


| Basic Information | |
|---|---|
| Family ID | F041163 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 160 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MAVKAKTGTGRLDHQAGKPKLTRQGNGKRSKPRGTRKLLRGQGR |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 52.50 % |
| % of genes near scaffold ends (potentially truncated) | 30.00 % |
| % of genes from short scaffolds (< 2000 bps) | 60.62 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (35.000 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (49.375 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.250 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (60.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF08291 | Peptidase_M15_3 | 12.50 |
| PF13392 | HNH_3 | 6.25 |
| PF00589 | Phage_integrase | 5.00 |
| PF00959 | Phage_lysozyme | 3.75 |
| PF13385 | Laminin_G_3 | 1.88 |
| PF16778 | Phage_tail_APC | 1.88 |
| PF12684 | DUF3799 | 1.88 |
| PF02511 | Thy1 | 1.25 |
| PF13884 | Peptidase_S74 | 1.25 |
| PF01764 | Lipase_3 | 1.25 |
| PF01391 | Collagen | 1.25 |
| PF01844 | HNH | 1.25 |
| PF07484 | Collar | 0.62 |
| PF05100 | Phage_tail_L | 0.62 |
| PF00271 | Helicase_C | 0.62 |
| PF01832 | Glucosaminidase | 0.62 |
| PF13529 | Peptidase_C39_2 | 0.62 |
| PF13550 | Phage-tail_3 | 0.62 |
| PF13229 | Beta_helix | 0.62 |
| PF00692 | dUTPase | 0.62 |
| PF08809 | DUF1799 | 0.62 |
| PF04545 | Sigma70_r4 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 1.25 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.62 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.62 |
| COG4672 | Phage tail protein | Mobilome: prophages, transposons [X] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.25 % |
| Unclassified | root | N/A | 28.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000124|BS_KBA_SWE12_21mDRAFT_c10015470 | Not Available | 2399 | Open in IMG/M |
| 3300000401|BB_Man_B_Liq_inBBDRAFT_1000105 | All Organisms → Viruses | 13664 | Open in IMG/M |
| 3300000401|BB_Man_B_Liq_inBBDRAFT_1004464 | Not Available | 2381 | Open in IMG/M |
| 3300000401|BB_Man_B_Liq_inBBDRAFT_1008910 | Not Available | 1481 | Open in IMG/M |
| 3300000401|BB_Man_B_Liq_inBBDRAFT_1012370 | All Organisms → Viruses | 1170 | Open in IMG/M |
| 3300003413|JGI25922J50271_10054181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
| 3300003430|JGI25921J50272_10002369 | All Organisms → Viruses | 6228 | Open in IMG/M |
| 3300004112|Ga0065166_10357266 | All Organisms → Viruses | 604 | Open in IMG/M |
| 3300005525|Ga0068877_10130958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1548 | Open in IMG/M |
| 3300005662|Ga0078894_10587763 | Not Available | 993 | Open in IMG/M |
| 3300005662|Ga0078894_11113443 | Not Available | 673 | Open in IMG/M |
| 3300005805|Ga0079957_1237486 | All Organisms → Viruses | 854 | Open in IMG/M |
| 3300006025|Ga0075474_10044670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1513 | Open in IMG/M |
| 3300006026|Ga0075478_10000627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12682 | Open in IMG/M |
| 3300006026|Ga0075478_10137523 | Not Available | 766 | Open in IMG/M |
| 3300006026|Ga0075478_10150117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 727 | Open in IMG/M |
| 3300006026|Ga0075478_10193996 | All Organisms → Viruses | 622 | Open in IMG/M |
| 3300006637|Ga0075461_10192865 | Not Available | 612 | Open in IMG/M |
| 3300006802|Ga0070749_10032388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 3251 | Open in IMG/M |
| 3300006802|Ga0070749_10035123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 3103 | Open in IMG/M |
| 3300006802|Ga0070749_10044823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 2710 | Open in IMG/M |
| 3300006802|Ga0070749_10051375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 2510 | Open in IMG/M |
| 3300006802|Ga0070749_10301073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
| 3300006802|Ga0070749_10626460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 579 | Open in IMG/M |
| 3300006810|Ga0070754_10004151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_47 | 10006 | Open in IMG/M |
| 3300006810|Ga0070754_10010821 | All Organisms → Viruses | 5739 | Open in IMG/M |
| 3300006810|Ga0070754_10052504 | All Organisms → Viruses | 2148 | Open in IMG/M |
