


| Basic Information | |
|---|---|
| Family ID | F041290 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNK |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.38 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.62 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.750 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.750 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.375 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.94% β-sheet: 0.00% Coil/Unstructured: 47.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF01478 | Peptidase_A24 | 94.38 |
| PF04964 | Flp_Fap | 2.50 |
| PF01642 | MM_CoA_mutase | 0.62 |
| PF01584 | CheW | 0.62 |
| PF02954 | HTH_8 | 0.62 |
| PF04140 | ICMT | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 2.50 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_13367994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104396131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300000789|JGI1027J11758_11180676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300001431|F14TB_105378213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300002075|JGI24738J21930_10148839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300004157|Ga0062590_100535959 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300004798|Ga0058859_11826293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
| 3300005186|Ga0066676_11037608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300005289|Ga0065704_10137398 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300005336|Ga0070680_101135435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300005344|Ga0070661_100827554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300005364|Ga0070673_101976552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300005440|Ga0070705_100884848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300005444|Ga0070694_100316697 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300005457|Ga0070662_100693967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300005457|Ga0070662_101322146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300005471|Ga0070698_101406802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300005545|Ga0070695_100623764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300005545|Ga0070695_101731308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300005564|Ga0070664_100572764 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300005578|Ga0068854_100588016 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300005719|Ga0068861_100255208 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
| 3300005842|Ga0068858_102521513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300005842|Ga0068858_102563658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300006046|Ga0066652_101773811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300006196|Ga0075422_10622001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300006847|Ga0075431_100240509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → Marinobacter lipolyticus | 1842 | Open in IMG/M |
| 3300006854|Ga0075425_100673342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1189 | Open in IMG/M |
| 3300006881|Ga0068865_101069037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300006954|Ga0079219_10576765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300006954|Ga0079219_11138872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300007004|Ga0079218_12135770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300009101|Ga0105247_10640850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300009156|Ga0111538_10976977 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300009162|Ga0075423_11429992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300009162|Ga0075423_11663084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300009174|Ga0105241_10687062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300009174|Ga0105241_10778655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300009177|Ga0105248_10507898 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300009177|Ga0105248_11595388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300009545|Ga0105237_12490551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300009553|Ga0105249_11939801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300009610|Ga0105340_1241369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
