300010159|Ga0099796_10186973 | Not Available | 834 | Open in IMG/M |
| 3300010341|Ga0074045_10228196 | Not Available | 1238 | Open in IMG/M |
| 3300010343|Ga0074044_10898613 | Not Available | 579 | Open in IMG/M |
| 3300010358|Ga0126370_10063121 | Not Available | 2414 | Open in IMG/M |
| 3300010358|Ga0126370_10789702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 845 | Open in IMG/M |
| 3300010358|Ga0126370_11888044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300010359|Ga0126376_11615774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300010361|Ga0126378_10401237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1484 | Open in IMG/M |
| 3300010361|Ga0126378_11720805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300010361|Ga0126378_12237975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300010361|Ga0126378_12443736 | Not Available | 597 | Open in IMG/M |
| 3300010366|Ga0126379_10155715 | Not Available | 2137 | Open in IMG/M |
| 3300010369|Ga0136643_10599032 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300010376|Ga0126381_100371588 | Not Available | 1983 | Open in IMG/M |
| 3300010376|Ga0126381_101162838 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300010398|Ga0126383_11454364 | Not Available | 775 | Open in IMG/M |
| 3300011120|Ga0150983_10118777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300011120|Ga0150983_15564090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300012096|Ga0137389_10562099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 980 | Open in IMG/M |
| 3300012361|Ga0137360_11601574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300012918|Ga0137396_10909192 | Not Available | 644 | Open in IMG/M |
| 3300012927|Ga0137416_10941137 | Not Available | 770 | Open in IMG/M |
| 3300012948|Ga0126375_10704257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300014150|Ga0134081_10151208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 763 | Open in IMG/M |
| 3300016270|Ga0182036_10001954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 9861 | Open in IMG/M |
| 3300016270|Ga0182036_10008454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5356 | Open in IMG/M |
| 3300016270|Ga0182036_10185558 | Not Available | 1512 | Open in IMG/M |
| 3300016270|Ga0182036_10432749 | Not Available | 1031 | Open in IMG/M |
| 3300016270|Ga0182036_11602733 | Not Available | 548 | Open in IMG/M |
| 3300016294|Ga0182041_11241434 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300016319|Ga0182033_11159330 | Not Available | 691 | Open in IMG/M |
| 3300016319|Ga0182033_11956166 | Not Available | 534 | Open in IMG/M |
| 3300016341|Ga0182035_10050608 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Methanosarcinaceae → Methanosarcina → Methanosarcina mazei | 2817 | Open in IMG/M |
| 3300016357|Ga0182032_10258551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1357 | Open in IMG/M |
| 3300016357|Ga0182032_12014805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300016387|Ga0182040_10412672 | Not Available | 1062 | Open in IMG/M |
| 3300016387|Ga0182040_10745582 | Not Available | 803 | Open in IMG/M |
| 3300016404|Ga0182037_11461425 | Not Available | 606 | Open in IMG/M |
| 3300016422|Ga0182039_10057838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2676 | Open in IMG/M |
| 3300016422|Ga0182039_10202990 | Not Available | 1583 | Open in IMG/M |
| 3300016422|Ga0182039_10714290 | Not Available | 884 | Open in IMG/M |