| 3300006810|Ga0070754_10290087 | All Organisms → Viruses | 737 | Open in IMG/M |
| 3300006810|Ga0070754_10368257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 633 | Open in IMG/M |
| 3300006810|Ga0070754_10430589 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 574 | Open in IMG/M |
| 3300006867|Ga0075476_10100888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1110 | Open in IMG/M |
| 3300006869|Ga0075477_10039091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 2146 | Open in IMG/M |
| 3300006870|Ga0075479_10173520 | All Organisms → Viruses | 873 | Open in IMG/M |
| 3300006870|Ga0075479_10318165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 609 | Open in IMG/M |
| 3300006874|Ga0075475_10239035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 765 | Open in IMG/M |
| 3300006916|Ga0070750_10001018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 15738 | Open in IMG/M |
| 3300006916|Ga0070750_10203489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 876 | Open in IMG/M |
| 3300007234|Ga0075460_10011072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 3594 | Open in IMG/M |
| 3300007344|Ga0070745_1054057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 1646 | Open in IMG/M |
| 3300007345|Ga0070752_1276944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 645 | Open in IMG/M |
| 3300007345|Ga0070752_1362809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300007346|Ga0070753_1037138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2061 | Open in IMG/M |
| 3300007538|Ga0099851_1006316 | All Organisms → Viruses | 4962 | Open in IMG/M |
| 3300007538|Ga0099851_1117539 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1006 | Open in IMG/M |
| 3300007538|Ga0099851_1213921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Atlauavirus → Synechococcus virus AC2014fSyn7803C8 | 698 | Open in IMG/M |
| 3300007539|Ga0099849_1052295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Atlauavirus → Synechococcus virus AC2014fSyn7803C8 | 1697 | Open in IMG/M |
| 3300007539|Ga0099849_1117011 | All Organisms → Viruses | 1051 | Open in IMG/M |
| 3300007541|Ga0099848_1004182 | Not Available | 6646 | Open in IMG/M |
| 3300007541|Ga0099848_1017822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 3058 | Open in IMG/M |
| 3300007541|Ga0099848_1031498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 2208 | Open in IMG/M |
| 3300007542|Ga0099846_1023457 | All Organisms → cellular organisms → Bacteria | 2390 | Open in IMG/M |
| 3300007640|Ga0070751_1018993 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 3324 | Open in IMG/M |
| 3300007640|Ga0070751_1320065 | Not Available | 574 | Open in IMG/M |
| 3300007960|Ga0099850_1350985 | Not Available | 552 | Open in IMG/M |
| 3300008110|Ga0114343_1049959 | All Organisms → Viruses | 1622 | Open in IMG/M |
| 3300008266|Ga0114363_1008037 | Not Available | 5762 | Open in IMG/M |
| 3300008996|Ga0102831_1261592 | Not Available | 571 | Open in IMG/M |
| 3300009009|Ga0105105_10502221 | Not Available | 694 | Open in IMG/M |
| 3300009051|Ga0102864_1015222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1976 | Open in IMG/M |
| 3300009149|Ga0114918_10302861 | Not Available | 893 | Open in IMG/M |
| 3300009165|Ga0105102_10187177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassospiraceae → Thalassospira → unclassified Thalassospira → Thalassospira sp. | 1028 | Open in IMG/M |
| 3300009466|Ga0126448_1025266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Neritesvirus → Neritesvirus scam8 | 1412 | Open in IMG/M |
| 3300009504|Ga0114946_10000208 | Not Available | 36670 | Open in IMG/M |
| 3300010354|Ga0129333_10006023 | All Organisms → Viruses | 11440 | Open in IMG/M |
| 3300010354|Ga0129333_10086530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2901 | Open in IMG/M |
| 3300010354|Ga0129333_10194896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1844 | Open in IMG/M |
| 3300010354|Ga0129333_10882447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300010370|Ga0129336_10218200 | Not Available | 1080 | Open in IMG/M |
| 3300010389|Ga0136549_10023305 | All Organisms → Viruses | 3652 | Open in IMG/M |
| 3300010389|Ga0136549_10037789 | Not Available | 2618 | Open in IMG/M |
| 3300010389|Ga0136549_10300931 | All Organisms → Viruses | 667 | Open in IMG/M |
