


| Basic Information | |
|---|---|
| Family ID | F041319 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MAKKSLKVDRNQFEGIVKNLLHSKPMKREDVKVSKRKPEKLIPPQK |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 55.62 % |
| % of genes near scaffold ends (potentially truncated) | 21.25 % |
| % of genes from short scaffolds (< 2000 bps) | 64.38 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (54.375 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland (15.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.750 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.27% β-sheet: 0.00% Coil/Unstructured: 79.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF12762 | DDE_Tnp_IS1595 | 20.62 |
| PF01925 | TauE | 1.25 |
| PF02371 | Transposase_20 | 1.25 |
| PF07884 | VKOR | 1.25 |
| PF03147 | FDX-ACB | 1.25 |
| PF01726 | LexA_DNA_bind | 1.25 |
| PF01527 | HTH_Tnp_1 | 1.25 |
| PF00072 | Response_reg | 0.62 |
| PF04255 | DUF433 | 0.62 |
| PF13426 | PAS_9 | 0.62 |
| PF04055 | Radical_SAM | 0.62 |
| PF13349 | DUF4097 | 0.62 |
| PF12680 | SnoaL_2 | 0.62 |
| PF00571 | CBS | 0.62 |
| PF05299 | Peptidase_M61 | 0.62 |
| PF11645 | PDDEXK_5 | 0.62 |
| PF13472 | Lipase_GDSL_2 | 0.62 |
| PF00155 | Aminotran_1_2 | 0.62 |
| PF07238 | PilZ | 0.62 |
| PF00266 | Aminotran_5 | 0.62 |
| PF13643 | DUF4145 | 0.62 |
| PF13588 | HSDR_N_2 | 0.62 |
| PF00589 | Phage_integrase | 0.62 |
| PF13414 | TPR_11 | 0.62 |
| PF03965 | Penicillinase_R | 0.62 |
| PF13304 | AAA_21 | 0.62 |
| PF07494 | Reg_prop | 0.62 |
| PF14329 | DUF4386 | 0.62 |
| PF10282 | Lactonase | 0.62 |
| PF06677 | Auto_anti-p27 | 0.62 |
| PF01916 | DS | 0.62 |
| PF01266 | DAO | 0.62 |
| PF00474 | SSF | 0.62 |
| PF04185 | Phosphoesterase | 0.62 |
| PF13453 | zf-TFIIB | 0.62 |
| PF00085 | Thioredoxin | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG0072 | Phenylalanyl-tRNA synthetase beta subunit | Translation, ribosomal structure and biogenesis [J] | 1.25 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 1.25 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.25 |
| COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 1.25 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.62 |
| COG1645 | Uncharacterized Zn-finger containing protein, UPF0148 family | General function prediction only [R] | 0.62 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.62 |
| COG1899 | Deoxyhypusine synthase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.62 |
| COG3292 | Periplasmic ligand-binding sensor domain | Signal transduction mechanisms [T] | 0.62 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.62 |
| COG3975 | Predicted metalloprotease, contains C-terminal PDZ domain | General function prediction only [R] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.38 % |
| Unclassified | root | N/A | 45.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10020774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4065 | Open in IMG/M |
| 3300001356|JGI12269J14319_10025240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4101 | Open in IMG/M |
| 3300001356|JGI12269J14319_10059540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2190 | Open in IMG/M |
| 3300001593|JGI12635J15846_10002627 | All Organisms → cellular organisms → Bacteria | 15715 | Open in IMG/M |
| 3300004092|Ga0062389_100081146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2775 | Open in IMG/M |
| 3300004152|Ga0062386_100088809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2366 | Open in IMG/M |
| 3300004152|Ga0062386_101037065 | Not Available | 680 | Open in IMG/M |
| 3300004631|Ga0058899_11047532 | Not Available | 535 | Open in IMG/M |
| 3300005178|Ga0066688_10051088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2391 | Open in IMG/M |
| 3300005181|Ga0066678_10158498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1421 | Open in IMG/M |
| 3300005445|Ga0070708_100324876 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300005454|Ga0066687_10530826 | Not Available | 697 | Open in IMG/M |
| 3300005467|Ga0070706_100313664 | Not Available | 1463 | Open in IMG/M |
| 3300005529|Ga0070741_10112203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2847 | Open in IMG/M |
| 3300005542|Ga0070732_10029727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3108 | Open in IMG/M |
| 3300005561|Ga0066699_11212656 | Not Available | 518 | Open in IMG/M |