| 3300016445|Ga0182038_10853181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 801 | Open in IMG/M |
| 3300018060|Ga0187765_10245928 | Not Available | 1052 | Open in IMG/M |
| 3300020581|Ga0210399_10134534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2036 | Open in IMG/M |
| 3300021178|Ga0210408_10147190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1864 | Open in IMG/M |
| 3300021178|Ga0210408_11383516 | Not Available | 531 | Open in IMG/M |
| 3300021374|Ga0213881_10304182 | Not Available | 712 | Open in IMG/M |
| 3300021377|Ga0213874_10114835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 909 | Open in IMG/M |
| 3300021406|Ga0210386_11188159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300021439|Ga0213879_10133763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 712 | Open in IMG/M |
| 3300021474|Ga0210390_11576621 | Not Available | 518 | Open in IMG/M |
| 3300021476|Ga0187846_10011793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4186 | Open in IMG/M |
| 3300021476|Ga0187846_10082413 | Not Available | 1395 | Open in IMG/M |
| 3300021479|Ga0210410_10928520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300021560|Ga0126371_11137279 | Not Available | 919 | Open in IMG/M |
| 3300021560|Ga0126371_11618003 | Not Available | 773 | Open in IMG/M |
| 3300021560|Ga0126371_11619428 | Not Available | 773 | Open in IMG/M |
| 3300022529|Ga0242668_1057957 | Not Available | 707 | Open in IMG/M |
| 3300022532|Ga0242655_10023065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1354 | Open in IMG/M |
| 3300022724|Ga0242665_10216304 | Not Available | 638 | Open in IMG/M |
| 3300022726|Ga0242654_10312886 | Not Available | 581 | Open in IMG/M |
| 3300025898|Ga0207692_10983159 | Not Available | 557 | Open in IMG/M |
| 3300025916|Ga0207663_10235697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1339 | Open in IMG/M |
| 3300025922|Ga0207646_11179991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300025928|Ga0207700_10263047 | Not Available | 1478 | Open in IMG/M |
| 3300025928|Ga0207700_11421184 | Not Available | 616 | Open in IMG/M |
| 3300026312|Ga0209153_1183000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300026547|Ga0209156_10055503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2085 | Open in IMG/M |
| 3300027651|Ga0209217_1191396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300027703|Ga0207862_1261573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300027729|Ga0209248_10146083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agaridevorans | 706 | Open in IMG/M |
| 3300027748|Ga0209689_1102963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1469 | Open in IMG/M |
| 3300027812|Ga0209656_10234448 | Not Available | 875 | Open in IMG/M |
| 3300028536|Ga0137415_11012041 | Not Available | 642 | Open in IMG/M |
| 3300031231|Ga0170824_112721473 | Not Available | 539 | Open in IMG/M |
| 3300031231|Ga0170824_127296114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300031469|Ga0170819_16619397 | Not Available | 1636 | Open in IMG/M |
| 3300031543|Ga0318516_10281178 | Not Available | 962 | Open in IMG/M |
| 3300031545|Ga0318541_10374005 | Not Available | 796 | Open in IMG/M |
| 3300031546|Ga0318538_10456197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300031561|Ga0318528_10340344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 805 | Open in IMG/M |
| 3300031573|Ga0310915_10230711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → filamentous cyanobacterium Phorm 46 | 1300 | Open in IMG/M |
