


| Basic Information | |
|---|---|
| Family ID | F041155 |
| Family Type | Metagenome |
| Number of Sequences | 160 |
| Average Sequence Length | 45 residues |
| Representative Sequence | AESVEVGVHRGLQADGDLGTVGFGLSALLSLGRLNLVESII |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.25 % |
| % of genes near scaffold ends (potentially truncated) | 98.75 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.250 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (40.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.250 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.125 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.64% β-sheet: 0.00% Coil/Unstructured: 75.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF00872 | Transposase_mut | 3.12 |
| PF13546 | DDE_5 | 2.50 |
| PF01609 | DDE_Tnp_1 | 2.50 |
| PF13358 | DDE_3 | 1.88 |
| PF00589 | Phage_integrase | 1.88 |
| PF13551 | HTH_29 | 1.88 |
| PF02371 | Transposase_20 | 1.25 |
| PF02607 | B12-binding_2 | 1.25 |
| PF02133 | Transp_cyt_pur | 1.25 |
| PF02566 | OsmC | 1.25 |
| PF13749 | HATPase_c_4 | 1.25 |
| PF00378 | ECH_1 | 1.25 |
| PF03150 | CCP_MauG | 1.25 |
| PF07690 | MFS_1 | 1.25 |
| PF00892 | EamA | 1.25 |
| PF13580 | SIS_2 | 1.25 |
| PF01261 | AP_endonuc_2 | 1.25 |
| PF05711 | TylF | 1.25 |
| PF13561 | adh_short_C2 | 0.62 |
| PF00196 | GerE | 0.62 |
| PF04070 | DUF378 | 0.62 |
| PF08220 | HTH_DeoR | 0.62 |
| PF13429 | TPR_15 | 0.62 |
| PF00005 | ABC_tran | 0.62 |
| PF14137 | DUF4304 | 0.62 |
| PF01590 | GAF | 0.62 |
| PF01867 | Cas_Cas1 | 0.62 |
| PF02730 | AFOR_N | 0.62 |
| PF02113 | Peptidase_S13 | 0.62 |
| PF00171 | Aldedh | 0.62 |
| PF01098 | FTSW_RODA_SPOVE | 0.62 |
| PF03358 | FMN_red | 0.62 |
| PF02542 | YgbB | 0.62 |
| PF01557 | FAA_hydrolase | 0.62 |
| PF02729 | OTCace_N | 0.62 |
| PF00472 | RF-1 | 0.62 |
| PF13426 | PAS_9 | 0.62 |
| PF13183 | Fer4_8 | 0.62 |
| PF04542 | Sigma70_r2 | 0.62 |
| PF13302 | Acetyltransf_3 | 0.62 |
| PF01981 | PTH2 | 0.62 |
| PF13289 | SIR2_2 | 0.62 |
| PF12773 | DZR | 0.62 |
| PF09861 | Lar_N | 0.62 |
| PF13683 | rve_3 | 0.62 |
| PF00462 | Glutaredoxin | 0.62 |
| PF12704 | MacB_PCD | 0.62 |
| PF12950 | TaqI_C | 0.62 |
| PF07311 | Dodecin | 0.62 |
| PF02596 | DUF169 | 0.62 |
| PF02653 | BPD_transp_2 | 0.62 |
| PF09505 | Dimeth_Pyl | 0.62 |
| PF00072 | Response_reg | 0.62 |
| PF05547 | Peptidase_M6 | 0.62 |
| PF04365 | BrnT_toxin | 0.62 |
| PF04255 | DUF433 | 0.62 |
| PF12627 | PolyA_pol_RNAbd | 0.62 |
| PF00293 | NUDIX | 0.62 |
| PF09369 | MZB | 0.62 |
| PF04087 | DUF389 | 0.62 |
| PF02687 | FtsX | 0.62 |
| PF13347 | MFS_2 | 0.62 |
| PF10009 | DUF2252 | 0.62 |
| PF13537 | GATase_7 | 0.62 |
| PF00662 | Proton_antipo_N | 0.62 |
| PF00496 | SBP_bac_5 | 0.62 |
| PF05016 | ParE_toxin | 0.62 |
| PF12802 | MarR_2 | 0.62 |
| PF13482 | RNase_H_2 | 0.62 |
| PF05598 | DUF772 | 0.62 |
| PF01042 | Ribonuc_L-PSP | 0.62 |
| PF14478 | DUF4430 | 0.62 |
| PF13560 | HTH_31 | 0.62 |
| PF00990 | GGDEF | 0.62 |
| PF13751 | DDE_Tnp_1_6 | 0.62 |
| PF07291 | MauE | 0.62 |
| PF06253 | MTTB | 0.62 |
| PF01865 | PhoU_div | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 3.12 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.50 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.50 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.50 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.50 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.50 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.50 |
| COG1009 | Membrane H+-translocase/NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit | Energy production and conversion [C] | 1.25 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.25 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.25 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 1.25 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.25 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.62 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0245 | 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | Lipid transport and metabolism [I] | 0.62 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.62 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.62 |