| 3300005610|Ga0070763_10790405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300005614|Ga0068856_102087442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300006050|Ga0075028_100068975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1743 | Open in IMG/M |
| 3300006052|Ga0075029_100002972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9534 | Open in IMG/M |
| 3300006052|Ga0075029_100328594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300006059|Ga0075017_100047611 | Not Available | 2871 | Open in IMG/M |
| 3300006059|Ga0075017_100356953 | Not Available | 1089 | Open in IMG/M |
| 3300006102|Ga0075015_100019802 | Not Available | 2964 | Open in IMG/M |
| 3300006176|Ga0070765_100532597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1105 | Open in IMG/M |
| 3300006796|Ga0066665_11478089 | Not Available | 529 | Open in IMG/M |
| 3300006893|Ga0073928_10088628 | All Organisms → cellular organisms → Bacteria | 2629 | Open in IMG/M |
| 3300009012|Ga0066710_100036645 | All Organisms → cellular organisms → Bacteria | 5836 | Open in IMG/M |
| 3300009012|Ga0066710_100138106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3362 | Open in IMG/M |
| 3300009012|Ga0066710_100174792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3025 | Open in IMG/M |
| 3300009012|Ga0066710_100251611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2557 | Open in IMG/M |
| 3300009012|Ga0066710_100824562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1423 | Open in IMG/M |
| 3300009012|Ga0066710_101098511 | Not Available | 1230 | Open in IMG/M |
| 3300009089|Ga0099828_10073768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2896 | Open in IMG/M |
| 3300009137|Ga0066709_100190470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2681 | Open in IMG/M |
| 3300009137|Ga0066709_100277768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2261 | Open in IMG/M |
| 3300009137|Ga0066709_100280179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2252 | Open in IMG/M |
| 3300009137|Ga0066709_100913238 | Not Available | 1280 | Open in IMG/M |
| 3300009137|Ga0066709_102245602 | Not Available | 751 | Open in IMG/M |
| 3300009518|Ga0116128_1001878 | All Organisms → cellular organisms → Bacteria | 9008 | Open in IMG/M |
| 3300009519|Ga0116108_1158710 | Not Available | 670 | Open in IMG/M |
| 3300009524|Ga0116225_1197718 | Not Available | 909 | Open in IMG/M |
| 3300009624|Ga0116105_1008034 | All Organisms → cellular organisms → Bacteria | 2144 | Open in IMG/M |
| 3300009636|Ga0116112_1002518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10876 | Open in IMG/M |
| 3300009640|Ga0116126_1161476 | Not Available | 744 | Open in IMG/M |
| 3300009760|Ga0116131_1025974 | All Organisms → cellular organisms → Bacteria | 2063 | Open in IMG/M |
| 3300010339|Ga0074046_10010496 | All Organisms → cellular organisms → Bacteria | 6913 | Open in IMG/M |
| 3300010366|Ga0126379_12217902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 650 | Open in IMG/M |
| 3300010379|Ga0136449_101711946 | Not Available | 947 | Open in IMG/M |
| 3300010379|Ga0136449_102700346 | Not Available | 705 | Open in IMG/M |
| 3300010379|Ga0136449_103864017 | Not Available | 562 | Open in IMG/M |
| 3300011120|Ga0150983_13079961 | Not Available | 643 | Open in IMG/M |
| 3300011120|Ga0150983_13564330 | Not Available | 587 | Open in IMG/M |
| 3300011120|Ga0150983_16345030 | Not Available | 751 | Open in IMG/M |
| 3300011269|Ga0137392_11305316 | Not Available | 585 | Open in IMG/M |
| 3300011270|Ga0137391_10199539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1740 | Open in IMG/M |
| 3300012096|Ga0137389_10442039 | Not Available | 1113 | Open in IMG/M |
| 3300012189|Ga0137388_10022901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4734 | Open in IMG/M |
| 3300012189|Ga0137388_11162152 | Not Available | 709 | Open in IMG/M |
| 3300012189|Ga0137388_11553817 | Not Available | 598 | Open in IMG/M |
| 3300013307|Ga0157372_11627299 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300013772|Ga0120158_10054958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2709 | Open in IMG/M |
| 3300013832|Ga0120132_1122501 | Not Available | 558 | Open in IMG/M |
| 3300014164|Ga0181532_10004650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 11924 | Open in IMG/M |