| 3300011984|Ga0119931_1029660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Aquisediminimonas → Aquisediminimonas sediminicola | 644 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1367368 | Not Available | 506 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10069391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2644 | Open in IMG/M |
| 3300017754|Ga0181344_1095231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-LBS1 | 867 | Open in IMG/M |
| 3300018421|Ga0181592_10064115 | All Organisms → Viruses | 2908 | Open in IMG/M |
| 3300018682|Ga0188851_1002007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 3318 | Open in IMG/M |
| 3300019756|Ga0194023_1081924 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 648 | Open in IMG/M |
| 3300020074|Ga0194113_11057361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 538 | Open in IMG/M |
| 3300020109|Ga0194112_10491222 | Not Available | 863 | Open in IMG/M |
| 3300020151|Ga0211736_10875326 | Not Available | 1628 | Open in IMG/M |
| 3300020172|Ga0211729_11169225 | All Organisms → Viruses | 4272 | Open in IMG/M |
| 3300020197|Ga0194128_10394389 | Not Available | 661 | Open in IMG/M |
| 3300020204|Ga0194116_10320770 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 804 | Open in IMG/M |
| 3300020551|Ga0208360_1002213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 3467 | Open in IMG/M |
| 3300021092|Ga0194122_10009535 | Not Available | 8091 | Open in IMG/M |
| 3300021376|Ga0194130_10430103 | All Organisms → Viruses | 693 | Open in IMG/M |
| 3300021961|Ga0222714_10175542 | All Organisms → Viruses → Predicted Viral | 1259 | Open in IMG/M |
| 3300021964|Ga0222719_10114381 | Not Available | 1953 | Open in IMG/M |
| 3300021964|Ga0222719_10348286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Neritesvirus → Neritesvirus scam8 | 941 | Open in IMG/M |
| 3300022050|Ga0196883_1018411 | Not Available | 837 | Open in IMG/M |
| 3300022057|Ga0212025_1008919 | All Organisms → Viruses | 1452 | Open in IMG/M |
| 3300022068|Ga0212021_1062175 | All Organisms → Viruses | 764 | Open in IMG/M |
| 3300022176|Ga0212031_1004269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. KLBC 81 | 1736 | Open in IMG/M |
| 3300022176|Ga0212031_1053723 | All Organisms → Viruses | 679 | Open in IMG/M |
| 3300022179|Ga0181353_1006493 | All Organisms → Viruses | 2809 | Open in IMG/M |
| 3300022198|Ga0196905_1006894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 3921 | Open in IMG/M |
| 3300022198|Ga0196905_1008243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 3537 | Open in IMG/M |
| 3300022200|Ga0196901_1012336 | All Organisms → Viruses | 3581 | Open in IMG/M |
| 3300022200|Ga0196901_1074792 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300022200|Ga0196901_1216669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Atlauavirus → Synechococcus virus AC2014fSyn7803C8 | 608 | Open in IMG/M |
| 3300025135|Ga0209498_1000085 | Not Available | 50288 | Open in IMG/M |
| 3300025646|Ga0208161_1003468 | Not Available | 7630 | Open in IMG/M |
| 3300025646|Ga0208161_1024089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2238 | Open in IMG/M |
| 3300025646|Ga0208161_1051719 | All Organisms → Viruses | 1310 | Open in IMG/M |
| 3300025646|Ga0208161_1081630 | Not Available | 934 | Open in IMG/M |
| 3300025646|Ga0208161_1170552 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 523 | Open in IMG/M |
| 3300025653|Ga0208428_1018811 | Not Available | 2296 | Open in IMG/M |
| 3300025655|Ga0208795_1111092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Atlauavirus → Synechococcus virus AC2014fSyn7803C8 | 722 | Open in IMG/M |
| 3300025671|Ga0208898_1084554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1010 | Open in IMG/M |
| 3300025674|Ga0208162_1072071 | All Organisms → Viruses | 1090 | Open in IMG/M |
| 3300025674|Ga0208162_1088927 | All Organisms → Viruses | 940 | Open in IMG/M |
| 3300025687|Ga0208019_1109542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 834 | Open in IMG/M |
| 3300025687|Ga0208019_1163026 | All Organisms → Viruses | 618 | Open in IMG/M |
| 3300025759|Ga0208899_1000144 | Not Available | 44288 | Open in IMG/M |
| 3300025759|Ga0208899_1012509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS4 | 4609 | Open in IMG/M |