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 0.62 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.62 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.62 |
| COG1392 | Phosphate transport regulator YkaA, distantly related to PhoU, UPF0111/DUF47 family | Inorganic ion transport and metabolism [P] | 0.62 |
| COG1518 | CRISPR-Cas system-associated integrase Cas1 | Defense mechanisms [V] | 0.62 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.62 |
| COG1808 | Uncharacterized membrane protein AF0785, contains DUF389 domain | Function unknown [S] | 0.62 |
| COG1990 | Peptidyl-tRNA hydrolase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG2043 | Uncharacterized conserved protein, DUF169 family | Function unknown [S] | 0.62 |
| COG2155 | Uncharacterized membrane protein YuzA, DUF378 family | Function unknown [S] | 0.62 |
| COG2414 | Aldehyde:ferredoxin oxidoreductase | Energy production and conversion [C] | 0.62 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.62 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.62 |
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.62 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.62 |
| COG4412 | Bacillopeptidase F, M6 metalloprotease family | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.62 |
| COG5598 | Trimethylamine:corrinoid methyltransferase | Coenzyme transport and metabolism [H] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.50 % |
| Unclassified | root | N/A | 42.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908032|Perma_A_C_ConsensusfromContig227339 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | 972 | Open in IMG/M |
| 2124908032|Perma_A_C_ConsensusfromContig233296 | Not Available | 671 | Open in IMG/M |
| 2140918008|ConsensusfromContig304284 | Not Available | 640 | Open in IMG/M |
| 3300002068|JGIcombinedJ21913_10065022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1511 | Open in IMG/M |
| 3300002068|JGIcombinedJ21913_10067835 | Not Available | 1467 | Open in IMG/M |
| 3300002068|JGIcombinedJ21913_10086803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1231 | Open in IMG/M |
| 3300002068|JGIcombinedJ21913_10136310 | Not Available | 888 | Open in IMG/M |
| 3300002068|JGIcombinedJ21913_10229607 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300002071|JGIcombinedJ21915_10002552 | Not Available | 7968 | Open in IMG/M |
| 3300002071|JGIcombinedJ21915_10091848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1231 | Open in IMG/M |
| 3300002071|JGIcombinedJ21915_10166636 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300002072|JGIcombinedJ21914_10211499 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300002179|JGI24141J26756_1025269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1639 | Open in IMG/M |
| 3300002515|JGI24144J35610_10133915 | Not Available | 569 | Open in IMG/M |
| 3300002538|JGI24132J36420_10017300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2761 | Open in IMG/M |
| 3300002550|JGI24131J36419_10124712 | Not Available | 618 | Open in IMG/M |
| 3300002551|JGI24135J36437_1003110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3708 | Open in IMG/M |
| 3300002563|JGI24138J36424_10094326 | Not Available | 727 | Open in IMG/M |
| 3300002563|JGI24138J36424_10158753 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 508 | Open in IMG/M |
| 3300002565|JGI24137J36423_1033755 | Not Available | 1317 | Open in IMG/M |
| 3300002565|JGI24137J36423_1083181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
| 3300002565|JGI24137J36423_1100417 | Not Available | 602 | Open in IMG/M |
| 3300002569|JGI24136J36422_10034901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1536 | Open in IMG/M |
| 3300002569|JGI24136J36422_10133839 | Not Available | 651 | Open in IMG/M |
| 3300003364|JGI25320J50211_1019290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 568 | Open in IMG/M |
| 3300005254|Ga0068714_10010970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 7804 | Open in IMG/M |
| 3300005947|Ga0066794_10177367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
| 3300006640|Ga0075527_10211605 | Not Available | 559 | Open in IMG/M |