| 3300031640|Ga0318555_10005739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5110 | Open in IMG/M |
| 3300031668|Ga0318542_10408528 | Not Available | 701 | Open in IMG/M |
| 3300031719|Ga0306917_10850882 | Not Available | 714 | Open in IMG/M |
| 3300031723|Ga0318493_10560636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300031736|Ga0318501_10466144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 687 | Open in IMG/M |
| 3300031748|Ga0318492_10241001 | Not Available | 933 | Open in IMG/M |
| 3300031751|Ga0318494_10963990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300031754|Ga0307475_11188017 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031763|Ga0318537_10103893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1053 | Open in IMG/M |
| 3300031765|Ga0318554_10014962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 3946 | Open in IMG/M |
| 3300031765|Ga0318554_10744481 | Not Available | 549 | Open in IMG/M |
| 3300031765|Ga0318554_10744646 | Not Available | 549 | Open in IMG/M |
| 3300031770|Ga0318521_10030138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2648 | Open in IMG/M |
| 3300031771|Ga0318546_10492364 | Not Available | 860 | Open in IMG/M |
| 3300031777|Ga0318543_10044945 | Not Available | 1783 | Open in IMG/M |
| 3300031781|Ga0318547_10282378 | Not Available | 1006 | Open in IMG/M |
| 3300031793|Ga0318548_10320568 | Not Available | 761 | Open in IMG/M |
| 3300031795|Ga0318557_10406916 | Not Available | 626 | Open in IMG/M |
| 3300031796|Ga0318576_10306782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300031796|Ga0318576_10569575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300031798|Ga0318523_10384525 | Not Available | 698 | Open in IMG/M |
| 3300031823|Ga0307478_10440676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1082 | Open in IMG/M |
| 3300031846|Ga0318512_10323350 | Not Available | 769 | Open in IMG/M |
| 3300031879|Ga0306919_10793014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300031880|Ga0318544_10139586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 926 | Open in IMG/M |
| 3300031890|Ga0306925_12182844 | Not Available | 516 | Open in IMG/M |
| 3300031893|Ga0318536_10149380 | Not Available | 1187 | Open in IMG/M |
| 3300031893|Ga0318536_10296733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 820 | Open in IMG/M |
| 3300031894|Ga0318522_10002783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4547 | Open in IMG/M |
| 3300031894|Ga0318522_10084921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1160 | Open in IMG/M |
| 3300031896|Ga0318551_10698017 | Not Available | 588 | Open in IMG/M |
| 3300031912|Ga0306921_11827892 | Not Available | 652 | Open in IMG/M |
| 3300031912|Ga0306921_12158234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300031946|Ga0310910_10460398 | Not Available | 1009 | Open in IMG/M |
| 3300031947|Ga0310909_11139743 | Not Available | 632 | Open in IMG/M |
| 3300031947|Ga0310909_11436966 | Not Available | 551 | Open in IMG/M |
| 3300031954|Ga0306926_10032419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 6140 | Open in IMG/M |
| 3300032010|Ga0318569_10152197 | Not Available | 1065 | Open in IMG/M |
| 3300032010|Ga0318569_10239068 | Not Available | 843 | Open in IMG/M |
| 3300032025|Ga0318507_10407724 | Not Available | 592 | Open in IMG/M |
| 3300032041|Ga0318549_10258008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300032041|Ga0318549_10494045 | Not Available | 550 | Open in IMG/M |