| 3300025759|Ga0208899_1016539 | All Organisms → Viruses | 3826 | Open in IMG/M |
| 3300025769|Ga0208767_1257136 | Not Available | 541 | Open in IMG/M |
| 3300025771|Ga0208427_1121628 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 883 | Open in IMG/M |
| 3300025853|Ga0208645_1007219 | All Organisms → Viruses | 7265 | Open in IMG/M |
| 3300025853|Ga0208645_1020946 | Not Available | 3602 | Open in IMG/M |
| 3300025853|Ga0208645_1024002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 3284 | Open in IMG/M |
| 3300025853|Ga0208645_1131164 | Not Available | 983 | Open in IMG/M |
| 3300025853|Ga0208645_1177076 | Not Available | 780 | Open in IMG/M |
| 3300025889|Ga0208644_1007081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 8042 | Open in IMG/M |
| 3300025889|Ga0208644_1009518 | Not Available | 6762 | Open in IMG/M |
| 3300025889|Ga0208644_1009921 | All Organisms → Viruses | 6584 | Open in IMG/M |
| 3300025889|Ga0208644_1124349 | All Organisms → Viruses | 1225 | Open in IMG/M |
| 3300027211|Ga0208307_1013725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1341 | Open in IMG/M |
| 3300027769|Ga0209770_10285882 | Not Available | 632 | Open in IMG/M |
| 3300027816|Ga0209990_10000843 | Not Available | 28622 | Open in IMG/M |
| 3300029448|Ga0183755_1053070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Neritesvirus → Neritesvirus scam8 | 1006 | Open in IMG/M |
| 3300031539|Ga0307380_10215931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1840 | Open in IMG/M |
| 3300031565|Ga0307379_10203389 | All Organisms → Viruses | 2024 | Open in IMG/M |
| 3300031566|Ga0307378_11000032 | Not Available | 681 | Open in IMG/M |
| 3300031578|Ga0307376_10204965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1345 | Open in IMG/M |
| 3300031578|Ga0307376_10705500 | All Organisms → Viruses | 632 | Open in IMG/M |
| 3300031673|Ga0307377_10674217 | All Organisms → Viruses | 730 | Open in IMG/M |
| 3300031746|Ga0315293_10171399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-LBS1 | 1801 | Open in IMG/M |
| 3300031758|Ga0315907_10330477 | Not Available | 1245 | Open in IMG/M |
| 3300031787|Ga0315900_10479375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
| 3300031857|Ga0315909_10429487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
| 3300031857|Ga0315909_11012294 | Not Available | 501 | Open in IMG/M |
| 3300031873|Ga0315297_10853146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-LBS1 | 758 | Open in IMG/M |
| 3300031951|Ga0315904_10038094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5499 | Open in IMG/M |
| 3300031951|Ga0315904_10080797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 3482 | Open in IMG/M |
| 3300031951|Ga0315904_10128052 | Not Available | 2613 | Open in IMG/M |
| 3300031951|Ga0315904_10310093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylovulum → Methylovulum psychrotolerans | 1474 | Open in IMG/M |
| 3300031952|Ga0315294_10074290 | All Organisms → cellular organisms → Bacteria | 3569 | Open in IMG/M |
| 3300032053|Ga0315284_11118199 | All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl | 874 | Open in IMG/M |
| 3300032053|Ga0315284_11538349 | Not Available | 703 | Open in IMG/M |
| 3300032116|Ga0315903_10777047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
| 3300032143|Ga0315292_10325060 | Not Available | 1284 | Open in IMG/M |
| 3300032173|Ga0315268_10031519 | Not Available | 5125 | Open in IMG/M |
| 3300032173|Ga0315268_10059290 | All Organisms → cellular organisms → Bacteria | 3614 | Open in IMG/M |
| 3300033816|Ga0334980_0014457 | Not Available | 3407 | Open in IMG/M |
| 3300033994|Ga0334996_0023286 | Not Available | 4009 | Open in IMG/M |
| 3300034072|Ga0310127_233803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 662 | Open in IMG/M |
| 3300034374|Ga0348335_007815 | Not Available | 6234 | Open in IMG/M |
| 3300034523|Ga0310143_00909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11835 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 49.38% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.62% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.12% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.75% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 3.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.50% |