| 3300006795|Ga0075520_1006091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6099 | Open in IMG/M |
| 3300006795|Ga0075520_1025832 | Not Available | 2920 | Open in IMG/M |
| 3300006864|Ga0066797_1035784 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300006864|Ga0066797_1102993 | Not Available | 1000 | Open in IMG/M |
| 3300006864|Ga0066797_1178673 | Not Available | 741 | Open in IMG/M |
| 3300006864|Ga0066797_1324922 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300006864|Ga0066797_1360631 | Not Available | 509 | Open in IMG/M |
| 3300006949|Ga0075528_10000760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6358 | Open in IMG/M |
| 3300006950|Ga0075524_10219260 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300006950|Ga0075524_10323123 | Not Available | 677 | Open in IMG/M |
| 3300006950|Ga0075524_10380380 | Not Available | 622 | Open in IMG/M |
| 3300006950|Ga0075524_10393308 | Not Available | 612 | Open in IMG/M |
| 3300006972|Ga0075518_1037277 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300006972|Ga0075518_1038335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 963 | Open in IMG/M |
| 3300009029|Ga0066793_10219611 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300009029|Ga0066793_10298261 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300009029|Ga0066793_10691208 | Not Available | 580 | Open in IMG/M |
| 3300009362|Ga0118673_1131402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.Bin444 | 673 | Open in IMG/M |
| 3300009566|Ga0130025_1145631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 799 | Open in IMG/M |
| 3300009672|Ga0116215_1528246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → Kutzneria buriramensis | 510 | Open in IMG/M |
| 3300009771|Ga0116155_10127785 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300010344|Ga0116243_10663704 | Not Available | 619 | Open in IMG/M |
| 3300010353|Ga0116236_10261542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1530 | Open in IMG/M |
| 3300010353|Ga0116236_10588743 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10066290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2283 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10859218 | Not Available | 553 | Open in IMG/M |
| 3300013232|Ga0170573_10142969 | Not Available | 653 | Open in IMG/M |
| 3300014160|Ga0181517_10167812 | Not Available | 1221 | Open in IMG/M |
| 3300014162|Ga0181538_10151492 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300014256|Ga0075318_1148679 | Not Available | 501 | Open in IMG/M |
| 3300014491|Ga0182014_10000682 | All Organisms → cellular organisms → Bacteria | 45983 | Open in IMG/M |
| 3300014491|Ga0182014_10296110 | Not Available | 832 | Open in IMG/M |
| 3300014491|Ga0182014_10336025 | Not Available | 766 | Open in IMG/M |
| 3300014496|Ga0182011_10715710 | Not Available | 631 | Open in IMG/M |
| 3300014502|Ga0182021_11097137 | Not Available | 958 | Open in IMG/M |
| 3300014658|Ga0181519_10977876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300014839|Ga0182027_10740210 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300014839|Ga0182027_11109589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
| 3300014839|Ga0182027_12243534 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300017948|Ga0187847_10792138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. SID8362 | 536 | Open in IMG/M |
| 3300017987|Ga0180431_10903390 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 585 | Open in IMG/M |
| 3300018033|Ga0187867_10154332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1319 | Open in IMG/M |
| 3300018089|Ga0187774_11104359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300020163|Ga0194039_1040060 | Not Available | 1775 | Open in IMG/M |
| 3300020221|Ga0194127_10852646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 558 | Open in IMG/M |
| 3300020812|Ga0214071_1211346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2676 | Open in IMG/M |
| 3300020812|Ga0214071_1285235 | All Organisms → cellular organisms → Bacteria | 6637 | Open in IMG/M |
| 3300020812|Ga0214071_1668203 | All Organisms → cellular organisms → Bacteria | 3739 | Open in IMG/M |
| 3300020813|Ga0214086_1237002 | Not Available | 920 | Open in IMG/M |