| 3300009789|Ga0126307_11357096 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 576 | Open in IMG/M |
| 3300009840|Ga0126313_10747636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300010043|Ga0126380_11968925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300010044|Ga0126310_10441612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300010044|Ga0126310_11340602 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300010047|Ga0126382_10383211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1090 | Open in IMG/M |
| 3300010146|Ga0126320_1012517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300010147|Ga0126319_1652792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300010166|Ga0126306_11098178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300010396|Ga0134126_13054176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300010400|Ga0134122_10071878 | All Organisms → cellular organisms → Bacteria | 2690 | Open in IMG/M |
| 3300010400|Ga0134122_10849314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300010400|Ga0134122_12355658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300010401|Ga0134121_10843554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300010403|Ga0134123_10714820 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300011270|Ga0137391_11035018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300011414|Ga0137442_1045895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300012010|Ga0120118_1090121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300012202|Ga0137363_10994560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300012208|Ga0137376_11770461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300012359|Ga0137385_11170056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300012474|Ga0157356_1004343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300012501|Ga0157351_1001495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1506 | Open in IMG/M |
| 3300012511|Ga0157332_1082911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300012530|Ga0136635_10194514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300012684|Ga0136614_10014155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5727 | Open in IMG/M |
| 3300012925|Ga0137419_11276520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300012927|Ga0137416_10095833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2220 | Open in IMG/M |
| 3300012929|Ga0137404_11449399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300012930|Ga0137407_10731918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300012930|Ga0137407_10889527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300013296|Ga0157374_11528842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300013297|Ga0157378_10010368 | All Organisms → cellular organisms → Bacteria | 8135 | Open in IMG/M |
| 3300013297|Ga0157378_11622220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300013297|Ga0157378_11688693 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300013306|Ga0163162_10304202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1727 | Open in IMG/M |
| 3300013308|Ga0157375_10294836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1785 | Open in IMG/M |
| 3300013760|Ga0120188_1035714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300014326|Ga0157380_10072271 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
| 3300014487|Ga0182000_10428840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300015373|Ga0132257_100220164 | All Organisms → cellular organisms → Bacteria | 2256 | Open in IMG/M |
| 3300015374|Ga0132255_104211207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300017695|Ga0180121_10360978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300017789|Ga0136617_10401316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1106 | Open in IMG/M |