| Bioluminescent Bay | Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Bioluminescent Bay | 2.50% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.88% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.88% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 1.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.25% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.25% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.25% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.25% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.25% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.62% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.62% |
| Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.62% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.62% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.62% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.62% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.62% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.62% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
| 3300000401 | Marine microbial community from La Parguera, Puerto Rico - BB Mangrove B Liquid | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300011984 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107 | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300025135 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027211 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034523 | Fracking water microbial communities from deep shales in Oklahoma, United States - K-4-A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BS_KBA_SWE12_21mDRAFT_100154703 | 3300000124 | Marine | MATKAKTGTGKLEIMPKRKKTRQGNGQHSKPRGTRKMLRGQGR* |
| BB_Man_B_Liq_inBBDRAFT_10001053 | 3300000401 | Bioluminescent Bay | MAVRAKGGTGRIEHQAGKPKLTRQGNGKRSKPRGTRKLRRGQGR* |
| BB_Man_B_Liq_inBBDRAFT_10044643 | 3300000401 | Bioluminescent Bay | MAVRAKTGTGKVEVIPKRKKTRQGNGQHSRPRGTRKLRVGQGR* |
| BB_Man_B_Liq_inBBDRAFT_10089103 | 3300000401 | Bioluminescent Bay | VAVKAKTGTGKLEVIPKRKKTRQGNGQHSRTRGTRKLLRGQGR* |
| BB_Man_B_Liq_inBBDRAFT_10123704 | 3300000401 | Bioluminescent Bay | KPGTGALQHQAGKPKLTRQGQGRRSKPRGNRKLLRGQGR* |
| JGI25922J50271_100541811 | 3300003413 | Freshwater Lake | VAVRSKTGTARIEHIPGKPKLTRQGQGTRSKPNHRRKKTRGQGK* |
| JGI25921J50272_100023693 | 3300003430 | Freshwater Lake | VAVRSKTGTARIEHIPGKPKLTRQGQGTRSKPNHRRKKTRGQGX* |
| Ga0065166_103572661 | 3300004112 | Freshwater Lake | MAVKSKTGTGKIEHQSGKPKLTRQGNGKRSKPRGTRKLRKGQGR* |
| Ga0068877_101309583 | 3300005525 | Freshwater Lake | MAVKAKSGTGRLDHQAGKPKLTRQGNGKRSKPRGTRKLRKGQGR* |
| Ga0078894_105877633 | 3300005662 | Freshwater Lake | MAVKSKTGAARIEHQAGKPKLTRQGQGKRSKPSHGRKKTRGQGR* |
| Ga0078894_111134432 | 3300005662 | Freshwater Lake | VAVRSKTGAARIEHIPGKPKLTRQGQGTRSKPNHRRKKTRGQGR* |
| Ga0079957_12374862 | 3300005805 | Lake | MTVRSKTGTASLQHQPGKPKLTRQGNGARSKPNHGRKLLRGQGK* |
| Ga0075474_100446703 | 3300006025 | Aqueous | MAVKSKTALGRVEHQAGKPKLTRQGNSKRSKPRGTRKLLRGQGR* |
| Ga0075478_100006275 | 3300006026 | Aqueous | MAVRAKTGTGKVEIIPKRKKTRQGNGQHSRPRGTRKLRRGQGR* |
| Ga0075478_101375232 | 3300006026 | Aqueous | MAVRSKTGTGALQHQAGKPKLTRQGNGKRSKARGTRKLLRGQGR* |
| Ga0075478_101501171 | 3300006026 | Aqueous | MAVRSKTGTGALQHQAGKPKLTRQGNGKRSKPRGSRKLLRGQ |
| Ga0075478_101939961 | 3300006026 | Aqueous | MATKAKTGTASLDRPQSKPKLTRQGNGKRSKPRGTRKLRKGQGR* |
| Ga0075461_101928652 | 3300006637 | Aqueous | MAVKAKTGTARIEHQAGKPKLTRQGQGKRSKPNHGRKKTRGQGR* |
| Ga0070749_100323884 | 3300006802 | Aqueous | MAVRSKTGTAAVQHQPGPPKLTRQGQGRRSKPNHNRKKLRGQGR* |
| Ga0070749_100351236 | 3300006802 | Aqueous | MAVKAKTGTARVEHQAGKPKLTRQGQGKRSKPNHNRKKTRGQGR* |
| Ga0070749_100448232 | 3300006802 | Aqueous | MAVRSKTGTGALQHQAGKPKLTRQGNGKRSKPRGTRKLRKGQGR* |
| Ga0070749_100513752 | 3300006802 | Aqueous | MVVKAKTGTGRLDHQAGKPKLTRQGNGKRSKPRGTRKLRKGQGR* |
| Ga0070749_103010733 | 3300006802 | Aqueous | MAVKSKTGTGKIDHQPGPPKLTRQGQGTRSKPSHGRKKLRGQGR* |
| Ga0070749_106264603 | 3300006802 | Aqueous | MTVKAKTGTGRIEHQAGKPKLTRQGNGKRSKPRGTRKLRKGQGR* |
| Ga0070754_100041517 | 3300006810 | Aqueous | MKSRTALGRLEHIESKPKKTRQGNSKRSRPRGTRKLLRGQGR* |
| Ga0070754_1001082112 | 3300006810 | Aqueous | VKAKTGTGRLDHQAGKPKLTRQGDGKRSKPRGNRKLSRGQGR* |
| Ga0070754_100525043 | 3300006810 | Aqueous | MVVKAKTGTGRLDHQAGKPKLTRQGNGKRSKARGTRKLLRKQGKG* |