| 3300032055|Ga0318575_10070288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1650 | Open in IMG/M |
| 3300032059|Ga0318533_10212367 | Not Available | 1389 | Open in IMG/M |
| 3300032059|Ga0318533_10226360 | Not Available | 1346 | Open in IMG/M |
| 3300032059|Ga0318533_11015788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300032059|Ga0318533_11078342 | Not Available | 588 | Open in IMG/M |
| 3300032063|Ga0318504_10314206 | Not Available | 743 | Open in IMG/M |
| 3300032065|Ga0318513_10454229 | Not Available | 626 | Open in IMG/M |
| 3300032067|Ga0318524_10524945 | Not Available | 622 | Open in IMG/M |
| 3300032076|Ga0306924_10151039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2659 | Open in IMG/M |
| 3300032076|Ga0306924_10807093 | Not Available | 1045 | Open in IMG/M |
| 3300032090|Ga0318518_10008091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4232 | Open in IMG/M |
| 3300032094|Ga0318540_10086755 | Not Available | 1458 | Open in IMG/M |
| 3300032261|Ga0306920_100604332 | Not Available | 1622 | Open in IMG/M |
| 3300032261|Ga0306920_101166878 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300032261|Ga0306920_103707670 | Not Available | 560 | Open in IMG/M |
| 3300032261|Ga0306920_104456399 | Not Available | 501 | Open in IMG/M |
| 3300033289|Ga0310914_11063391 | Not Available | 710 | Open in IMG/M |
| 3300033290|Ga0318519_10251985 | Not Available | 1022 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.75% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.38% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.25% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.25% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.25% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.62% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.62% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.62% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010369 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 3) | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26341J46601_101621881 | 3300003219 | Bog Forest Soil | LHRLGRPADARAALETLLGSGVSFADKADAEKLLQDLKRG* |
| Ga0062385_101022171 | 3300004080 | Bog Forest Soil | APEDLDVQYHLAVALHRVGLAADARALLESLLGSAGSFADRPEAEKLMRELKRG* |
| Ga0062384_1000947053 | 3300004082 | Bog Forest Soil | HLAVALNRLGRTTDARARLETLLGSGVTFSDRAEAEQLLQQLKRG* |
| Ga0062384_1002146761 | 3300004082 | Bog Forest Soil | AVALNRLGRSADAQAMLEKLLGSGTAFADKPEAEKLLAELKHS* |
| Ga0062388_1004200351 | 3300004635 | Bog Forest Soil | PEDLDVQYHLAVALHRVGRAADARALLESLLGSAGSFADRAEAEKLMQELKRS* |
| Ga0066684_100135181 | 3300005179 | Soil | LAVALHRVGRQADAQATLEHLLGSGVSFSDKAEAEKLLQELKRS* |
| Ga0066388_1001964363 | 3300005332 | Tropical Forest Soil | IQYHLAVALQRVGRRADAQAMLEALLGSGVSFTDKAEAEKLLQELKHS* |
| Ga0066388_1029824572 | 3300005332 | Tropical Forest Soil | NRIGRTVDAQSVLERLLGSGAAFSDKAEAEKLLEHLKQG* |
| Ga0070707_1017784561 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AVALHRVGRAADAQAMLETLLGSGVAFSDKSEAEKLLQEWKRG* |
| Ga0066700_109239632 | 3300005559 | Soil | QYHLAVALHRVGRPADAQSMLEGLLASGASFADKAEAEKLLQKLKQG* |
| Ga0066652_1002046151 | 3300006046 | Soil | YHLAVALHRVGRAADARVVLENLLGSGGSFADRTEAERLMQELKRS* |
| Ga0075432_104575481 | 3300006058 | Populus Rhizosphere | VALHRVGRPADAQSMLESLLESGASFADKAEAEKLLQKLKQG* |
| Ga0070712_1002870482 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | QYHLAVALHNVGRPADARAMLESLLGSGGSFAERAEAEKLLQELKRG* |
| Ga0070712_1013252581 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | APQDLDIQYHLAVALYRVGRAADARILLESLLGSFGSFANRAEAEKLMQELNRS* |