| 3300017789|Ga0136617_10519916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300018054|Ga0184621_10371229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300018059|Ga0184615_10372934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300018071|Ga0184618_10354350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300018073|Ga0184624_10196011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 3300018429|Ga0190272_10710181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300018432|Ga0190275_10071645 | All Organisms → cellular organisms → Bacteria | 2975 | Open in IMG/M |
| 3300018432|Ga0190275_13333914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300018465|Ga0190269_11158369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300018466|Ga0190268_10308953 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300018466|Ga0190268_11482088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300018466|Ga0190268_11998516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300018468|Ga0066662_12425828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300018469|Ga0190270_10278300 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300018469|Ga0190270_10868519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300018482|Ga0066669_12208109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300018920|Ga0190273_10428555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
| 3300019238|Ga0180112_1096199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300020215|Ga0196963_10389307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300020215|Ga0196963_10596583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300021344|Ga0193719_10342286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300021445|Ga0182009_10160239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
| 3300025885|Ga0207653_10255010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300025903|Ga0207680_10221971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1296 | Open in IMG/M |
| 3300025908|Ga0207643_10083741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1851 | Open in IMG/M |
| 3300025911|Ga0207654_10462677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300025920|Ga0207649_11218801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300025924|Ga0207694_11721698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300025935|Ga0207709_10250505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1293 | Open in IMG/M |
| 3300025935|Ga0207709_11046430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300025937|Ga0207669_11679115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300025939|Ga0207665_10351037 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300025942|Ga0207689_10185081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1718 | Open in IMG/M |
| 3300025942|Ga0207689_11399475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300025960|Ga0207651_11983282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300026041|Ga0207639_10954839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300026041|Ga0207639_11219055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300026041|Ga0207639_11332872 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300026116|Ga0207674_10411926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1306 | Open in IMG/M |
| 3300026116|Ga0207674_11687247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300026118|Ga0207675_100313082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1531 | Open in IMG/M |
| 3300026118|Ga0207675_102560178 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300027678|Ga0209011_1037402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1520 | Open in IMG/M |
| 3300027691|Ga0209485_1015901 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300027765|Ga0209073_10161936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300027778|Ga0209464_10331023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300028380|Ga0268265_10467232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1182 | Open in IMG/M |