| Ga0070754_102900872 | 3300006810 | Aqueous | MAVRSKTGTGALQHQAGKPKLTRQGNGKRSKPRGSRKLLRGQGR* |
| Ga0070754_103682572 | 3300006810 | Aqueous | MTVRAKTGTGRLDHQAGKPKLTRQGNGKRSKPRGTRKLRKGQGR* |
| Ga0070754_104305892 | 3300006810 | Aqueous | MAVKAKTGTGALQHQAGKPKLTRQGNGKRSKPRGSRKLLRGQG |
| Ga0075476_101008881 | 3300006867 | Aqueous | GTGKVEIIPKRKKTRQGNGQHSRPRGTRKLRRGQGR* |
| Ga0075477_100390913 | 3300006869 | Aqueous | MAVKAKTGTGRIEHQAGKPKLTRQGQGKRSKPSHGRKLLRGQGR* |
| Ga0075479_101735201 | 3300006870 | Aqueous | TGALQHQAGKPKLTRQGNGKRSKARGTRKLLRGQGR* |
| Ga0075479_103181653 | 3300006870 | Aqueous | DSWSDCNLMATKAKTGTASLDRPQSKPKLTRQGNGKRSKPRGTRKLRKGQGR* |
| Ga0075475_102390352 | 3300006874 | Aqueous | MAVRSKTGTGALQHQAGKPKLTRQGNGKRSKPRGTRKLLRKQGKG* |
| Ga0070750_100010188 | 3300006916 | Aqueous | MAVRAKSGTARIEHQPGKPKLTRQGNSKRSKPRGTRKLLRGQGK* |
| Ga0070750_102034892 | 3300006916 | Aqueous | MATKAKTGTASLDRPQSKPKLTRQGNGKRSKPRGT |
| Ga0075460_100110724 | 3300007234 | Aqueous | MATRAKTGTGRIEHQAGKPKLTRQGNSKRSKPRGTRKLLRGQGK* |
| Ga0070745_10540574 | 3300007344 | Aqueous | MTNRSKTTLNGLKRKEGKPKLTTQGNSKRSKPRGTRKLRKGQGK* |
| Ga0070752_12769441 | 3300007345 | Aqueous | GDCFSCIADSWSDCNLMATKAKTGTASLDRPQSKPKLTRQGNGKRSKPRGTRKLRKGQGR |
| Ga0070752_13628092 | 3300007345 | Aqueous | MAVKSKTGIAALERKAKRLKLTRQGQGTRSKPNHGRKKTRGQGR* |
| Ga0070753_10371385 | 3300007346 | Aqueous | MAVKAKTGTGRIEHKEGKPKMTRQGNGTRSRPRGTRKLRRGQGR* |
| Ga0099851_100631611 | 3300007538 | Aqueous | MAVKAKTGTARIEHQAGKPKLTRQGNSKRSKPRGTRKLRKGQGR* |
| Ga0099851_11175393 | 3300007538 | Aqueous | MAVKAKTGTGRLEHQAGKPKLTRQGNGKRSKPRGTRKLLRKQGKG* |
| Ga0099851_12139212 | 3300007538 | Aqueous | MAVKAKNGTGRLGHQAGKPKLTRQGNGKRSKPRGTRKLLRKQGKG* |
| Ga0099849_10522955 | 3300007539 | Aqueous | MAVKAKTGTGRLEHQSGKPKLTRQGNGKRSKPRGTRKLLRKQGKG* |
| Ga0099849_11170113 | 3300007539 | Aqueous | MAVKAKTGTGRLEHQSSKPKLTRQGNGKRSKPRGTRKLRRGQGR* |
| Ga0099848_10041821 | 3300007541 | Aqueous | MTVRSKTGTGRLEHQAGKPKLTRQGNGKRSKPRGTRKLLRKQGKG* |
| Ga0099848_10178228 | 3300007541 | Aqueous | MTVKAKTGTGRLEHQSGKPKLTRQGNGKRSKPRGTRKLRRGQGR* |
| Ga0099848_10314985 | 3300007541 | Aqueous | MAVKAKTGTGRIEHQAGKPKLTRQGQGKRSKPHGTRKLLRGQGK* |
| Ga0099846_10234575 | 3300007542 | Aqueous | MAVKAKTGTGRLEHQAGKPKLTRQGNGKRSKPRGTRKLRKGQGR* |
| Ga0070751_10189931 | 3300007640 | Aqueous | MAVKAKTGTGALQHQAGKPKLTRQGNGKRSKPRGTRKLLRGQGR* |
| Ga0070751_13200651 | 3300007640 | Aqueous | TALGRVEHQSGKPKRTRQGNSKRSKPRGTRKLLRGQGR* |
| Ga0099850_13509851 | 3300007960 | Aqueous | MAVRAKTGTARIEHQSGKPKLTRQGNGKRSKPRGTRK |
| Ga0114343_10499594 | 3300008110 | Freshwater, Plankton | GPTRVRRRGGLLMAVKAKSGTGRLDHQAGKPKLTRQGNGKRSKPRGTRKLRKGQGR* |
| Ga0114363_10080377 | 3300008266 | Freshwater, Plankton | MAVKSKTGTARIEHQAGKPKLTRQGQGKRSKPSHGRKKTRGQGR* |
| Ga0102831_12615922 | 3300008996 | Estuarine | MAVRSKAGTAALQHQPGKPKLTRQGNGARSKPSHGRKLKIGQGK* |
| Ga0105105_105022212 | 3300009009 | Freshwater Sediment | MATKAKTGTGKLEIVPKRKKTRQGNGQHSKPRGTRKLRHGQGR* |
| Ga0102864_10152225 | 3300009051 | Estuarine | HTDHCSRYAVVVKAKTGTASLQHQPGKPKGTRQGNGARSKPSHGRKLMRGQGR* |
| Ga0114918_103028611 | 3300009149 | Deep Subsurface | MAVRSKTGTAPLQHLPGKPKLTRQGNGARSKPSHGRK |
| Ga0105102_101871771 | 3300009165 | Freshwater Sediment | MAVRSKTGTAPLQHQKGKPKLTRQGNGARSKPSHGRKLMRGQGR* |
| Ga0126448_10252664 | 3300009466 | Meromictic Pond | MAVKAKTGTGRLDHQAGKPKLTRQGNGKRSKPRGTRKLLRGQGR* |
| Ga0114946_1000020811 | 3300009504 | Sediment | MAVRSKTGTGAIQHQPAKPKLTRQGNSKRSKPRGTRKLRRGQGR* |
| Ga0129333_1000602325 | 3300010354 | Freshwater To Marine Saline Gradient | MAVKAKTGTGRIEHQAGKPKLTRQGQGKRSKPNHGRKKTRGQGR* |
| Ga0129333_100865305 | 3300010354 | Freshwater To Marine Saline Gradient | MAVRSKTGTAAVQHQPGKPKLTRQGQGRRSRPSHNRKKLRGQGR* |
| Ga0129333_101948961 | 3300010354 | Freshwater To Marine Saline Gradient | TPLESGPSFLHMAVKSKTALGRVEHQAGKPKLTRQGNGKRSKPRGTRKLRKGQGR* |
| Ga0129333_108824473 | 3300010354 | Freshwater To Marine Saline Gradient | MTVRSKTGAMGRVEHTPGKPKRTHQGQSKRSKPRGT |
| Ga0129336_102182003 | 3300010370 | Freshwater To Marine Saline Gradient | MAVRSKTGTAAVQHQPGKPKLTRQGQGRHSRPSHNRKKLRGQGR* |
| Ga0136549_100233053 | 3300010389 | Marine Methane Seep Sediment | MATKAKTGTASLDRLQSKPKLTRQGQGKRSKPRGTRKLRIGQGR* |
| Ga0136549_100377893 | 3300010389 | Marine Methane Seep Sediment | MAVRSKTGTSALQHQAGKPKLTRQGNGKRSKPRGTRKLRRGQGR* |