| Ga0126374_114005861 | 3300009792 | Tropical Forest Soil | LAVALNRVGRTADAQAMLETLLGSGAVFSDKAEAEKLLQQLKHG* |
| Ga0126380_122176872 | 3300010043 | Tropical Forest Soil | KNPDIQYHLSVALNRLGRTAEAQVTLETLLGPGPSFSDKAEAEKLLQQLKRG* |
| Ga0126382_112935221 | 3300010047 | Tropical Forest Soil | HLAVAFHRAGRQNDAQATLEALLGSGVSFAEKPDAEKLLEELKRG* |
| Ga0126373_127239242 | 3300010048 | Tropical Forest Soil | QYHLAVALQRVGQPTDAQAMLETLLGSGVSFADKADAEKLLQQLKRG* |
| Ga0099796_101869731 | 3300010159 | Vadose Zone Soil | YHLAVALNRLGRTADAQAMLETLLGAGVTFSDRAEAEKLLQQLKRG* |
| Ga0074045_102281962 | 3300010341 | Bog Forest Soil | VAFNRLGRIADAQAMLETLLGSGTNFSDRAEAEKLLQQLKRG* |
| Ga0074044_108986131 | 3300010343 | Bog Forest Soil | ALNRLGRTSDAQATLEALLGSDVTFSDRTEAEKLLQQLKRG* |
| Ga0126370_100631211 | 3300010358 | Tropical Forest Soil | LAVALQRVGRRSDAQAMLEALLGSGVSFTDKAEAEKLLQELKHS* |
| Ga0126370_107897021 | 3300010358 | Tropical Forest Soil | IQYHLAVALQRVGRPADAQAMLEALLGSGVSFTDKADAEKLLQELKRG* |
| Ga0126370_118880442 | 3300010358 | Tropical Forest Soil | RVGRPADAQAMLETLLGSSVSFADRAEAEKLLHKLKAG* |
| Ga0126376_116157741 | 3300010359 | Tropical Forest Soil | IRYHLAVALNPVGRTADAQAMLETLLGSGAAFSDKAEAEKLLQQLKHG* |
| Ga0126378_104012371 | 3300010361 | Tropical Forest Soil | AAPANPDIQYHLAVALQHLWRSADAQAMLEKLLGSGVSFTDRAEAERLLQDLKHS* |
| Ga0126378_117208051 | 3300010361 | Tropical Forest Soil | IQYHLAVALQRVGRPADAQAMLEALLGSGVSFTDMADAEKLLQELKRG* |
| Ga0126378_122379751 | 3300010361 | Tropical Forest Soil | GRTAEAQATLETLLGPGPSFSDKAEAEKLLQQLKRG* |
| Ga0126378_124437361 | 3300010361 | Tropical Forest Soil | RAGRSADAEALLETLLGSGASFADKAAAETLLHELKPG* |
| Ga0126379_101557153 | 3300010366 | Tropical Forest Soil | KRVGRPTDAQVILEGLLGSGISFADRADAEKLLQELRHG* |
| Ga0136643_105990322 | 3300010369 | Termite Gut | GRTADAQATLEALLGSGAAFSDKDEAEKLLQQLKRG* |
| Ga0126381_1003715883 | 3300010376 | Tropical Forest Soil | AVALHRVGRQADAQTTLENLLGSGASFSDKSDAEKLLQELKRG* |
| Ga0126381_1011628381 | 3300010376 | Tropical Forest Soil | RQADAQATLESLLGSGASFADKPEAEKLLQELKRG* |
| Ga0126383_114543642 | 3300010398 | Tropical Forest Soil | VALHRVGRQADAQTTLENLLGSGASFSDRSDAEKLLQELKRG* |
| Ga0150983_101187771 | 3300011120 | Forest Soil | QYHLAVALHRVGRAADARAMLESLLGSAGSFADRTEAEKLMQELKRS* |
| Ga0150983_155640901 | 3300011120 | Forest Soil | HRVGRTADARAMLEILLGSAGSFADRAEAEKLMQELKRS* |
| Ga0137389_105620991 | 3300012096 | Vadose Zone Soil | PADAQSMLESLLGSGASFADKADAEKLLQKLKQG* |
| Ga0137360_116015741 | 3300012361 | Vadose Zone Soil | LHHVGRPADAQSMLESLLGSGASFADKADAEKLLQKLKQG* |
| Ga0137396_109091921 | 3300012918 | Vadose Zone Soil | NRLGRTADARETLETLLGSGVTFSDKAEAERLLQQLKRG* |
| Ga0137416_109411371 | 3300012927 | Vadose Zone Soil | VALHRVGRAADAQAMLETLLGSGVAFSDKSEAEKLLQEWKRG* |
| Ga0126375_107042571 | 3300012948 | Tropical Forest Soil | IQYHLAVALHRVGRQADAQATLENLLRSGVSFSDKTEAEKLLQELKRG* |
| Ga0134081_101512081 | 3300014150 | Grasslands Soil | HRVGHAADARLILENLLSSAGSFADRAEAEKLMQELKRG* |
| Ga0182036_100019549 | 3300016270 | Soil | LAVALNRVGRTADAQAMLETLLGSGAAFSDRAEAEKLLQQLKRG |
| Ga0182036_100084547 | 3300016270 | Soil | HLAVALNRLGRTADARAMLEALLGSGTTFSDRAEAEKLLQQLKRG |
| Ga0182036_101855581 | 3300016270 | Soil | QRVGRPTDAQAMLETLLGSGASFADKADAEKLLQELKRS |
| Ga0182036_104327492 | 3300016270 | Soil | AVALNRLGRTADAQATLETLLGSGVTFSDRAEAEKLLQQLKQG |
| Ga0182036_116027331 | 3300016270 | Soil | LNRLGRTADAQATLETLLGSGVTFSDRAEAEKLLQQLKQG |
| Ga0182041_112414341 | 3300016294 | Soil | RLGRTADAQAKLETLLGSGVTFSDKAEAEKLLQQLKRG |