| 3300028380|Ga0268265_11177625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300028381|Ga0268264_12647246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300030496|Ga0268240_10140849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300030513|Ga0268242_1099241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300031547|Ga0310887_10629034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300031720|Ga0307469_11233632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300031740|Ga0307468_100658374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300031854|Ga0310904_10498678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300031949|Ga0214473_12327187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300032003|Ga0310897_10402851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300033412|Ga0310810_11050725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300033412|Ga0310810_11408723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300033988|Ga0334909_034487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300034005|Ga0334930_045045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300034006|Ga0334934_005845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1642 | Open in IMG/M |
| 3300034133|Ga0334916_027768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300034172|Ga0334913_045734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
| 3300034221|Ga0334937_054100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300034221|Ga0334937_182351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300034268|Ga0372943_1021782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300034391|Ga0334917_070298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300034660|Ga0314781_144790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300034664|Ga0314786_121218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300034672|Ga0314797_155243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300034675|Ga0314800_045708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300034678|Ga0314803_006583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1441 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.75% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.38% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 3.12% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.12% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.12% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.12% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.12% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.75% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.50% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 1.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.88% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.25% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.25% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.25% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.25% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 1.25% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.25% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.25% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.62% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.62% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.62% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.62% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.62% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030513 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG (v2) | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033988 | Soil microbial communities from Mojave Desert, California, United States - 5NOC | Environmental | Open in IMG/M |
| 3300034005 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 26HNS | Environmental | Open in IMG/M |
| 3300034006 | Biocrust microbial communities from Mojave Desert, California, United States - 30SMC | Environmental | Open in IMG/M |
| 3300034133 | Biocrust microbial communities from Mojave Desert, California, United States - 12HMC | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| 3300034221 | Biocrust microbial communities from Mojave Desert, California, United States - 33SMC | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034391 | Biocrust microbial communities from Mojave Desert, California, United States - 13HMC | Environmental | Open in IMG/M |