| Ga0136549_103009312 | 3300010389 | Marine Methane Seep Sediment | MAVKAKTGTGKIEIVPKRKKTRQGNGQHSKPRGTRKLLRGQGR* |
| Ga0119931_10296601 | 3300011984 | Drinking Water Treatment Plant | MAVKAKTGTGRIEHQAGKPKLTRQGNGKRSKPRGTRKLR |
| (restricted) Ga0172374_13673681 | 3300013122 | Freshwater | MAVRSKTNTSAAAIQHQPGKPKLTRQGNGTHSKPSHGRKKLRGQGQGKG* |
| (restricted) Ga0172367_100693915 | 3300013126 | Freshwater | MAVKAKTGAARIDHQPGPPKLTRQGQGKRSKPRGTRKLLRGQGKG* |
| Ga0181344_10952311 | 3300017754 | Freshwater Lake | MAVKSKTGTARIEHKSGAPKLTRQGNGVRSKPSHGR |
| Ga0181592_100641155 | 3300018421 | Salt Marsh | MAVRAKTGTGKVEIIPKRKKTRQGNGQHSRPRGTRKLRRGQGR |
| Ga0188851_100200710 | 3300018682 | Freshwater Lake | MAVRSKTGTASLQHKPGKPKLTRQGQGARSKPNHSRKQLRGQGK |
| Ga0194023_10819241 | 3300019756 | Freshwater | MAVKAKTGTGRLDHQAGKPKLTRQGNGKRSKPRGTRKLRKGQGR |
| Ga0194113_110573612 | 3300020074 | Freshwater Lake | MAVRSKTGTAAVQHQPGKPKTTHQGNGRRSKPRGSRKLLRGQGKG |
| Ga0194112_104912221 | 3300020109 | Freshwater Lake | VAVRSKTGTARVEFKPGNPKLTRQGQGKRSKPSHGR |
| Ga0211736_108753261 | 3300020151 | Freshwater | MAVRSKTGTASVQHAPGKPKLTKQGQGKRSKPNHGRKKLRGQGR |
| Ga0211729_111692259 | 3300020172 | Freshwater | MAVKAKTGAARVDHQAGKPKLTRQGQGARSKPNHGRKKLRGQGR |
| Ga0194128_103943892 | 3300020197 | Freshwater Lake | VAVRSKTGTARVEFKPGNPKLTRQGQGKRSKPSHGRKK |
| Ga0194116_103207702 | 3300020204 | Freshwater Lake | MAAKAKTGTGKLEVIPKKKRTRQGNGQHSKPRGTRKLLRGQGK |
| Ga0208360_10022135 | 3300020551 | Freshwater | MAVKAKTGAARIEHSPSPPKSTRQGNGARSKPSHGRKLLRGQGKG |
| Ga0194122_100095352 | 3300021092 | Freshwater Lake | MPVKSKTGTARVEFKPGNPKLTRQGQGKRSKPSHGRKKLRGQGKG |
| Ga0194130_104301032 | 3300021376 | Freshwater Lake | MTAKAKTGTGKLEVIPKKKRTRQGNGQHSKPRGTRKLLRGQGK |
| Ga0222714_101755424 | 3300021961 | Estuarine Water | MTVRSKSGSLGRIEHTPGKPKLTRQGQGKRSKARGTRKLLRGQGR |
| Ga0222719_101143811 | 3300021964 | Estuarine Water | MAVRAKTGIASLDRPARKPKLTRQGNGKRSKARGTRKLRKGQGR |
| Ga0222719_103482862 | 3300021964 | Estuarine Water | MAVKAKTGTGRLDHQAGKPKLTRQGNGKRSKPRGTRKLLRGQGR |
| Ga0196883_10184112 | 3300022050 | Aqueous | MAVKSKTALGRVEHQAGKPKLTRQGNSKRSKPRGTRKLLRGQGR |
| Ga0212025_10089194 | 3300022057 | Aqueous | MAVRSKTGTGALQHQAGKPKLTRQGNGKRSKARGTRKLLRGQGR |
| Ga0212021_10621752 | 3300022068 | Aqueous | MAVRAKSGTARIEHQPGKPKLTRQGNSKRSKPRGTRKLLRGQGK |
| Ga0212031_10042692 | 3300022176 | Aqueous | MAVKAKTGTARIEHQAGKPKLTRQGNSKRSKPRGTRKLRKGQGR |
| Ga0212031_10537233 | 3300022176 | Aqueous | PMAVKAKTGTGRIEHQAGKPKLTRQGQNKRSKPHGTRKLLRGQGK |
| Ga0181353_10064937 | 3300022179 | Freshwater Lake | MAVKSKTGTGKIEHQSGKPKLTRQGNGKRSKPRGTRKLRKGQGR |
| Ga0196905_10068948 | 3300022198 | Aqueous | MTVKAKTGTGRLEHQSGKPKLTRQGNGKRSKPRGTRKLRRGQGR |
| Ga0196905_10082433 | 3300022198 | Aqueous | MAVKAKTGTGRLEHQSGKPKLTRQGNGKRSKPRGTRKLRRGQGR |
| Ga0196901_101233610 | 3300022200 | Aqueous | LMAGKAKTGTARIEHQAGKPKLTRQGNSKRSKPRGTRKLRKGQGR |
| Ga0196901_10747923 | 3300022200 | Aqueous | MTVRSKTGTGRLEHQAGKPKLTRQGNGKRSKPRGTRKL |
| Ga0196901_12166692 | 3300022200 | Aqueous | TGTGRLEHQAGKPKLTRQGNGKRSKPRGTRKLLRKQGKG |
| Ga0209498_100008533 | 3300025135 | Sediment | MAVRSKTGTGAIQHQPAKPKLTRQGNSKRSKPRGTRKLRRGQGR |
| Ga0208161_100346811 | 3300025646 | Aqueous | MTVRSKTGTGRLEHQAGKPKLTRQGNGKRSKPRGTRKLRKGQ |
| Ga0208161_10240895 | 3300025646 | Aqueous | MAVKAKTGTGRIEHQAGKPKLTRQGQGKRSKPHGTRKLLRGQGK |
| Ga0208161_10517192 | 3300025646 | Aqueous | MAVKAKTGTGRLEHQAGKPKLTRQGNGKRSKPRGTRKLLRKQGKG |
| Ga0208161_10816304 | 3300025646 | Aqueous | MAVRAKTGTGKLEHQPGKPKLTRQGNGKRSKPRGTRKLRRG |
| Ga0208161_11705522 | 3300025646 | Aqueous | MTVKAKTGTGRLEHQSGKPKLTRQGNGKRSKPRGTRKLRR |
| Ga0208428_10188115 | 3300025653 | Aqueous | MAVRSKTGTGALQHQAGKPKLTRQGNGKRSKPRGTRKLRRGQGR |
| Ga0208795_11110922 | 3300025655 | Aqueous | GRLEHQAGKPKLTRQGNGKRSKPRGTRKLLRKQGKG |
| Ga0208898_10845543 | 3300025671 | Aqueous | VVAVKAKTALGRVEHQSRKPKRTRQGNSKRSKPRGTRKLLRGQGR |
| Ga0208162_10720713 | 3300025674 | Aqueous | MAVKAKTGTGRLEHQSSKPKLTRQGNGKRSKPRGTRKLRRGQGR |
| Ga0208162_10889271 | 3300025674 | Aqueous | MAVKAKTGTGRLEHQSGKPKLTRQGNGKRSKPRGTRKLLRKQGKG |
| Ga0208019_11095422 | 3300025687 | Aqueous | MATRSKTGTARLDHQPGKPKLTRQGNGKRSKPRGTRKLRKGQ |
| Ga0208019_11630261 | 3300025687 | Aqueous | GLMAVRAKTGTGRLEHQAGKPKLTRQGNGKRSKPRGTRKLRKGQGR |