| Ga0182033_111593301 | 3300016319 | Soil | LQRVGRPADAQAMLETLLGSGVSFTNRSDAERLLQDLKRG |
| Ga0182033_119561661 | 3300016319 | Soil | VALQRVGRPTDAQAMLETLLGSGASFADKADAEKLLQELKRG |
| Ga0182035_100506085 | 3300016341 | Soil | GRPTDAQAMLETLLGSGASFADKADAEKLLQELKRS |
| Ga0182032_102585512 | 3300016357 | Soil | ALHRVGRQADAQTTLEKLLGSGASFSDKTEAEKLLQELKRS |
| Ga0182032_120148052 | 3300016357 | Soil | DIQYHLAVAFHRTGRPADAEALLTALLTSGIFFTDKAEAEKLLHELKPG |
| Ga0182040_104126723 | 3300016387 | Soil | ALQRVGRPTDAQAMLETLLGSGASFADKADAEKLLQELKRS |
| Ga0182040_107455822 | 3300016387 | Soil | AGRSADAEVLLKTLLGSGASFADKAAAEKLLQEMKPG |
| Ga0182037_114614251 | 3300016404 | Soil | LAVALQRVGRRADAQAMLEALLGSGVSFTDKAEAERLLQELKHS |
| Ga0182039_100578381 | 3300016422 | Soil | RAADAQTMLETLLGSSVSFADRADAEKLLHELKAG |
| Ga0182039_102029901 | 3300016422 | Soil | VGRAADAQATLETLLGSGVSFADKAEAEKLLQELKHG |
| Ga0182039_107142901 | 3300016422 | Soil | RLGRPAEARARIEPLLRSGLSFADKDEAEKLLEELKHG |
| Ga0182038_108531811 | 3300016445 | Soil | YHLAVALHHVGRAADARAMLETLLGSAGSFADRAEAEKLMQELKRG |
| Ga0187765_102459282 | 3300018060 | Tropical Peatland | VALQRVGRPADAQAMIETLLGSGVSFTDKSEAEKLLRDLKNG |
| Ga0210399_101345343 | 3300020581 | Soil | APGNPDIQYHPAVALHRVGRQADAQATLENLLGSGASFSDKAAAEKLLQELKRS |
| Ga0210408_101471904 | 3300021178 | Soil | DLQYHLAVALYRVGRAADARILLENLLGSFGSFADRAEAEKLMQELKRS |
| Ga0210408_113835161 | 3300021178 | Soil | RLGRTGEAQAVLETLLGSGVTFSDRAEAEKLLQQLKRG |
| Ga0213881_103041822 | 3300021374 | Exposed Rock | RVGRTADAQTTLETLLKSGATFDDKAEAEKLLEQLKRG |
| Ga0213874_101148352 | 3300021377 | Plant Roots | LHRVGRQADAQATLENLLGSGASFSDRAEAEKLLQELKRT |
| Ga0210386_111881591 | 3300021406 | Soil | YLHAANLGAPEDLDIQYHLAVALYRVGRAADARILLENLLGSFGSFADRAEAEKLMQELKRS |
| Ga0213879_101337631 | 3300021439 | Bulk Soil | DIQYHLAVALQRIGRPADAQAMLETLLGSGVSFTDKSEAEKLLQDLKRG |
| Ga0210390_115766211 | 3300021474 | Soil | ALHRVGKRADARATLENLLDSGASFSDKAEAEKLLQELKRS |
| Ga0187846_100117931 | 3300021476 | Biofilm | RSHLAVALQRADRPADARAVLERLLGSGISFADRGEAEKLLQDLKSG |
| Ga0187846_100824131 | 3300021476 | Biofilm | IQYHLAVALHRIGRPADAEALLTALLASGISFTDKAEAEKLLHELKPG |
| Ga0210410_109285201 | 3300021479 | Soil | EDLDVQYHLAVALHRVGRAADARAMLESLLGSAGSFADRTEAEKLMQELKRS |
| Ga0126371_111372791 | 3300021560 | Tropical Forest Soil | IQYHLAVALNRLGRTADARATLETLLGSGMTFSDRAEAEKLLQHLKRG |
| Ga0126371_116180032 | 3300021560 | Tropical Forest Soil | ALNRVGRTADAQAMLETLLGSGAAFSDKAEAEKLLQQLKHG |
| Ga0126371_116194282 | 3300021560 | Tropical Forest Soil | GRTADAQAMLETLLGSGAAFSDKAEAEKLLQQLKHG |
| Ga0242668_10579572 | 3300022529 | Soil | GRPADARAALERLLDSGVSFADKTDAEKLLQDLKRG |
| Ga0242655_100230651 | 3300022532 | Soil | LAVALNRLGRTADAQAMLETLLGSGATFSDRTEAEKLLQQLKRS |
| Ga0242665_102163041 | 3300022724 | Soil | VALNRLGRTADAQATLETLLGSGVTFSDRGEAEKLLQQLKRG |
| Ga0242654_103128861 | 3300022726 | Soil | RPADAQAMLETLLGSGVSFTDKDEAEKLLRELKHG |
| Ga0207692_109831592 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LHKVGRQADAQATLENLLGSGVSFSDKAEAEKLLQELKRS |
| Ga0207663_102356972 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AVALHRVGRQADAQATLETLLGSGASFSDKAEAEKLLQELKRG |
| Ga0207646_111799911 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | HRVGRPDEALSMLESLLASGVSFTDKAEAEKLLQKLKQG |
| Ga0207700_102630471 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVALHKVGRQADAQATLENLLGSGVSFSDKAEAEKLLQELKRS |
| Ga0207700_114211841 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVALYRVGRAADARILLENLLGSFGSFADRAEAERLMQELKRS |