| 3300021069|Ga0194062_1052096 | Not Available | 1317 | Open in IMG/M |
| 3300021070|Ga0194056_10054457 | Not Available | 1497 | Open in IMG/M |
| 3300021074|Ga0194044_10186923 | Not Available | 810 | Open in IMG/M |
| 3300021473|Ga0194043_1181496 | Not Available | 710 | Open in IMG/M |
| 3300021520|Ga0194053_10080847 | Not Available | 1382 | Open in IMG/M |
| 3300022177|Ga0228536_1001089 | All Organisms → cellular organisms → Bacteria | 31941 | Open in IMG/M |
| 3300023203|Ga0255812_10318128 | Not Available | 881 | Open in IMG/M |
| 3300023203|Ga0255812_10763383 | All Organisms → cellular organisms → Bacteria | 3184 | Open in IMG/M |
| 3300023232|Ga0224516_1035474 | Not Available | 644 | Open in IMG/M |
| 3300025495|Ga0207932_1087155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
| 3300025575|Ga0209430_1028819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1846 | Open in IMG/M |
| 3300025575|Ga0209430_1079943 | Not Available | 818 | Open in IMG/M |
| 3300025600|Ga0209125_1041564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1525 | Open in IMG/M |
| 3300025692|Ga0209744_1029870 | All Organisms → cellular organisms → Bacteria | 2095 | Open in IMG/M |
| 3300025692|Ga0209744_1136375 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300025716|Ga0209746_1162739 | Not Available | 620 | Open in IMG/M |
| 3300025716|Ga0209746_1203231 | Not Available | 524 | Open in IMG/M |
| 3300025739|Ga0209745_1078477 | Not Available | 1147 | Open in IMG/M |
| 3300025739|Ga0209745_1144322 | Not Available | 749 | Open in IMG/M |
| 3300025750|Ga0209747_1112704 | Not Available | 905 | Open in IMG/M |
| 3300025750|Ga0209747_1211097 | Not Available | 583 | Open in IMG/M |
| 3300025764|Ga0209539_1005325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6419 | Open in IMG/M |
| 3300025764|Ga0209539_1013307 | All Organisms → cellular organisms → Bacteria | 3818 | Open in IMG/M |
| 3300025764|Ga0209539_1101075 | Not Available | 1165 | Open in IMG/M |
| 3300025764|Ga0209539_1126643 | Not Available | 1007 | Open in IMG/M |
| 3300025764|Ga0209539_1143499 | Not Available | 927 | Open in IMG/M |
| 3300025764|Ga0209539_1192746 | Not Available | 757 | Open in IMG/M |
| 3300025764|Ga0209539_1245758 | Not Available | 637 | Open in IMG/M |
| 3300025846|Ga0209538_1003106 | All Organisms → cellular organisms → Bacteria | 8213 | Open in IMG/M |
| 3300025846|Ga0209538_1053739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1716 | Open in IMG/M |
| 3300025846|Ga0209538_1160496 | Not Available | 863 | Open in IMG/M |
| 3300025852|Ga0209124_10344479 | Not Available | 551 | Open in IMG/M |
| 3300025864|Ga0209429_10061718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1717 | Open in IMG/M |
| 3300025864|Ga0209429_10112907 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | 1179 | Open in IMG/M |
| 3300025865|Ga0209226_10243017 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300025865|Ga0209226_10251804 | Not Available | 757 | Open in IMG/M |
| 3300025865|Ga0209226_10271519 | Not Available | 721 | Open in IMG/M |
| 3300025888|Ga0209540_10023599 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 3797 | Open in IMG/M |
| 3300025888|Ga0209540_10025064 | Not Available | 3679 | Open in IMG/M |
| 3300025888|Ga0209540_10045971 | All Organisms → cellular organisms → Bacteria | 2694 | Open in IMG/M |
| 3300025888|Ga0209540_10070227 | All Organisms → cellular organisms → Bacteria | 2156 | Open in IMG/M |
| 3300025891|Ga0209585_10299164 | Not Available | 644 | Open in IMG/M |
| 3300026223|Ga0209840_1069352 | Not Available | 775 | Open in IMG/M |
| 3300026272|Ga0209913_1002808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7403 | Open in IMG/M |
| 3300026273|Ga0209881_1014148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 1854 | Open in IMG/M |
| 3300026365|Ga0255360_1027890 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300026450|Ga0247847_1004974 | All Organisms → cellular organisms → Bacteria | 2120 | Open in IMG/M |
| 3300027051|Ga0209269_1056530 | Not Available | 648 | Open in IMG/M |
| 3300027703|Ga0207862_1197381 | Not Available | 598 | Open in IMG/M |