| 3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034675 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034678 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_133679941 | 3300000363 | Soil | MRNKRFFVVLAGALVFGLLAAVSVNRYLSNAQAFSKDMTKVAVA |
| INPhiseqgaiiFebDRAFT_1043961312 | 3300000364 | Soil | MRNKRFFLVLVGALIFGVLAAFSVSKYLSSAQAYTKNL |
| JGI1027J11758_111806761 | 3300000789 | Soil | MRNKRFLFVLAGALAFGLLAAVSVSRYLSSAQAYTKN |
| F14TB_1053782132 | 3300001431 | Soil | MRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLSRV |
| JGI24738J21930_101488391 | 3300002075 | Corn Rhizosphere | MRNKRFXXVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNKIAVA |
| Ga0062590_1005359591 | 3300004157 | Soil | MRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLSKVAVAKVQIP |
| Ga0058859_118262931 | 3300004798 | Host-Associated | MRNKRFFVVLVGALIFGVLAAVSVSKYLSSAQAFSKNLNKVAV |
| Ga0066676_110376081 | 3300005186 | Soil | MRNKRFFLVLAGALIFGLLAAVSVSRYLSSAQAYTKDMHRVAVAKVAI |
| Ga0065704_101373985 | 3300005289 | Switchgrass Rhizosphere | MRNKRFFIVLAGALLFGLLAAVSVSRYLSSAQAYTKSLRGVAVAKVAIP |
| Ga0070680_1011354352 | 3300005336 | Corn Rhizosphere | MRNKRFFIVLAGALLFGLLAAISVTRYLSSAQAYTRNLNRV |
| Ga0070661_1008275542 | 3300005344 | Corn Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNLNKVAVAKVA |
| Ga0070673_1019765522 | 3300005364 | Switchgrass Rhizosphere | MRNKRFFIVLGGALLFGLVAAVSVSRYLSSAQAYTKSLNGVVVAK |
| Ga0070705_1008848481 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNKRFFIVLVGALMFGLLAAVSVSRYLSSAQAYTKNLTRVAVAKVAIP |
| Ga0070694_1003166974 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNKRFFIVLAGALLFGLLAAVSVSRYLSSAQAYTKSLRGIAVA |
| Ga0070662_1006939672 | 3300005457 | Corn Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLSKVAV |
| Ga0070662_1013221462 | 3300005457 | Corn Rhizosphere | MRNKRFFIVLIGALIFGVLAAVSVSKYLSSAQAYSKNLSRVAVAKVA |
| Ga0070698_1014068022 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLSKV |
| Ga0070695_1006237641 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNKRFFIVLAGALLFGLLAAVSVSRYLSSAQAYTKSLRG |
| Ga0070695_1017313082 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNLNKIVVAKVA |
| Ga0070664_1005727641 | 3300005564 | Corn Rhizosphere | MRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATTKEF |
| Ga0068854_1005880163 | 3300005578 | Corn Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYAKNLKK |
| Ga0068861_1002552081 | 3300005719 | Switchgrass Rhizosphere | MRNKRFFVVLVGALLFGLLAAVSVSRYLSSAQAYTK |
| Ga0068858_1025215132 | 3300005842 | Switchgrass Rhizosphere | MRNKRFFIVLTGALLFGLLAAISVTRYLSSAQAYS |
| Ga0068858_1025636581 | 3300005842 | Switchgrass Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKN |
| Ga0066652_1017738112 | 3300006046 | Soil | MRNKRFFIVLVGALIFGVLAAVTVSKYLSSAQAYTKNMSKVAVA |
| Ga0075422_106220012 | 3300006196 | Populus Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNLNKVAVAKV |
| Ga0075431_1002405095 | 3300006847 | Populus Rhizosphere | MRNKRFLIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLSKVAVAKVAIPI |
| Ga0075425_1006733421 | 3300006854 | Populus Rhizosphere | MKNKRLLFVLAGALVFGLLAAVSVSRYLSSAQAYTKNLNN |
| Ga0068865_1010690371 | 3300006881 | Miscanthus Rhizosphere | MRNKRFFIVLIGALIFGVLAAVSVSKYLSSAQAYSKNLS |
| Ga0079219_105767651 | 3300006954 | Agricultural Soil | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNLNKVA |
| Ga0079219_111388722 | 3300006954 | Agricultural Soil | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYT |
| Ga0079218_121357701 | 3300007004 | Agricultural Soil | MRNKRLVVVLAGAAMFGLLAAVSVSRYLSNAQANTRNANSVV |
| Ga0105247_106408502 | 3300009101 | Switchgrass Rhizosphere | MRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYS |
| Ga0111538_109769773 | 3300009156 | Populus Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAFSKNLNKVAVAKVPIPLG |
| Ga0075423_114299922 | 3300009162 | Populus Rhizosphere | MRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATTKEFNRVTVAK |
| Ga0075423_116630842 | 3300009162 | Populus Rhizosphere | MRNKRFFIVLVGALIFGVLAAISVSRYLSSAQAYTKNLS |
| Ga0105241_106870621 | 3300009174 | Corn Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQALTKNLNKI |
| Ga0105241_107786551 | 3300009174 | Corn Rhizosphere | MRNKRFFVVLAGALVFGLLAAVSVNRYLSNAQAFSKDMTRVAVAKV |