| Ga0209153_11830002 | 3300026312 | Soil | RAGRAADARAMLETLLGSGSSLAEKAEAEKLLRELKRG |
| Ga0209156_100555031 | 3300026547 | Soil | LHRVGRQADAQATLEHLLGSGVSFSDKAEAEKLLQQLKRG |
| Ga0209217_11913962 | 3300027651 | Forest Soil | APQDLDIQYHLAVALYRVGRSADARILLENLLGSFGSFTERAEAEKLMQELKRS |
| Ga0207862_12615732 | 3300027703 | Tropical Forest Soil | RVGRPADAQAMLETLLGSDVSFTNKAEAEKLLKELKHG |
| Ga0209248_101460831 | 3300027729 | Bog Forest Soil | YHLAVALQRVGRSADAQAMLEKLLESGSSFADKAEAEKLLQELKHG |
| Ga0209689_11029632 | 3300027748 | Soil | LAVALHRVGRPGDALSMLESLLESGVSFTDKAEAEKLLQKLKPG |
| Ga0209656_102344481 | 3300027812 | Bog Forest Soil | RTADAQATLETLLGSGVTFSDRAEAEKLLQQLKRG |
| Ga0137415_110120412 | 3300028536 | Vadose Zone Soil | VALHRVGRAADAQAMLETLLGSGVAFSDKSEAEKLLQEWKRG |
| Ga0170824_1127214732 | 3300031231 | Forest Soil | LAVALQRVGRPADAQAMLETLLGSGLSFADKAEAAKLLQELKHS |
| Ga0170824_1272961141 | 3300031231 | Forest Soil | DLDIQYHLAVALYRVGRAADARFILENLLGSVGSFTERPDAERLTQELERS |
| Ga0170819_166193973 | 3300031469 | Forest Soil | AVALQRVGRPTDAQAMLETLLGSGVSFTEKADAEKLLQELKRG |
| Ga0318516_102811781 | 3300031543 | Soil | IQYHLAVALNRLGRTADAQAMLETLLGSGVTFSDRAEAEKLLQQLKQG |
| Ga0318541_103740051 | 3300031545 | Soil | VVVELGHLAVALNRVGRSADAETLLKSLLVSAATSSDKAEAEKLLQQLKRG |
| Ga0318538_104561971 | 3300031546 | Soil | YHLAVALQRVGRPADAQAMLETLLGSGVSFTDKDEAEKLLRELKHS |
| Ga0318528_103403441 | 3300031561 | Soil | QYHLAVALHRIGRPGDAEALLTALLASGVSFTDKVEAAKLLHELKPG |
| Ga0310915_102307115 | 3300031573 | Soil | QYHLAVALNRLGRTADAQAMLETLLSSGVTFSDKAEAEKLLQHLKRG |
| Ga0318555_100057391 | 3300031640 | Soil | ALNRVGRTADAQAMLETLLGSGAAFSDKAEAEKLLQQLKRG |
| Ga0318542_104085281 | 3300031668 | Soil | LQRVGRTADAQVMLEALLSSGVSFPDKDAAEKLLQELKHG |
| Ga0306917_108508823 | 3300031719 | Soil | HLAVALNRLGRTADAQAMLETLLSSGVTFSDKAEAEKLLQHLKRG |
| Ga0318493_105606361 | 3300031723 | Soil | QYHLAVALQRVGRTADAQVMLEALLSSGVSFPDKDAAEKLLQELKHG |
| Ga0318501_104661442 | 3300031736 | Soil | IQYHLAVALLRVGRPADAEAMLETLLGSGVSFTDKREAEKLLRDLKRG |
| Ga0318492_102410013 | 3300031748 | Soil | DIQYHLAVALTRLGRTGDAQARLEMVLGSGATFSDRAEAEKLLQQLKRG |
| Ga0318494_109639902 | 3300031751 | Soil | QYHLAVALHRIGRPADARAMLESLFRSGVSFADRAEAEKLLHELKPG |
| Ga0307475_111880171 | 3300031754 | Hardwood Forest Soil | IQYHLAVTLNRLGRTADAQTMLEALLGSGVTFTDKGEAEKLLQQLKQG |
| Ga0318537_101038932 | 3300031763 | Soil | IQYHLAVALQRVGRPADAQAMLETLLGSGVSFTNKAEAEKLLKELKHG |
| Ga0318554_100149621 | 3300031765 | Soil | AVALQRVGRPADAQAMLETLLGSGVSFTDKDEAEKLLRELKHS |
| Ga0318554_107444811 | 3300031765 | Soil | LQRVGRPADAQAMLETLLGSGVSFTDKDEAEKLLLELKHG |
| Ga0318554_107446461 | 3300031765 | Soil | AIALNRLGRTADAQATLETLLGSGVTFSDRAEAEKLLLKLKRG |
| Ga0318521_100301381 | 3300031770 | Soil | DIQYHLAVALQRVGRPADAQAMLEALLGFGVSFTDKADAEKLLQELKRG |
| Ga0318546_104923641 | 3300031771 | Soil | HLAAALYRAGRPADAEALLETLLGSGASFADKAAAETLLHELKPG |
| Ga0318543_100449453 | 3300031777 | Soil | LQRVGRPADAQAMLETLLGSGVSFTDKDEAEKLLRELKHG |
| Ga0318547_102823783 | 3300031781 | Soil | SVGRPTDAQAMLETLLGSGASFADKADAEKLLQELKRS |
| Ga0318548_103205682 | 3300031793 | Soil | TRLGRTGDAQARLEMLLGSGATFSDRAEAEKLLQQLKRG |
| Ga0318557_104069161 | 3300031795 | Soil | IQYHLAVALQRVVRPADAQAMLETLLGSGVSFANKSDAEKLLQDLKRG |
| Ga0318576_103067821 | 3300031796 | Soil | VALQRVGRPADAQAMLETLLGSGVSFTDKSEAEKLLQDLKRG |
| Ga0318576_105695751 | 3300031796 | Soil | IQYHLAVALQRVGRPADAQAMLEALLGFGVSFTDKADAEKLLQELKRG |
| Ga0318523_103845251 | 3300031798 | Soil | DPNIQYHLAAALYRAGRPADAEALLETLLGSGASFADKAAAETLLHELKPG |
| Ga0307478_104406761 | 3300031823 | Hardwood Forest Soil | DGVGRPADAQAMLETLLRSGAPFADKAKAEKLLRELKPG |