| 3300014489|Ga0182018_10003305 | All Organisms → cellular organisms → Bacteria | 14689 | Open in IMG/M |
| 3300014489|Ga0182018_10027799 | All Organisms → cellular organisms → Bacteria | 3629 | Open in IMG/M |
| 3300014489|Ga0182018_10563588 | Not Available | 599 | Open in IMG/M |
| 3300014496|Ga0182011_10570372 | Not Available | 722 | Open in IMG/M |
| 3300014498|Ga0182019_11245252 | Not Available | 548 | Open in IMG/M |
| 3300014501|Ga0182024_10916230 | Not Available | 1055 | Open in IMG/M |
| 3300016702|Ga0181511_1003027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1207 | Open in IMG/M |
| 3300017823|Ga0187818_10012887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3580 | Open in IMG/M |
| 3300017925|Ga0187856_1011347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5078 | Open in IMG/M |
| 3300017938|Ga0187854_10006557 | All Organisms → cellular organisms → Bacteria | 8035 | Open in IMG/M |
| 3300017940|Ga0187853_10352798 | Not Available | 657 | Open in IMG/M |
| 3300017941|Ga0187850_10095874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1444 | Open in IMG/M |
| 3300017943|Ga0187819_10007567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6077 | Open in IMG/M |
| 3300017943|Ga0187819_10166157 | Not Available | 1310 | Open in IMG/M |
| 3300017943|Ga0187819_10422561 | Not Available | 765 | Open in IMG/M |
| 3300017946|Ga0187879_10112517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1555 | Open in IMG/M |
| 3300017955|Ga0187817_10630055 | Not Available | 684 | Open in IMG/M |
| 3300017972|Ga0187781_10002674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13489 | Open in IMG/M |
| 3300017972|Ga0187781_10135293 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
| 3300017972|Ga0187781_10169731 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
| 3300017972|Ga0187781_10240753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1280 | Open in IMG/M |
| 3300017972|Ga0187781_11264447 | Not Available | 544 | Open in IMG/M |
| 3300017975|Ga0187782_10034317 | All Organisms → cellular organisms → Bacteria | 3689 | Open in IMG/M |
| 3300017975|Ga0187782_10656988 | Not Available | 807 | Open in IMG/M |
| 3300018027|Ga0184605_10002062 | All Organisms → cellular organisms → Bacteria | 6675 | Open in IMG/M |
| 3300018044|Ga0187890_10830882 | Not Available | 522 | Open in IMG/M |
| 3300018062|Ga0187784_10007121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9043 | Open in IMG/M |
| 3300018062|Ga0187784_10059686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3090 | Open in IMG/M |
| 3300018062|Ga0187784_10495299 | Not Available | 985 | Open in IMG/M |
| 3300018062|Ga0187784_10770629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
| 3300018085|Ga0187772_10089911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1961 | Open in IMG/M |
| 3300018085|Ga0187772_10230414 | Not Available | 1253 | Open in IMG/M |
| 3300018085|Ga0187772_10231904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1249 | Open in IMG/M |
| 3300018086|Ga0187769_10009820 | All Organisms → cellular organisms → Bacteria | 6063 | Open in IMG/M |
| 3300018086|Ga0187769_11013903 | Not Available | 628 | Open in IMG/M |
| 3300018088|Ga0187771_10028316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4246 | Open in IMG/M |
| 3300018088|Ga0187771_10032478 | All Organisms → cellular organisms → Bacteria | 3981 | Open in IMG/M |
| 3300018088|Ga0187771_10131683 | All Organisms → cellular organisms → Bacteria | 2042 | Open in IMG/M |
| 3300018088|Ga0187771_10455963 | Not Available | 1080 | Open in IMG/M |
| 3300018088|Ga0187771_10590955 | Not Available | 941 | Open in IMG/M |
| 3300018088|Ga0187771_10827457 | Not Available | 785 | Open in IMG/M |
| 3300018090|Ga0187770_10529052 | Not Available | 934 | Open in IMG/M |
| 3300018090|Ga0187770_11691430 | Not Available | 517 | Open in IMG/M |
| 3300019258|Ga0181504_1085672 | Not Available | 507 | Open in IMG/M |
| 3300019887|Ga0193729_1085963 | Not Available | 1219 | Open in IMG/M |
| 3300019888|Ga0193751_1003099 | All Organisms → cellular organisms → Bacteria | 9868 | Open in IMG/M |
| 3300019890|Ga0193728_1373203 | Not Available | 502 | Open in IMG/M |
| 3300020581|Ga0210399_10099624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2376 | Open in IMG/M |