| Ga0105248_105078984 | 3300009177 | Switchgrass Rhizosphere | MRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYTK |
| Ga0105248_115953882 | 3300009177 | Switchgrass Rhizosphere | MRNKRFFIVLVGALMFGVLAAVSVSKYLSSAQAFTKNLNKVAV |
| Ga0105237_124905511 | 3300009545 | Corn Rhizosphere | MRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATTKE |
| Ga0105249_119398012 | 3300009553 | Switchgrass Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNKVAVA |
| Ga0105340_12413692 | 3300009610 | Soil | MRNKRFFIVLVGALIFGVLAAVSVSRYLSNAQAYSNSLS |
| Ga0126307_113570961 | 3300009789 | Serpentine Soil | MRNKRLLFVLGSAVVFGLLAAVSVSRYLSDAQASSR |
| Ga0126313_107476361 | 3300009840 | Serpentine Soil | MRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNK |
| Ga0126380_119689251 | 3300010043 | Tropical Forest Soil | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAFSKNLHKVA |
| Ga0126310_104416123 | 3300010044 | Serpentine Soil | MRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYSKNLNKI |
| Ga0126310_113406022 | 3300010044 | Serpentine Soil | MRNKSLLLALAGAVIFGLIAAVSVSRYISQARAYAENL |
| Ga0126382_103832114 | 3300010047 | Tropical Forest Soil | MRNKRFLIVLVGALMFGLVAAVSVSRYLSSAQAYTK |
| Ga0126320_10125171 | 3300010146 | Soil | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAFTKNLNKVA |
| Ga0126319_16527921 | 3300010147 | Soil | MRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATTKEFN |
| Ga0126306_110981782 | 3300010166 | Serpentine Soil | MRNKRFFLVLVGALIFGVLAAVSVSRYLSNAQGYTKNLN |
| Ga0134126_130541762 | 3300010396 | Terrestrial Soil | MRNKRFFIVLVGALIFGVLAAVSVSNYLSSAQALTKNLNKVAVAKVPI |
| Ga0134122_100718786 | 3300010400 | Terrestrial Soil | MRNKRFFIVLAGALLFGLLAAVSVSRYLSSAQAYTKNLNGIVVAKVA |
| Ga0134122_108493141 | 3300010400 | Terrestrial Soil | MRNKRFFIVLTGALLFGLLAAISVTRYLSSAQAYSKNLSRVAV |
| Ga0134122_123556582 | 3300010400 | Terrestrial Soil | MRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYTKNLN |
| Ga0134121_108435542 | 3300010401 | Terrestrial Soil | MRNKRFFIVLVGALMFGVLAAVSVSKYLSSAQAFTK |
| Ga0134123_107148201 | 3300010403 | Terrestrial Soil | MRNKRFFFVLGGALVFGLLAAVSVSRYLSSAQAYTKNLNTIAV |
| Ga0137391_110350181 | 3300011270 | Vadose Zone Soil | MRNKRFFIVLVGALLFGLLAAFSVSRYLSSAQAYTKNLNRVA |
| Ga0137442_10458951 | 3300011414 | Soil | MRNKRFFIVLAGALVFGLLAAVSVTRYLSSAQAYTKSLNRVAVAKVAI |
| Ga0120118_10901212 | 3300012010 | Permafrost | MRNKRFFVVLVGALLFGLLAAVSVSRYLSSAQAYTNNLNRVAVAKV |
| Ga0137363_109945601 | 3300012202 | Vadose Zone Soil | MRNKRFFFVLAGALVFGLLAAISVSRYLSSAQAYTKNLNMVAV |
| Ga0137376_117704611 | 3300012208 | Vadose Zone Soil | MRNKRFFIVLIGALLFGLLAAVSVSRYLSSAQAYTK |
| Ga0137385_111700562 | 3300012359 | Vadose Zone Soil | MRNKRFFIVLTGALLFGVLAAFSVSRYLSSAQAFSK |
| Ga0157356_10043431 | 3300012474 | Unplanted Soil | MRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATTKEFNRVTVAKVPI |
| Ga0157351_10014951 | 3300012501 | Unplanted Soil | MRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATTKEFNR |
| Ga0157332_10829111 | 3300012511 | Soil | MRNKRFFVVLAGALVFGVLAAVSVSRYLSNAQAFAKDMHKVAVAKVAIPV |
| Ga0136635_101945141 | 3300012530 | Polar Desert Sand | MRNKRFVFVMVGAVVFGLVAAFSVSRYLSGTQAYAKNLNSV |
| Ga0136614_100141558 | 3300012684 | Polar Desert Sand | MRNKRFMIALAGAVVFGLIATVAVTRYLANAQAYTKNLG |
| Ga0137419_112765201 | 3300012925 | Vadose Zone Soil | MRNKRFFIVLAGALVFGLLAAVSVTRYLSSAQAYT |
| Ga0137416_100958331 | 3300012927 | Vadose Zone Soil | MRNKRFFVVLAGALVFGLLAAVSVNRYLSNAQAFSKDM |
| Ga0137404_114493992 | 3300012929 | Vadose Zone Soil | MRNKRFFIVLTGALLFGVLAAFSVSRYLSSAQAFTKD |
| Ga0137407_107319183 | 3300012930 | Vadose Zone Soil | MRNKRFFVVLAGALVFGLLAAVTVSRYLSSAQAYSKDLRQVAVAKVAI |
| Ga0137407_108895271 | 3300012930 | Vadose Zone Soil | MRNKRFFIVLTGALLFGVLAAFSVSRYLSSAQAFSKDLKRVV |
| Ga0157374_115288421 | 3300013296 | Miscanthus Rhizosphere | MRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNKVAVAKVAI |
| Ga0157378_100103681 | 3300013297 | Miscanthus Rhizosphere | MRNKRFFIVLAGALVFGLLAAVSVTRYLSSAQAYTKNLNKVAV |
| Ga0157378_116222201 | 3300013297 | Miscanthus Rhizosphere | MRNKRFFVVLAGALVFGVLAAVSVSRYLSNAQAFAKDMHKVAV |
| Ga0157378_116886932 | 3300013297 | Miscanthus Rhizosphere | MRNKRFFIVLAGALVFGLLAAVSVNRYLSNAQAFSKDMTKVAVAK |