| Ga0318512_103233502 | 3300031846 | Soil | YHLAAALYRAGRPADAEALLETLLGSGASFADKAAAETLLHELKPG |
| Ga0306919_107930141 | 3300031879 | Soil | HLAVALQRVGRPADAQAMLEALLGSGVSFTDKADAEKLLQELKRG |
| Ga0318544_101395862 | 3300031880 | Soil | IQYHLAVALQRVGRPADAEAMLETLLGSGVSFTDKSEAEKLLRDLKRG |
| Ga0306925_121828441 | 3300031890 | Soil | ALNRLGRTADAQATLETLLGSGVTFSDRAEAEKLLLKLKRG |
| Ga0318536_101493802 | 3300031893 | Soil | VALQRVGRPADAVAMLETLLGSGVSFTDKSEAEKLLRDLKRG |
| Ga0318536_102967332 | 3300031893 | Soil | HLAVALQRVGRPADAQAMLETLLGSGVSFTNKAEAEKLLKELKHG |
| Ga0318522_100027831 | 3300031894 | Soil | NRLGRTADAQAMLETLLSSGITFSDKAEAEKLLQHLKRG |
| Ga0318522_100849213 | 3300031894 | Soil | FAVALHRVGRPADAQAILETLLGSSVSFADRAEAEKLLHELKAG |
| Ga0318551_106980172 | 3300031896 | Soil | GLKHRLSVGRPADAQAMLETLLGSGVSFANKSDAEKLLQDLKRG |
| Ga0306921_118278922 | 3300031912 | Soil | AVALQRVGRPTDAQAMLETLLGSGASFADKADAEKLLQELKRG |
| Ga0306921_121582342 | 3300031912 | Soil | LHRVGRAADAQATLETLLGSGVSFADKAEAEKLLQELKHG |
| Ga0310910_104603983 | 3300031946 | Soil | IQYHLAGALTRLGRTGDAQARLEMLLGSGATFSDRAEAEKLLQQLKRG |
| Ga0310909_111397432 | 3300031947 | Soil | LAVALNRVGRTADAQAMLETLLGSGAAFSDRAEAEKLLQQLKHG |
| Ga0310909_114369661 | 3300031947 | Soil | QRVGRPTDAQAMLETLLGSGVSFTEKADAEKLLQELKRG |
| Ga0306926_100324191 | 3300031954 | Soil | LAAALYRAGRPADAEALLETLLGSGASFADKAAAETLLHELKPG |
| Ga0318569_101521971 | 3300032010 | Soil | GRPADAQAILETLLGSSVSFADRAEAEKLLHELKAG |
| Ga0318569_102390681 | 3300032010 | Soil | HLAVALTRLGRTGDAQARLEMLLGSGATFSDRAEAEKLLQQLKRG |
| Ga0318507_104077241 | 3300032025 | Soil | AVALQRVGRPADAQAMLETLLGSGVSFTDKDEAEKLLRELKHG |
| Ga0318549_102580082 | 3300032041 | Soil | PNIQYHLAAALHRVGRPADAQAMLETLLGSGVSFTDRAEAEKLLHELKPG |
| Ga0318549_104940452 | 3300032041 | Soil | YHLAVALNRIGRTGDAQAMLETLLGSGATFSDRAEAEKLLQQLKHG |
| Ga0318575_100702883 | 3300032055 | Soil | YHLAVALNRLGRTADAQAMLETLLGSGVTFSDRAEAEKLLQQLKQG |
| Ga0318533_102123671 | 3300032059 | Soil | IQYHLAVALNRLGRTADAQATLETLLGSGVAFSDRAEAEKLLQQLKRG |
| Ga0318533_102263602 | 3300032059 | Soil | IQYHLAVALQHLGRSADAQAMLEKLLGSGVSFTDRAEAERLLQDLKHS |
| Ga0318533_110157881 | 3300032059 | Soil | HHVGRAADARAMLETLLGSAGSFADRAEAEKLMQELKRG |
| Ga0318533_110783421 | 3300032059 | Soil | VALHRAGRQADAQAMLEKLLGSGISFSDKQQAEKLLAEMKHS |
| Ga0318504_103142061 | 3300032063 | Soil | QYHLAVALQRVGRPADGQAMLETLLGSGVSFANKTDAEKLLQDLKRG |
| Ga0318513_104542291 | 3300032065 | Soil | LAVALQRVGRTADAQVMLEALLSSGVSFPDKDAAEKLLQELKHG |
| Ga0318524_105249452 | 3300032067 | Soil | IQYHLAVALTRLGRTGDAQARLEMVLGSGATFSDRAEAEKLLQQLKRG |
| Ga0306924_101510393 | 3300032076 | Soil | YHLAVALHRIGRPADARAMLESLFRSGVSFADRAEAEKLLHELKPG |
| Ga0306924_108070932 | 3300032076 | Soil | QRVGRPADAQAMLETLLGSGVSFTDKDEAEKLLLELKHG |
| Ga0318518_100080918 | 3300032090 | Soil | IQYHLAVALHRVGRPADAQAMLETLLGSSVSFADRAEAEKLLHELKAG |
| Ga0318540_100867553 | 3300032094 | Soil | LQRVGRPADGQAMLETLLGSGVSFANKTDAEKLLQDLKRG |
| Ga0306920_1006043323 | 3300032261 | Soil | RPADAQAMLETLLGSGVSFTDKSEAEKLLQDLKRG |
| Ga0306920_1011668784 | 3300032261 | Soil | PDIQYHLAVALQRVGRTADAQVMLETLLGSGVSFPDKDEAEKLLRDLKHG |
| Ga0306920_1037076701 | 3300032261 | Soil | RLGRTGDAQARLEMLLGSGATFSDRAEAEKLLQQLKRG |
| Ga0306920_1044563992 | 3300032261 | Soil | VALNRLGRTADAQAKLETLLGSAMTFPDRAKAEKLLQQLKRR |
| Ga0310914_110633911 | 3300033289 | Soil | ALNRLGRTADAQATLVTLLGSGVTFSDRAEAEKLLLKLKRG |
| Ga0318519_102519852 | 3300033290 | Soil | VALNRLGRTADAQATLETLLGSGVTFSDRAEAEKLLQQLKQG |
| ⦗Top⦘ |