| (restricted) 3300028576|Ga0255340_1018879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium ADurb.BinA094 | 4637 | Open in IMG/M |
| 3300031256|Ga0315556_1297315 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300031707|Ga0315291_10536041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1077 | Open in IMG/M |
| 3300031772|Ga0315288_10019792 | All Organisms → cellular organisms → Bacteria | 8358 | Open in IMG/M |
| 3300031873|Ga0315297_10092065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2389 | Open in IMG/M |
| 3300031873|Ga0315297_10582110 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300031997|Ga0315278_10314006 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300031999|Ga0315274_10675113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1123 | Open in IMG/M |
| 3300032020|Ga0315296_10142417 | Not Available | 1485 | Open in IMG/M |
| 3300032053|Ga0315284_10048061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5887 | Open in IMG/M |
| 3300032053|Ga0315284_10753535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1134 | Open in IMG/M |
| 3300032143|Ga0315292_10135626 | All Organisms → cellular organisms → Bacteria | 1964 | Open in IMG/M |
| 3300032143|Ga0315292_10494243 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300032143|Ga0315292_10674690 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300032156|Ga0315295_10144997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2355 | Open in IMG/M |
| 3300032164|Ga0315283_10222754 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
| 3300032164|Ga0315283_11409449 | Not Available | 717 | Open in IMG/M |
| 3300032164|Ga0315283_11551534 | Not Available | 676 | Open in IMG/M |
| 3300032177|Ga0315276_10180867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2206 | Open in IMG/M |
| 3300032177|Ga0315276_10442936 | Not Available | 1393 | Open in IMG/M |
| 3300032342|Ga0315286_10552754 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300032342|Ga0315286_10652554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1079 | Open in IMG/M |
| 3300032342|Ga0315286_11034585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 814 | Open in IMG/M |
| 3300032397|Ga0315287_11276950 | Not Available | 841 | Open in IMG/M |
| 3300032397|Ga0315287_12133005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 613 | Open in IMG/M |
| 3300032401|Ga0315275_10664961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1160 | Open in IMG/M |
| 3300032401|Ga0315275_10900700 | Not Available | 976 | Open in IMG/M |
| 3300032401|Ga0315275_11773570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 656 | Open in IMG/M |
| 3300032516|Ga0315273_10680775 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300032516|Ga0315273_11160170 | Not Available | 976 | Open in IMG/M |
| 3300032516|Ga0315273_11679998 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300032516|Ga0315273_13181268 | Not Available | 508 | Open in IMG/M |
| 3300033177|Ga0334883_1010538 | All Organisms → cellular organisms → Bacteria | 6285 | Open in IMG/M |
| 3300033982|Ga0371487_0106600 | Not Available | 1465 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 40.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 18.75% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 5.62% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 3.12% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 3.75% |
| Anaerobic Digester Digestate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate | 3.75% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 2.50% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.88% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.88% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.88% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.25% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.25% |
| Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 1.25% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.62% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.62% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.62% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.62% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.62% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface | 0.62% |