| 3300020582|Ga0210395_10369259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1079 | Open in IMG/M |
| 3300021168|Ga0210406_10029240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5003 | Open in IMG/M |
| 3300021178|Ga0210408_11380923 | Not Available | 531 | Open in IMG/M |
| 3300021420|Ga0210394_10401129 | Not Available | 1206 | Open in IMG/M |
| 3300021432|Ga0210384_11057870 | Not Available | 714 | Open in IMG/M |
| 3300021474|Ga0210390_10004820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11345 | Open in IMG/M |
| 3300021559|Ga0210409_11377109 | Not Available | 581 | Open in IMG/M |
| 3300022515|Ga0224546_1032857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300022521|Ga0224541_1003843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1592 | Open in IMG/M |
| 3300022557|Ga0212123_10299521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1125 | Open in IMG/M |
| 3300024295|Ga0224556_1168860 | Not Available | 535 | Open in IMG/M |
| 3300027559|Ga0209222_1045799 | Not Available | 843 | Open in IMG/M |
| 3300027641|Ga0208827_1020492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2444 | Open in IMG/M |
| 3300027645|Ga0209117_1163127 | Not Available | 577 | Open in IMG/M |
| 3300027696|Ga0208696_1149955 | Not Available | 755 | Open in IMG/M |
| 3300027696|Ga0208696_1189269 | Not Available | 655 | Open in IMG/M |
| 3300027842|Ga0209580_10000623 | All Organisms → cellular organisms → Bacteria | 18222 | Open in IMG/M |
| 3300027842|Ga0209580_10117761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1294 | Open in IMG/M |
| 3300027894|Ga0209068_10013376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3930 | Open in IMG/M |
| 3300027898|Ga0209067_10014095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4163 | Open in IMG/M |
| 3300027905|Ga0209415_10385105 | Not Available | 1143 | Open in IMG/M |
| 3300027911|Ga0209698_10151373 | Not Available | 1903 | Open in IMG/M |
| 3300027911|Ga0209698_10218912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1532 | Open in IMG/M |
| 3300028560|Ga0302144_10111137 | Not Available | 883 | Open in IMG/M |
| 3300028792|Ga0307504_10004811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2768 | Open in IMG/M |
| 3300028792|Ga0307504_10066471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300028792|Ga0307504_10286300 | Not Available | 615 | Open in IMG/M |
| 3300028866|Ga0302278_10240755 | Not Available | 871 | Open in IMG/M |
| 3300029915|Ga0311358_11000474 | Not Available | 575 | Open in IMG/M |
| 3300029943|Ga0311340_11575469 | Not Available | 511 | Open in IMG/M |
| 3300029945|Ga0311330_10102276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2865 | Open in IMG/M |
| 3300030054|Ga0302182_10122370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1135 | Open in IMG/M |
| 3300030399|Ga0311353_10594642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
| 3300030606|Ga0299906_10720570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300030706|Ga0310039_10289491 | Not Available | 623 | Open in IMG/M |
| 3300031090|Ga0265760_10158393 | Not Available | 746 | Open in IMG/M |
| 3300031231|Ga0170824_123265252 | Not Available | 1320 | Open in IMG/M |
| 3300031708|Ga0310686_104748036 | All Organisms → cellular organisms → Bacteria | 2874 | Open in IMG/M |
| 3300031715|Ga0307476_10506485 | Not Available | 894 | Open in IMG/M |
| 3300031715|Ga0307476_11371927 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031718|Ga0307474_10191140 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300031820|Ga0307473_11453970 | Not Available | 518 | Open in IMG/M |
| 3300032160|Ga0311301_10428003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2008 | Open in IMG/M |
| 3300032160|Ga0311301_10681518 | Not Available | 1452 | Open in IMG/M |
| 3300032160|Ga0311301_12050486 | Not Available | 665 | Open in IMG/M |
| 3300032783|Ga0335079_10009765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 10931 | Open in IMG/M |
| 3300032895|Ga0335074_11277285 | Not Available | 609 | Open in IMG/M |