| Ga0163162_103042025 | 3300013306 | Switchgrass Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNKIAVAKVAIPIG |
| Ga0157375_102948364 | 3300013308 | Miscanthus Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNL |
| Ga0120188_10357142 | 3300013760 | Terrestrial | MRNKRFIIVLVGALIFGVLAAVSVSKYLSSAQAFTK |
| Ga0157380_100722715 | 3300014326 | Switchgrass Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYTKDMHKVAVA |
| Ga0182000_104288402 | 3300014487 | Soil | MRNKRFFLVLVGALIFGVLAAVSVSKYLSSAQAYTKNLNKVAVAKVAI |
| Ga0132257_1002201646 | 3300015373 | Arabidopsis Rhizosphere | MRNKRFFLVLVGALIFGVLAAVSVSKYLSSAQAYSKNLNKVPVAKVAIPIW |
| Ga0132255_1042112072 | 3300015374 | Arabidopsis Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQALTKNLNKIAVAKVPI |
| Ga0180121_103609781 | 3300017695 | Polar Desert Sand | MRNKRFMIALAGAVVFGLIATVAVTRYLANAQAYTKNLGNVVVAK |
| Ga0136617_104013163 | 3300017789 | Polar Desert Sand | MVGAVVFGLVAAFSVSRYLSGTQAYAKNLNSVVVAKVDI |
| Ga0136617_105199161 | 3300017789 | Polar Desert Sand | MRNKRFLVVLTGAIVFGLFAAVLVSRYLSNAQAYTKNLGNV |
| Ga0184621_103712291 | 3300018054 | Groundwater Sediment | MRNKRFFIVLAGALIFGLLAAVSVTRYLSSAQAYTKS |
| Ga0184615_103729342 | 3300018059 | Groundwater Sediment | MRNKRFFIVLAGALVFGLLAAVSVTRYLSSAQAYTKNFNRVAVAK |
| Ga0184618_103543501 | 3300018071 | Groundwater Sediment | MRNKRFFIVLAGALLFGLLAAVSVTRYLSSAQAYTRNLNRVAVAKVSIPLG |
| Ga0184624_101960112 | 3300018073 | Groundwater Sediment | MRNKRFFIVLVGALIFGVLAAVSVSRYLSNAQAYSNSLSRIAVAKVAIP |
| Ga0190272_107101812 | 3300018429 | Soil | MRNKRFFIVLAGALVFGLLAAVSVTRYLSSAQAYTKNLNRVTVAKVAI |
| Ga0190275_100716451 | 3300018432 | Soil | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNLNKVAVAKVPIP |
| Ga0190275_133339141 | 3300018432 | Soil | MRNKRFLIVMAGALVFGLLAAFSVSRYLSSAQANNSNFTKV |
| Ga0190269_111583691 | 3300018465 | Soil | MRNKRLLFVLGSAVVFGLLAAVSVSRYLSDAQASSRNMNNV |
| Ga0190268_103089533 | 3300018466 | Soil | MRNKRFFIVLVGALIFGVLAAVSISKYLSSAQAYT |
| Ga0190268_114820882 | 3300018466 | Soil | MRNKRFFVVLAGALLFGLLAAVSVSRYLSSAQAYT |
| Ga0190268_119985161 | 3300018466 | Soil | MRNKRFFVVLVGALIFGLLAAVSVSRYLSSAQAYTKNLTRVAVAKV |
| Ga0066662_124258282 | 3300018468 | Grasslands Soil | MRNKRFFVVLAGALLFGLLAAVTVSRYLSSAQAYSKDLKP |
| Ga0190270_102783004 | 3300018469 | Soil | MRNKRFFVVLAGALVFGLLAAVSVNRYLSNAQAFSKDMT |
| Ga0190270_108685191 | 3300018469 | Soil | MRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQAYTKNLTR |
| Ga0066669_122081092 | 3300018482 | Grasslands Soil | MRNKRFFRVWVGALIFGVLATVPVSKYLSSAQAYTK |
| Ga0190273_104285551 | 3300018920 | Soil | MRNKRFFVVLVGALLFGLLAAVSVSRYLSSAQAYTKNLTR |
| Ga0180112_10961991 | 3300019238 | Groundwater Sediment | MRNKRFFIVLAGALLFGLLAAVSVSRYLSSAQAYTKTLN |
| Ga0196963_103893071 | 3300020215 | Soil | MRNKRLVFVLAGAAMFGLLAAVSVSRYLSNAQANPRGA |
| Ga0196963_105965832 | 3300020215 | Soil | MRNKRLIVVLGGAVVFGLIAAVSVSRYLSNAQGFSRGMN |
| Ga0193719_103422861 | 3300021344 | Soil | MRNKRFIFVLAGALIFGLLAAVSVSRYLSSAQAYTKNLNRVAV |
| Ga0182009_101602393 | 3300021445 | Soil | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNLTKVAVAKVAI |
| Ga0207653_102550101 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNKIAVAKV |
| Ga0207680_102219714 | 3300025903 | Switchgrass Rhizosphere | MRNKRFFIVLIGALIFGVLAAVSVSKYLSSAQAYSKNLSRVAVAKVAIP |
| Ga0207643_100837415 | 3300025908 | Miscanthus Rhizosphere | MRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATTKEFNRVTVAKVPIP |
| Ga0207654_104626773 | 3300025911 | Corn Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQACSKNMSKV |
| Ga0207649_112188012 | 3300025920 | Corn Rhizosphere | MRNKRFFVVLVGALIFGVLAAVSVSKYLSSAQAFSKN |
| Ga0207694_117216982 | 3300025924 | Corn Rhizosphere | MRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATTKEFNRVTVAKVP |
| Ga0207709_102505054 | 3300025935 | Miscanthus Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLSKVAVAKVQIPLG |
| Ga0207709_110464301 | 3300025935 | Miscanthus Rhizosphere | MRNKRFFLVLIGALVFGLLAAVSVSRYLSSAQAYTKSLN |
| Ga0207669_116791152 | 3300025937 | Miscanthus Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSRYLSNAQAYSNTLSRIAVAKVAIP |
| Ga0207665_103510373 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNLNKIVVA |
| Ga0207689_101850814 | 3300025942 | Miscanthus Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYSKNMSKVAVAKVTIPIG |
| Ga0207689_113994752 | 3300025942 | Miscanthus Rhizosphere | MRNKRFFLVLVGALIFGVLAAFSVSKYLSSAQAYTKNLSKVAVAKVA |
| Ga0207651_119832822 | 3300025960 | Switchgrass Rhizosphere | MRNKRFFIVLAGALLFGLLAAVSVSRYLSSAQAYTKSL |
| Ga0207639_109548392 | 3300026041 | Corn Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQALTKNLNKIAVA |
| Ga0207639_112190552 | 3300026041 | Corn Rhizosphere | MRNKRFFVVLAGALVFGVLAAVSVSRYLSNAQAFAKDMHKVAVA |
| Ga0207639_113328722 | 3300026041 | Corn Rhizosphere | MRNKRFFIVLVGALLFGLLAAFSVSRYLSSAQAYTKNLNRVAVAKVAI |
| Ga0207674_104119264 | 3300026116 | Corn Rhizosphere | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYTKNLN |
| Ga0207674_116872471 | 3300026116 | Corn Rhizosphere | MRNKRLLIVLVGALIFGVLAAVSVSKYLSSAQAYTKS |
| Ga0207675_1003130825 | 3300026118 | Switchgrass Rhizosphere | MRNKRFFVVLVGALLFGLLAAVSVSRYLSSAQAYTKNLTRVAVAKVA |
| Ga0207675_1025601782 | 3300026118 | Switchgrass Rhizosphere | MRNKRFFIVLAGALLFGLLAAVSVSRYLSSAQAYTKSLRGIAVAK |
| Ga0209011_10374021 | 3300027678 | Forest Soil | MRNKRFFFVLAGALIFGLLAAVSVSRYLSSAQAYTKNMNHVA |
| Ga0209485_10159011 | 3300027691 | Agricultural Soil | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYTKNLNKVAVAKVA |
| Ga0209073_101619361 | 3300027765 | Agricultural Soil | MRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNKV |
| Ga0209464_103310231 | 3300027778 | Wetland Sediment | MRNKRFLFVLAGALIFGLVAAVSVSRYLSSAQAYTKNL |
| Ga0268265_104672321 | 3300028380 | Switchgrass Rhizosphere | MRNKRFFVVLAGALVFGVLAAVSVSRYLSNAQAFA |
| Ga0268265_111776252 | 3300028380 | Switchgrass Rhizosphere | MRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNKVAVA |
| Ga0268264_126472462 | 3300028381 | Switchgrass Rhizosphere | MRNKRFFLVLVGALIFGVLAAVSVSKYLSSAQAYTKNLSKV |
| Ga0268240_101408492 | 3300030496 | Soil | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYSKNLNKIAV |
| Ga0268242_10992412 | 3300030513 | Soil | MRNKRFLIVMAGALVFGLLAAFSVSRYLSSAQANNSNMTKIAVAKVD |
| Ga0310887_106290342 | 3300031547 | Soil | MRNKRFFIVLVGALLFGLLAAVSVSRYLSSAQATVKEFNRVTVAK |
| Ga0307469_112336321 | 3300031720 | Hardwood Forest Soil | MRNKRFFIVLGGALLFGLLAAVSVSRYLSSAQAYTK |
| Ga0307468_1006583741 | 3300031740 | Hardwood Forest Soil | MRNKRFFIVLAGALVFGLLAAVSVSRYLSSAQAYTN |
| Ga0310904_104986782 | 3300031854 | Soil | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAFTKNLNKVAV |
| Ga0214473_123271872 | 3300031949 | Soil | MRNKRFFVVLAGALLFGLLAAVSVSRYLSSAQAYSKNFNRVAVA |
| Ga0310897_104028512 | 3300032003 | Soil | MRNKRFFIVLVGALIFGVLAAISVSRYLSSAQAYTKNLSKVAVAKVQIPLG |
| Ga0310810_110507251 | 3300033412 | Soil | MRNKRFFIVLVGALIFGVLAAVTVSKYLSSAQAYTKNM |
| Ga0310810_114087232 | 3300033412 | Soil | MRNKRFFLVLVGALIFGVLAAVSVSRYLSSAQAYGKTLN |
| Ga0334909_034487_538_642 | 3300033988 | Soil | MRNKRLLFVLAGAAVFGLVAAVSVSRYLSNAQAFT |
| Ga0334930_045045_621_737 | 3300034005 | Sub-Biocrust Soil | MRNKRLLFVLGSAAVFGLLAAVSVSRYLSDAQANTRNMN |
| Ga0334934_005845_1523_1642 | 3300034006 | Biocrust | MRNKRLLFVLGSAVVFGLLAAVSVSRYLSDAQASSRNLNN |
| Ga0334916_027768_2_127 | 3300034133 | Hypolithic Biocrust | MRNKRLLVVLVGAAVFGLLAAVSVSRYLSNAQATPRNLANVV |
| Ga0334913_045734_2_130 | 3300034172 | Sub-Biocrust Soil | MRNKRFLIVMTGALVFGLLAAFSVSRYLSSAQANPNFTKIAVA |
| Ga0334937_054100_987_1094 | 3300034221 | Biocrust | MRNKRLLFVLGSAAVFGLLAAVSVSRYLSDAQASSR |
| Ga0334937_182351_3_110 | 3300034221 | Biocrust | MRNKRLVFVMCGAVVFGLVAAFSVSRYLSGTQAYAK |
| Ga0372943_1021782_445_549 | 3300034268 | Soil | MRNKRLLFVLGSAVVFGLLAAVSVSRYLSDAQASG |
| Ga0334917_070298_528_650 | 3300034391 | Hypolithic Biocrust | MRNKRLLFVLAGAAVFGLVAAVSVSRYLSNAQAFTRNMNNV |
| Ga0314781_144790_3_152 | 3300034660 | Soil | MRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYSKNMSKVAVAKVAIPI |
| Ga0314786_121218_462_584 | 3300034664 | Soil | MRNKRFFIVLVGALIFGVLAAVSVSKYLSSAQAYTKNLNNV |
| Ga0314797_155243_405_509 | 3300034672 | Soil | MRNKRFFIVLVGALIFGVLAAVSVSRYLSRAQAFT |
| Ga0314800_045708_2_130 | 3300034675 | Soil | MRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYSKNLNKVVV |
| Ga0314803_006583_1320_1439 | 3300034678 | Soil | MRNKRFFIVLVGALIFGVLAAVSVSRYLSSAQAYTKNLNK |
| ⦗Top⦘ |