| Aquifer Solids | Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Aquifer Solids | 0.62% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.62% |
| Anaerobic Wastewater Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Wastewater Sludge | 0.62% |
| Sediment | Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment | 0.62% |
| Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge | 0.62% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 0.62% |
| Defined Medium | Engineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
| 2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 3300002068 | Barrow Graham LP Ref core NGADG0004-212 (Barrow Graham LP Ref core NGADG0004-212,NGADG0011-311, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300002071 | Barrow Graham LP Ref core NGADG0011-312 (Barrow Graham LP Ref core NGADG0011-312,NGADG0011-212, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300002072 | Barrow Graham LP Ref core NGADG0011-211 (Barrow Graham LP Ref core NGADG0011-211,NGADG0004-312, ASSEMBLY_DATE=20131005) | Environmental | Open in IMG/M |
| 3300002179 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A | Environmental | Open in IMG/M |
| 3300002515 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A | Environmental | Open in IMG/M |
| 3300002538 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 | Environmental | Open in IMG/M |
| 3300002550 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 | Environmental | Open in IMG/M |
| 3300002551 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211 | Environmental | Open in IMG/M |
| 3300002563 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 | Environmental | Open in IMG/M |
| 3300002565 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-311 | Environmental | Open in IMG/M |
| 3300002569 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 | Environmental | Open in IMG/M |
| 3300003364 | Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/21 | Environmental | Open in IMG/M |
| 3300005254 | Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG | Engineered | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300006972 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-A | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009362 | Syntrophic microbial communities from biogas reactors - R1.C13.But.A IBDA | Engineered | Open in IMG/M |
| 3300009566 | Methanogenic o-xylene degrading microbial communities from aquifer solids in Pensacola, Florida - enrichment culture X8-AB | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009771 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG | Engineered | Open in IMG/M |
| 3300010344 | AD_JPASca | Engineered | Open in IMG/M |
| 3300010353 | AD_USCAca | Engineered | Open in IMG/M |
| 3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013232 | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1 | Engineered | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014256 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D2 | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017987 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_1 metaG | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020163 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-8m | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020812 | Anaerobic digester digestate microbial community, University of Toronto, Ontario, Canada - DG074 megahit | Engineered | Open in IMG/M |
| 3300020813 | Anaerobic digester digestate microbial community, University of Toronto, Ontario, Canada - DG078 megahit | Engineered | Open in IMG/M |
| 3300021069 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L224-25m | Environmental | Open in IMG/M |
| 3300021070 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-13m | Environmental | Open in IMG/M |
| 3300021074 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-17m | Environmental | Open in IMG/M |
| 3300021473 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-15m | Environmental | Open in IMG/M |
| 3300021520 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8m | Environmental | Open in IMG/M |