| 3300033402|Ga0326728_10528703 | Not Available | 947 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 15.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.62% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.12% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.75% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.50% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.50% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.88% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.88% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.88% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.88% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.25% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.25% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.25% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.25% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.25% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.25% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.62% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.62% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.62% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.62% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
| 3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100207744 | 3300000567 | Peatlands Soil | VGKKSLKVDRTKFEGIVKNLLNTAPVKRENVKVKNPKNREKLIPPSEQPK* |
| JGI12269J14319_100252404 | 3300001356 | Peatlands Soil | AVGKKSLKVDRTKFEGIVKNLLNTAPVKRENVKVKNPKNREKLIPPSEQPK* |
| JGI12269J14319_100595403 | 3300001356 | Peatlands Soil | MTKGLKVDRKQFEGIVKNLIHSAPVKREDVKVSKKKPAKLIPPQK* |
| JGI12635J15846_100026275 | 3300001593 | Forest Soil | MPKKSLKVDRDQFEGIVKTLLATKPVKREDVKVSKKKPGKLIPPQKPEKR* |
| Ga0062389_1000811463 | 3300004092 | Bog Forest Soil | MPKSLKVDRKKFEGIVKNLLQGKPLKRAKVKVSKRKPEKLFPPQGK* |
| Ga0062386_1000888093 | 3300004152 | Bog Forest Soil | MAKKSLKVDRNQFEGIVKNLLHSKPMKREDVKVSKRKPEKLIPPQK* |
| Ga0062386_1010370652 | 3300004152 | Bog Forest Soil | VQTVQKKSLKVDRQKFEGIVKNLLQSKPMKRDDVKVSKRKPEKLIPPQK* |
| Ga0058899_110475322 | 3300004631 | Forest Soil | MVLAREKKSLKVDRDKFEGLVKRLLHSEPLKREDVKVSKKKPEKLIPQTTPQE* |
| Ga0066688_100510883 | 3300005178 | Soil | MVHVAKKSLKVDREKFEGIVKNLLHTKPVKREDVKIKNPKNRKKLIPPQK* |
| Ga0066678_101584984 | 3300005181 | Soil | MAKKSLKVDRAKFEGIVKRLLHAAPVKREDVKIKNRKNREK |
| Ga0070708_1003248763 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKKKSLKVDRGKFEGIVKNLLHTKPVKREDVKIKNRKNREKLIPPQK* |
| Ga0066687_105308262 | 3300005454 | Soil | MAKKSLKVDRAKFEGIVKRLLHAAPVKREDVKIKNRKNREKLIPPQK* |
| Ga0070706_1003136643 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKKSLKVDRAKFEGIVRNLLHTKPVKRDVKIKNRKNREKLIPPQK* |
| Ga0070741_101122034 | 3300005529 | Surface Soil | MAKQKKKLVVDRKQFEGIVKNLIHGTPMKRDEIKPAKKKPAKLIPPQK* |
| Ga0070732_100297275 | 3300005542 | Surface Soil | LKSGTESVMAKKSLKVNRKQFEGIVKNLLHSKPLQREKVKVAKKKPAKLIPPQK* |
| Ga0066699_112126562 | 3300005561 | Soil | MPKKSLKVDREKFEGIVQRLLHTKPVKREDVKIKNRKNREKLI |
| Ga0070763_107904051 | 3300005610 | Soil | VDRDKFENLVKRLIHSDPVKREDVKVSKKKPDKVIPPQK* |
| Ga0068856_1020874422 | 3300005614 | Corn Rhizosphere | MTDKRELKVDRKKFEGIVRNLLKTTPVKRDDVKPDKKKPEKLIPPQEDARKR* |
| Ga0075028_1000689751 | 3300006050 | Watersheds | VAKKSLKVDRKKFEGIVQRLLDTKPVKREDVKVSKRKPEKLIPPQ |
| Ga0075029_1000029729 | 3300006052 | Watersheds | MVKKTLKVDRDKFEGIVRNLLRSDPIKRDDVKVSKKKPEKLIPPQK* |
| Ga0075029_1003285942 | 3300006052 | Watersheds | MPKKSLKVDRTQFEGIVKNLLAAKPVKREDVKVSKKKPEKIIPPQK* |
| Ga0075017_1000476111 | 3300006059 | Watersheds | VHVLRVSGKVHRKQFLEIVKNLLHSKPEKREDMKISKKKPEKLIPPQK* |
| Ga0075017_1003569532 | 3300006059 | Watersheds | MARKSLKVDRKKFEGIVQNLLNTKPVKREDVKVSKRKPEKLIPPQK* |
| Ga0075015_1000198024 | 3300006102 | Watersheds | LRVSGKVHRKQFLEIVKNLLHSKPEKREDMKISKKKPEKLIPPQK* |
| Ga0070765_1005325972 | 3300006176 | Soil | MAKSLKVDRKKFEGIVQNLLNSKPLKRSKVKVSKRKPEKLIPPHK* |
| Ga0066665_114780892 | 3300006796 | Soil | MPKKSLKVDREKFEGIVKNLLHTKPVKREDVKVKNPKNRKKLI |
| Ga0073928_100886284 | 3300006893 | Iron-Sulfur Acid Spring | MGKKSLKVDRDQFEGLVKRLLHSEPVKREDVKVSKKKPEKLIPPQK* |
| Ga0066710_1000366452 | 3300009012 | Grasslands Soil | MAKKSLKVDRAKFEGIVKRLLHAAPVKREDVKIKNRKNREKLIPPQK |
| Ga0066710_1001381064 | 3300009012 | Grasslands Soil | VRKKKELKVDRAKFEGIVQSLLKADPVKREDVKVGKKKPAKLIPPTEQK |
| Ga0066710_1001747923 | 3300009012 | Grasslands Soil | MAKKSLKVDREKFEGIVKNLLHTKPLKREDVKIKNRKNREKLIPPQK |
| Ga0066710_1002516113 | 3300009012 | Grasslands Soil | MVHVAKKSLKVDREKFEGIVKNLLHTKPVKREDVKIKNPKNRKKLIPPQK |
| Ga0066710_1008245623 | 3300009012 | Grasslands Soil | VKIVNKKESKKLLVDRKQFEGIVRNLINTKPVKREDVKVGKKKPGKLIPPQK |