| Ga0208899_10001447 | 3300025759 | Aqueous | MVVKAKTGTGRLDHQAGKPKLTRQGNGKRSKPRGTRKLRKGQGR |
| Ga0208899_10125098 | 3300025759 | Aqueous | MAVRAKSGTARIEHQPGKPKLTRQGNSKRSKPRGTRKLLRG |
| Ga0208899_10165391 | 3300025759 | Aqueous | KSKTALGRVEHQSGKPKRTRQGNSKRSRPRGTRKLRRGQGR |
| Ga0208767_12571362 | 3300025769 | Aqueous | MAVKAKTGTARIEHQAGKPKLTRQGQGKRSKPNHGRKKTRGQGR |
| Ga0208427_11216283 | 3300025771 | Aqueous | MAVKAKTGTGRIEHQAGKPKLTRQGQGKRSKPSHGRKLLRGQGR |
| Ga0208645_10072198 | 3300025853 | Aqueous | MAVRSKTGTGALQHQAGKPKLTRQGNGKRSKPRGSRKLLRGQGR |
| Ga0208645_10209463 | 3300025853 | Aqueous | MKSRTALGRLEHIESKPKKTRQGNSKRSRPRGTRKLLRGQGR |
| Ga0208645_10240025 | 3300025853 | Aqueous | MVVKAKTGTGRLDHQAGKPKLTRQGNGKRSKARGTRKLLRKQGKG |
| Ga0208645_11311642 | 3300025853 | Aqueous | MATKAKTGTASLDRPQSKPKLTRQGNGKRSKPRGTRKLRKG |
| Ga0208645_11770761 | 3300025853 | Aqueous | KTGTGALQHQAGKPKLTRQGNGKRSKARGTRKLLRGQGR |
| Ga0208644_10070815 | 3300025889 | Aqueous | MAVKAKTGTGRIEHKEGKPKMTRQGNGTRSRPRGTRKLRRGQGR |
| Ga0208644_10095186 | 3300025889 | Aqueous | MATRAKTGTGRIEHQAGKPKLTRQGNSKRSKPRGTRKLLRGQGK |
| Ga0208644_10099212 | 3300025889 | Aqueous | MTVKAKTGTGRIEHQAGKPKLTRQGNGKRSKPRGTRKLRKGQGR |
| Ga0208644_11243493 | 3300025889 | Aqueous | MAVKSKTGTGKIDHQPGPPKLTRQGQGTRSKPSHGRKKLRGQGR |
| Ga0208307_10137251 | 3300027211 | Estuarine | SRYAVVVKAKTGTASLQHQPGKPKGTRQGNGARSKPSHGRKLMRGQGR |
| Ga0209770_102858821 | 3300027769 | Freshwater Lake | MAVKAKTGTARVEHQPGKPKLTRQGQGQHSKPSHG |
| Ga0209990_1000084337 | 3300027816 | Freshwater Lake | MAVKAKSGTGRLDHQAGKPKLTRQGNGKRSKPRGTRKLRKGQGR |
| Ga0183755_10530702 | 3300029448 | Marine | MAVKSKTTLGRVEHVEARPKRTRQGNSKRSKARHNKKLRRGQGR |
| Ga0307380_102159313 | 3300031539 | Soil | MAVKAKTGTGRLDHQAGKPKLTRQGQGKRSKPSHNRKKTRGQGR |
| Ga0307379_102033894 | 3300031565 | Soil | MAVRSKTGTAILDRPQSKPKLTRQGQGKRSKPRGTRKMLRGQGR |
| Ga0307378_110000321 | 3300031566 | Soil | MAVRSKTGTAPLQHQPGKPKLTRQGNGARSKPSHGRKLL |
| Ga0307376_102049651 | 3300031578 | Soil | MAVRSKTGTASLDRPQSKPKLTRQGQGKRSKARGTRKMLRGQGR |
| Ga0307376_107055002 | 3300031578 | Soil | MAVRSKTGTASLDRPQSKPKLTRQGQGKRSKPRGTRKMLRGQGK |
| Ga0307377_106742172 | 3300031673 | Soil | VVVKAKTGTGKLDHQAGKPKLTRQGQGKRSKPNHNRKKTRGQGR |
| Ga0315293_101713995 | 3300031746 | Sediment | MTVRSKTGTASLQHQPGKPKLTRQGNGARSKPNHGRKLLRGQGK |
| Ga0315907_103304772 | 3300031758 | Freshwater | MAVRSKTGTAAVQHQPGKPKLTRQGQGRRSRPSHNRKKLRGQGR |
| Ga0315900_104793751 | 3300031787 | Freshwater | MTVRSKTGAMGRVEHTPGKPKRTHQGQSKRSKPRGTR |
| Ga0315909_104294873 | 3300031857 | Freshwater | MTVRSKTGAMGRVEHTPGKPKRTHQGQSKRSKPRGTRKP |
| Ga0315909_110122942 | 3300031857 | Freshwater | VAVKAKTGTGRLEHKEGKPKLTRQGQGKRSKPSHW |
| Ga0315297_108531464 | 3300031873 | Sediment | KAKTGTASMQHQPGKPKGTRQGNGARSKPSHGRKLRRGQGK |
| Ga0315904_1003809412 | 3300031951 | Freshwater | MAVRSKTGTAAVQHQPGKPKLTRQGQGRHSRPSHNRKKLRGQGR |
| Ga0315904_100807972 | 3300031951 | Freshwater | MAVRAKTGTASLDRPVRKPKLTRQGNGKRSKPRGSRKLLRGQGR |
| Ga0315904_101280523 | 3300031951 | Freshwater | MAVRSKTGTAAVQHQPGKPKLTRQGHGRHSRPSHNRKKLRGQGR |
| Ga0315904_103100932 | 3300031951 | Freshwater | MAVRSKTGTAAVQHQPGKPKLTRQGQGRHSKPNHNRKKLHGQGR |
| Ga0315294_100742903 | 3300031952 | Sediment | MAVRSKTGTGTIQHQAGKPKLTRQGNGARSKPNHGRKLMRGQGKG |
| Ga0315284_111181994 | 3300032053 | Sediment | MTVRSKTGTASLQRQSGKPQGTRQGNGARSKPSHGRKLRRGQGR |
| Ga0315284_115383491 | 3300032053 | Sediment | ASLQHQPGKPKLTRQGNGARSKPSHGRKLMRGQGR |
| Ga0315903_107770471 | 3300032116 | Freshwater | MATKSKTGTAKLEHQAGKPKLTRQGNGTRSKPSHRRKKRIGQG |
| Ga0315292_103250603 | 3300032143 | Sediment | MAVRSKTGTGTIQHQAGKPKLTRQGNGARSKPNHGRKLMRGQGRG |
| Ga0315268_100315195 | 3300032173 | Sediment | MAVRSKTGTAPLQHLPGKPKLTRQGNGARSKPSHGRKLMRGQGR |
| Ga0315268_100592909 | 3300032173 | Sediment | MAVRSKTGTAPLQHQPGKPKLTRQGNGKRSKRSHGRKLRRGQGKG |
| Ga0334980_0014457_1646_1780 | 3300033816 | Freshwater | MAVRAKTGTASLDRPVRKPKLTHQGNGKRSKPRGSRKLLRGQGR |
| Ga0334996_0023286_3241_3375 | 3300033994 | Freshwater | MAVKSKTGAARIEHQAGKPKLTRQGQGKRSKPSHGRKKTRGQGR |
| Ga0310127_233803_290_424 | 3300034072 | Fracking Water | MAVKAKTGTGRIEHQPGKPKLTRQGNSKRSKPRGSRKLRHGQGR |
| Ga0348335_007815_3284_3418 | 3300034374 | Aqueous | MTNRSKTTLNGLKRKEGKPKLTTQGNSKRSKPRGTRKLRKGQGK |
| Ga0310143_00909_812_946 | 3300034523 | Fracking Water | MAVKAKTGTGRIEHQAGKPKLTRQGNGKRSKPRGTRKLRKGQGR |
| ⦗Top⦘ |