| Ga0066710_1010985113 | 3300009012 | Grasslands Soil | MPKKSLKVDREKFEGIVKNLLHTKPVKREDVKVKNPKNRKKLIPPQAK |
| Ga0099828_100737684 | 3300009089 | Vadose Zone Soil | MTKKTLKVDRQQFEGIVKSMLRSKPVKRDKVKISKKKPTQLIPPQK* |
| Ga0066709_1001904706 | 3300009137 | Grasslands Soil | MPKKSLKVDREKFEGIVKNLLHTKPVKREDVKVKNPKNRKKLIPPQAK* |
| Ga0066709_1002777683 | 3300009137 | Grasslands Soil | MVHVAKKSLKVDREKFEGIVKNLLHTKPVKRKDVKIKNPKNLKKLIPPQK* |
| Ga0066709_1002801794 | 3300009137 | Grasslands Soil | MAKKSLKVDREKFEGIVKNLLHTKPLKREDVKIKNRKNREKLIPPQK* |
| Ga0066709_1009132382 | 3300009137 | Grasslands Soil | MPRKKLLVDRKQFEGIVRNLINTKPVKREDVKVGKKKPAKLIPPLK* |
| Ga0066709_1022456022 | 3300009137 | Grasslands Soil | VKIVNKKESKKLLVDRKQFEGIVRNLINTKPVKREDVKVGKKKPGKLIPPQK* |
| Ga0116128_10018786 | 3300009518 | Peatland | VQKKSLKVDRDHFEGIVKNLLHSKPLKRKDVKVSKRKPEKLIPPQK* |
| Ga0116108_11587101 | 3300009519 | Peatland | VQKKSLKVDRDHFEGIVKNLLHSKPLKRKDVKVSKRKPEK |
| Ga0116225_11977181 | 3300009524 | Peatlands Soil | MKKQSKSLKVDRKQFEGIVKNLIHSAPVKREDVKVSKKKPAKLIPPQN* |
| Ga0116105_10080342 | 3300009624 | Peatland | LGGINGKKKLLVDRKKFEGIVKQMLETDPLKREDVKVSKKKPQKLIPPQK* |
| Ga0116112_10025189 | 3300009636 | Peatland | MPKKSLKVDRHQFEGIVKNLLHSKPLKREDVKISKKKPEKLIPPR* |
| Ga0116126_11614762 | 3300009640 | Peatland | MSAKNLKVDRDKFEGIVKNLLESKPLKRSKVKVSKRKPEKLFPPQK* |
| Ga0116131_10259741 | 3300009760 | Peatland | STIFSAILWKGVQTVQKKSLKVDRDHFEGIVKNLLHSKPLKRKDVKVSKRKPEKLIPPQK |
| Ga0074046_100104964 | 3300010339 | Bog Forest Soil | MGRKSLKVDRAQFEGIVKNLLRSKPLKREDVKVSKRKPEKLIPPQK* |
| Ga0126379_122179021 | 3300010366 | Tropical Forest Soil | DREKFEGIVKRLLQSDPLKREDVKVSKKKPEKLIPPQK* |
| Ga0136449_1017119462 | 3300010379 | Peatlands Soil | MVRKSLKVDRKQFEGIVKNLIHSAPVKREDVKVSKKKPAKLIPPQK* |
| Ga0136449_1027003462 | 3300010379 | Peatlands Soil | MAKKSLKVDRAQFEGIVKSLIHSAPVKREDVKVSKKKPHKVIPPQEN* |
| Ga0136449_1038640171 | 3300010379 | Peatlands Soil | KDLSMAAKSLKVDRKQFEGIVKNLINSAPMKREDVKVSKKKPANVIPPQS* |
| Ga0150983_130799612 | 3300011120 | Forest Soil | LTTTKKSLKVDREKFEGLVKRLLHSEPLQREDVKVSKKKPEKLIPPQK* |
| Ga0150983_135643301 | 3300011120 | Forest Soil | LKVDRAQFEGFVKSLINSAPLKREDVKVSKKKPEKLIPPQK* |
| Ga0150983_163450302 | 3300011120 | Forest Soil | MTKKSLKVDRKKFEGIVQNLLQTPHLKREDVKVSKKKPEKLIPPQK* |
| Ga0137392_113053162 | 3300011269 | Vadose Zone Soil | VAKKSLKVDRKKFEGIVKNLLDTKPVKRENVKIKNPKNRERLIPPQK* |
| Ga0137391_101995393 | 3300011270 | Vadose Zone Soil | MAKKSLKVDREKFEGIVQRLLQSKPVKREDVKVKNRKNREKLIPPQK* |
| Ga0137389_104420393 | 3300012096 | Vadose Zone Soil | VAKKSLKVDRKKFEGIVKNLLDTKPVKREDVKIKNRKNREQLIPPQK* |
| Ga0137388_100229016 | 3300012189 | Vadose Zone Soil | VQKTLKVDRRKFEGIVQNLLHSKPIKREKVKIAKKKPAKLIPPQK* |
| Ga0137388_111621521 | 3300012189 | Vadose Zone Soil | VAKKSLKVDRKKFEGIVKNLLDTKPVKREDVKIKNRKNREQLIP |
| Ga0137388_115538171 | 3300012189 | Vadose Zone Soil | SLKVDRKKFEGIVKNLLDTKPVKREDVKIKNRKNREQLIPPQK* |
| Ga0157372_116272991 | 3300013307 | Corn Rhizosphere | MVTKSLKVDRKKFEGIVQNLLNAKPVKREKVKVSKKKPAKLIPPQSDNRR* |
| Ga0120158_100549582 | 3300013772 | Permafrost | MAEKTLKVDRKRFEGIVQNLLQTKPMKRDKVKVAKKKPAKLIPPQK* |
| Ga0120132_11225011 | 3300013832 | Permafrost | VAEKTLKVDRKRFEGIVQNLLQTKPMKRDKVKVAKKKPAKLIPPQS* |
| Ga0181532_100046507 | 3300014164 | Bog | MPKKKLLVDRAQFEGIVKNLLHSKPLKREDVKVSKKKPEKLIPPQK* |
| Ga0182018_100033055 | 3300014489 | Palsa | MPKKSLKVDRDQFEGIVKNLLATKPVKREDVKISKKKPGKLIPPQKPEIAQ* |
| Ga0182018_100277993 | 3300014489 | Palsa | MPKKSLKVDRDQFEGIVKNLLATKPVKREDVKISKKKPGKLIPPQSEPR* |
| Ga0182018_105635882 | 3300014489 | Palsa | MAKKSLKVDREKFEGIVKNLLWAKPVKRQDVKVSKKKPEKLIPPQK* |
| Ga0182011_105703722 | 3300014496 | Fen | LWKAVHTVKKKPLIVDREQLERIAKNLLQSKPLKREDVKVSKRKPEKLSPPQK* |
| Ga0182019_112452522 | 3300014498 | Fen | MTEKTLKVDRDKFEGIVRRLLDTEPVKRDDVKTAKKKPGKLIPPPK* |
| Ga0182024_109162302 | 3300014501 | Permafrost | MAKKSLKVDRKNFEGIVQNLLQAKPLKRDKVKVAKKKPEKLFPPQK* |
| Ga0181511_10030271 | 3300016702 | Peatland | MPKKKLLVDRAQFEGIVKNLLHSKPLKREDVKVSKKKPEKLIPPQK |
| Ga0187818_100128874 | 3300017823 | Freshwater Sediment | MARKSLKVDRQQFEGIVKRLLQSKPLKREDVKVKNPKNREKLIPPQKSEMK |
| Ga0187856_10113476 | 3300017925 | Peatland | VQKKSLKVDRDHFEGIVKNLLHSKPLKRKDVKVSKRKPEKLIPPQK |
| Ga0187854_100065575 | 3300017938 | Peatland | VQTVQKKSLKVDRDHFEGIVKNLLHSKPLKRKDVKVSKRKPEKLIPPQK |
| Ga0187853_103527981 | 3300017940 | Peatland | MPKKSLKVDRHQFEGIVKNLLHSKPLKREDVKISKKKPEKLIPP |
| Ga0187850_100958744 | 3300017941 | Peatland | MPKKSLKVDRHQFEGIVKNLLHSKPLKREDVKISKKKPEKLIPPR |
| Ga0187819_100075675 | 3300017943 | Freshwater Sediment | MTVQKKTLKVDRKQFEGIVKNLLQSPHVKREDVRVSKKKPGKLIQKNPSAT |
| Ga0187819_101661572 | 3300017943 | Freshwater Sediment | MSSESMSAEMAKKSLKVDRKWFEGIVQNLLHTKPLKRSKVKVSKRKPEKLFPPQK |
| Ga0187819_104225612 | 3300017943 | Freshwater Sediment | MPKKSLKIDRAKFEGIVKRLLASAPVKREDVKVSKRKPERLIPPQK |
| Ga0187879_101125172 | 3300017946 | Peatland | LTQQTVDRVQFERIARNLLATKPLKRDDVKVSNKKPEKLIPLQK |
| Ga0187817_106300552 | 3300017955 | Freshwater Sediment | MSSESMSAEMAKKSLKVDRKRFEGIVQNLLHTKPLKRSKVKVSKRKPEKLFPPQK |
| Ga0187781_100026748 | 3300017972 | Tropical Peatland | MPKKSLKVDRQKFQGIVKRLLETPHTKREDVKLDKKKPEKLILPQK |
| Ga0187781_101352931 | 3300017972 | Tropical Peatland | MSVEAVKKKALKVDRAKFEGIVKSLLKADPMKREDVEPAKKKPEKLIPPQK |
| Ga0187781_101697311 | 3300017972 | Tropical Peatland | MPKKKSLKVDRNQFEKIVKRMVTTPPLKRDDVKVENPKNREQLIPPQK |
| Ga0187781_102407533 | 3300017972 | Tropical Peatland | VETVKKTDLKVDRQKFEGIVKSLLDSPPVKRDDVKVEKKKPGKLIPSQK |
| Ga0187781_112644471 | 3300017972 | Tropical Peatland | VENMAKKSLKVDRDKFEGIVKNLLGTKPVKREDVKLDKKKPEKLIPPQK |
| Ga0187782_100343173 | 3300017975 | Tropical Peatland | MPKKSLKVDRQKFQGIVKRLLETPHTKREDVKLDKKKPEKLIPPQK |
| Ga0187782_106569882 | 3300017975 | Tropical Peatland | MAKKSLKVNREKFEGIVKNLLNTKPVKRENVKIKNPKNREKLIPPSPQPN |
| Ga0184605_100020628 | 3300018027 | Groundwater Sediment | MPKKSLKVDREKFEGIVRTLLHSKPVKREDVKIKNRKNREKLIPPQK |
| Ga0187890_108308822 | 3300018044 | Peatland | MPKKSLKVDRDQFEGIVKNLLATKPVKREDVKVSKKKPGKLIPPQ |
| Ga0187784_1000712110 | 3300018062 | Tropical Peatland | MPKKSLKVDRQKFEGIVKRLLETPHTKREDVKLDKKKPEKLIPPQK |
| Ga0187784_100596865 | 3300018062 | Tropical Peatland | MPKKSLKVDRQKFEGIVKSLLNSPHVKRDDVKVEKKKPGKLIPSQK |
| Ga0187784_104952992 | 3300018062 | Tropical Peatland | VKKKTLQVDRAKFEGFVKNLLTTPHVKREDVKVEKKKPEKVIPPQR |
| Ga0187784_107706292 | 3300018062 | Tropical Peatland | MSVEAVKKKALKVDRAKFEGIVKSLLKADPMKREDVEPAKKKPEN |
| Ga0187772_100899114 | 3300018085 | Tropical Peatland | RDMPKKKSLKVDRKQFEGIVKNLLATKPLKREKIKVAKCKPEKLFPPQK |
| Ga0187772_102304141 | 3300018085 | Tropical Peatland | MPKKSLKVDRQKFEGIVKSLLNSPHVKRDDVKVGKKKPGKLIQPSGQR |
| Ga0187772_102319041 | 3300018085 | Tropical Peatland | MPKKSLKVDRAKFEGIVKRLLHANPVKRNDVRVKNPKNREKLIPPPREHS |
| Ga0187769_100098205 | 3300018086 | Tropical Peatland | MPQKKSLKVDRAKFEGIVKRLLHANPVKRNDVRVKNPKNREKLIPPPREHS |
| Ga0187769_110139031 | 3300018086 | Tropical Peatland | MPKKSLKVDRAKFEGIVKRLLHANPVKREDVRVKNPKNRERLIPPPRENS |
| Ga0187771_100283161 | 3300018088 | Tropical Peatland | MARKVLKVDRAKFEGIVKSLLNSPHTKREDVKVEKKKPERLIPPQK |
| Ga0187771_100324785 | 3300018088 | Tropical Peatland | MAKKSLKVDRAQFEGIVKRMIQTEPVKREDVKVSKKKPEKIIPPQK |
| Ga0187771_101316834 | 3300018088 | Tropical Peatland | VAKKTLNVDRAKFEGIVKSLLNTPHVKREDVKVEKKKPGKLITPQVNEKT |
| Ga0187771_104559632 | 3300018088 | Tropical Peatland | MPKKSLKVDRAKFEGIVKNLLTTPHVKREDVKVEKKKPEKVIPPQK |
| Ga0187771_105909552 | 3300018088 | Tropical Peatland | MPKKSLKVDRKKFEGIVRNLLNTPHVKREDVKVAKRKPEKLIPPQK |
| Ga0187771_108274572 | 3300018088 | Tropical Peatland | MPKKSLKVDREKFEGIVKRLLETKPTKREDVRLDKKKPEKLIPPANSDKQE |
| Ga0187770_105290522 | 3300018090 | Tropical Peatland | MTKKTLKVDRAKFEGIVKNLLTAPHVKRQDVKVEKKKPEKVIPPQK |
| Ga0187770_116914301 | 3300018090 | Tropical Peatland | VKAVSKKSLKVDRAQFEGIVRNLLQSKPVKREDVKIKNPKNREKLIPPQK |
| Ga0181504_10856722 | 3300019258 | Peatland | VKNTVTRPESLQVDREKFEGIVKNLLDTKPLKRSKVKIAKRKPEKLIPPQK |
| Ga0193729_10859632 | 3300019887 | Soil | MPKKSLKVDRKKFEGIVKNLLQTKHVKRENVKIKNPKNREQLIPPQK |
| Ga0193751_10030995 | 3300019888 | Soil | VPEKSLKVDRKKFEGIVKNLLDSPPTKREDVKVSKKKPEKLIPPQK |
| Ga0193728_13732031 | 3300019890 | Soil | KSLKVDRKQFEGIVKNLLDSKPMKREKVKVSKKKPHKLIPPQK |
| Ga0210399_100996243 | 3300020581 | Soil | MTKKSLKVDRKKFEGIVQNLLQTPHLKREDVKVSKKKPEKLIPPQK |
| Ga0210395_103692593 | 3300020582 | Soil | VGVEPTKPCEGGLTTIKRSLKVDRDKFENLVKRLIHSDPVKREDVKVSKKKPDKVIPPQK |
| Ga0210406_100292404 | 3300021168 | Soil | MAKKSLKVDRKQFEGIVQNLLNAKPMKREKVKVAKKKPHKLIPPQGS |
| Ga0210408_113809231 | 3300021178 | Soil | VAGKSLKVDRNKFEGIVRNLLQSKPVKRENVKVSKRKPEKL |
| Ga0210394_104011292 | 3300021420 | Soil | LAKKSLKVDREKFEGIVKNLLHAKPVKREDVKVSKQKPEKLIPPQK |
| Ga0210384_110578702 | 3300021432 | Soil | MAKKSLKVDRKKFEGIVQNLLQSKPVKRENVKVKNPKNREKLIPPQK |
| Ga0210390_1000482011 | 3300021474 | Soil | LAKKSLKVDREKFEGIVKNLLHAKPVKREDVKVSKKKPEKLIPPRNSEAD |
| Ga0210409_113771092 | 3300021559 | Soil | DRVTFEGLVNRLLHTKPVKREDVKVSKKKPEKIIPAQSPER |
| Ga0224546_10328571 | 3300022515 | Soil | MQKKSLKVDRDQFEGIVKNLLATKPVKREDVKISKKKPGKLIPPQKPEIAQ |
| Ga0224541_10038433 | 3300022521 | Soil | MPKKSLKVDRDQFEGIVKNLLATKPVKREDVKISKKKPGKLIPPQKPEIAQ |
| Ga0212123_102995212 | 3300022557 | Iron-Sulfur Acid Spring | VSKSLTVDRKKFEGIVKNLLHSKPLKREDVKVSKKKPQKLIPPQK |
| Ga0224556_11688602 | 3300024295 | Soil | KTLTVDRNRFEGIVKNLLDSPPLKRAKVKTAKKKPEKLFPPEK |
| Ga0209222_10457992 | 3300027559 | Forest Soil | MPKKSLKVDRDQFEGIVKTLLATKPVKREDVKVSKKKPGKLIPPQKPEKR |
| Ga0208827_10204924 | 3300027641 | Peatlands Soil | MTKGLKVDRKQFEGIVKNLIHSAPVKREDVKVSKKKPAKLIPPQK |
| Ga0209117_11631272 | 3300027645 | Forest Soil | MARKSLKVDRKKFEGIVQNLLHSKPVKREDAKVSKRKPEKLIPPQR |
| Ga0208696_11499552 | 3300027696 | Peatlands Soil | VGKKSLKVDRTKFEGIVKNLLNTAPVKRENVKVKNPKNREKLIPPSEQPK |
| Ga0208696_11892691 | 3300027696 | Peatlands Soil | MTKGLKVDRKQFEGIVKNLIHSAPVKREDVKVSKKKPAKLIP |
| Ga0209580_1000062321 | 3300027842 | Surface Soil | MAKKSLKVNRKQFEGIVKNLLHSKPLQREKVKVAKKKPAK |
| Ga0209580_101177611 | 3300027842 | Surface Soil | MVSKKSLKVDRKQFEGIVQNLINTAPLKRDKVKPAKKKPAKLIPPQK |
| Ga0209068_100133764 | 3300027894 | Watersheds | VAKKSLKVDRKKFEGIVQRLLDTKPVKREDVKVSKRKPEKLIPPQK |
| Ga0209067_100140955 | 3300027898 | Watersheds | MVKKTLKVDRDKFEGIVRNLLRSDPIKRDDVKVSKKKPEKLIPPQK |
| Ga0209415_103851052 | 3300027905 | Peatlands Soil | MAKKSLKVDRKQFEGIVKNLIHSAPVKREDVKVSKKKPAKLIPPQN |
| Ga0209698_101513733 | 3300027911 | Watersheds | LRVSGKVHRKQFLEIVKNLLHSKPEKREDMKISKKKPEKLIPPQK |
| Ga0209698_102189123 | 3300027911 | Watersheds | MPKKSLKVDRTQFEGIVKNLLAAKPVKREDVKVSKKKPEKIIPPQK |
| Ga0302144_101111372 | 3300028560 | Bog | MPKKTLTVDRNRFEGIVKNLLDSPPLKRAKVKTAKKKPEKLFPPEK |
| Ga0307504_100048113 | 3300028792 | Soil | MGRKSLKVDRRKFEGIVQSLLQSAPVKRDQVKVAKKKPAKLIPPSR |
| Ga0307504_100664711 | 3300028792 | Soil | MKTAVRVDRWKFEGVVKNLLHYKPVKREDAKVSKKKPE |
| Ga0307504_102863001 | 3300028792 | Soil | LVDRQKFEGIVQNLLQSKPMKRAKVKIAKKKPAKLIPTQK |
| Ga0302278_102407553 | 3300028866 | Bog | VDRNRFEGIVKNLLDSPPLKRAKVKTAKKKPEKLFPPEK |
| Ga0311358_110004743 | 3300029915 | Bog | MPKKTLTVDRNRFEGIVKNLLDSPPLKRAKVKTAKNKPEKLFP |
| Ga0311340_115754693 | 3300029943 | Palsa | MPKKSLKVDRDQFEGIVKNLLATKPVKREDVKISKKKPGKLI |
| Ga0311330_101022765 | 3300029945 | Bog | KKTLTVDRNRFEGIVKNLLDSPPLKRAKVKTAKKKPEKLFPPEK |
| Ga0302182_101223704 | 3300030054 | Palsa | RRNCSKLDCEKSMPKKSLKVDRDQFEGIVKNLLATKPVKREDVKISKKKPGKLIPPQKPEIAQ |
| Ga0311353_105946424 | 3300030399 | Palsa | KSMPKKSLKVDRDQFEGIVKNLLATKPVKREDVKISKKKPGKLIPPQKPEIAQ |
| Ga0299906_107205703 | 3300030606 | Soil | MDVEKRMAKKSLKVDRKQFEGIVKTLLHSKPVKREDVKVGRKKPQKLIPPQK |
| Ga0310039_102894913 | 3300030706 | Peatlands Soil | VGKKSLKVDRTKFEGIVKNLLNTAPVKRENVKVKNPKNREK |
| Ga0265760_101583931 | 3300031090 | Soil | MAKTLKVDREKFEGIVKNLLQGKPLKRAKVKVSKRKPKKLFPPRENG |
| Ga0170824_1232652522 | 3300031231 | Forest Soil | HVLRASGKVDREQVEGIAKNLLHSKPMKREDVKVSKRKPEKLIPPQK |
| Ga0310686_1047480362 | 3300031708 | Soil | VDRDKFENLVKRLIHSDPVKREDVKVSKKKPDKVIPPQK |
| Ga0307476_105064852 | 3300031715 | Hardwood Forest Soil | VKKTLKVNRDQFEGIVKNLLGSKPMKREDVRVKNPKNRKKLIPPKRADISASE |
| Ga0307476_113719272 | 3300031715 | Hardwood Forest Soil | VPRKSLKVDRKKFEGLVQNLLHSKPVKREKVKIAKRKPEKLIPPPK |
| Ga0307474_101911402 | 3300031718 | Hardwood Forest Soil | VPRKSLKVDRKKFEGLVQNLLHSKPVKREKVKIAKRKPEKLIPPRK |
| Ga0307473_114539701 | 3300031820 | Hardwood Forest Soil | VEIRGVVPKKELKVDRMKFEGIVKNLLQSRPMKREDVKVSKKKPEKLIPPQK |
| Ga0311301_104280033 | 3300032160 | Peatlands Soil | MKKQSKSLKVDRKQFEGIVKNLIHSAPVKREDVKVSKKKPAKLIPPQN |
| Ga0311301_106815181 | 3300032160 | Peatlands Soil | MVRKSLKVDRKQFEGIVKNLIHSAPVKREDVKVSKKKPAKLIPPQK |
| Ga0311301_120504862 | 3300032160 | Peatlands Soil | MAKKSLKVDRAQFEGIVKSLIHSAPVKREDVKVSKKKPHKVIPPQEN |
| Ga0335079_1000976514 | 3300032783 | Soil | MPKKSLKVDRKKFEGIVRNLLQAKPVKREDVKVSKRKPEKLIPPQS |
| Ga0335074_112772851 | 3300032895 | Soil | MKKTLIVDRKKFEGIVKNLLQSKPVKRDDVKPAKKKPHKVIPPEK |
| Ga0326728_105287032 | 3300033402 | Peat Soil | MSKKSLKVDRKQFEGIVKNLIHSAPVKREDVKVSKKKPQKLIPPQK |
| ⦗Top⦘ |