| 3300022177 | Enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.S | Engineered | Open in IMG/M |
| 3300023203 | Combined Assembly of Gp0238866, Gp0238878 | Engineered | Open in IMG/M |
| 3300023232 | Peat soil microbial communities from Stordalen Mire, Sweden - IR.F.S.T0 | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025575 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-33A (SPAdes) | Environmental | Open in IMG/M |
| 3300025600 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-31A (SPAdes) | Environmental | Open in IMG/M |
| 3300025692 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes) | Environmental | Open in IMG/M |
| 3300025716 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025739 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes) | Environmental | Open in IMG/M |
| 3300025750 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-311 (SPAdes) | Environmental | Open in IMG/M |
| 3300025764 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes) | Environmental | Open in IMG/M |
| 3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025852 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes) | Environmental | Open in IMG/M |
| 3300025864 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025865 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026272 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 (SPAdes) | Environmental | Open in IMG/M |
| 3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
| 3300026365 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T50 | Environmental | Open in IMG/M |
| 3300026450 | Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T25 | Environmental | Open in IMG/M |
| 3300027051 | Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300028576 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant10 | Engineered | Open in IMG/M |
| 3300031256 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032020 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033177 | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_09_05-R1 | Engineered | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Perma_A_C_01186650 | 2124908032 | Soil | VGVHRGLQADDVHDTVGFGLSALLSLDRLNLVESII |
| Perma_A_C_00971070 | 2124908032 | Soil | EVGVHRGLQADDANDTVGFGLSALLSLGRLNLVESII |
| Bog_all_C_01439480 | 2140918008 | Soil | QEIVGCAINDRAESVEVGVHRGLRADGADDTVGFGLSVSLSLCMPDLVESII |
| JGIcombinedJ21913_100650224 | 3300002068 | Arctic Peat Soil | VPSCLWQEIVGCAINDRAESVEVGVHRGLQADGDIGTVGFGLSALLSLDAVGFVESXX* |
| JGIcombinedJ21913_100678351 | 3300002068 | Arctic Peat Soil | IVGCAINDRAESVEVGVHRGLQADGDLGTVGFGFSALLSLDTANLVESII* |
| JGIcombinedJ21913_100868032 | 3300002068 | Arctic Peat Soil | GVHRGLQADDANDTVGFGLSALLSLGRLNLVESMI* |
| JGIcombinedJ21913_101363102 | 3300002068 | Arctic Peat Soil | VPSCLWQEIVGCAINDRAESVEVGVHRGLQADGADDTVGFGLSALLSLGRANLVESII* |
| JGIcombinedJ21913_102296071 | 3300002068 | Arctic Peat Soil | AESVEVGVHRGLQADDANDTVGFGLSALLSLGRLNLVESII* |
| JGIcombinedJ21915_1000255210 | 3300002071 | Arctic Peat Soil | RAESVEVGVHRGLQADDANDTVGFGLSALLSLGRLNLVESII* |
| JGIcombinedJ21915_100918481 | 3300002071 | Arctic Peat Soil | GVHRGLQADDANDTVGFGLSALLSLGRLNLVESXX* |
| JGIcombinedJ21915_101666362 | 3300002071 | Arctic Peat Soil | NDRAESVEVGVHRGLRADGDLRTVGFGLSALLSLDTADLVESII* |
| JGIcombinedJ21914_102114991 | 3300002072 | Arctic Peat Soil | SVEVGVHRGLQADDVNDTVGFGLSALLSLGAVGFVESII* |
| JGI24141J26756_10252692 | 3300002179 | Arctic Peat Soil | LPCPWQKIGGCAINDRAESVEVGVHRGLQADDADDTVGFGLSALLSLGRLNLVESII* |
| JGI24144J35610_101339152 | 3300002515 | Arctic Peat Soil | SVEVGVHRGLQADGDLGTVGFGLSALLSLDRADLVESVI* |
| JGI24132J36420_100173005 | 3300002538 | Arctic Peat Soil | AESVEVGVHRGLQADGDLGTVGFGLSALLSLDRRNLVESVI* |
| JGI24131J36419_101247121 | 3300002550 | Arctic Peat Soil | VLPWLWEKIVGCAIDDRAESVEVGVHRGLQADDANDTVGFGLSALLSLGRLNLVESII* |
| JGI24135J36437_10031108 | 3300002551 | Arctic Peat Soil | RAESVEVGVHRGLQADGDIGTVGFGLSALLSLDAVGFVESII* |
| JGI24138J36424_100943261 | 3300002563 | Arctic Peat Soil | DRAESVEVGVHRGLQADGDLGTVGFGLSALLSLCTPEADLVESVI* |
| JGI24138J36424_101587532 | 3300002563 | Arctic Peat Soil | IVGCAINDRAESVEVGVHRGFQADGDLGTVGFGLSALLSLDRADLVESVI* |
| JGI24137J36423_10337551 | 3300002565 | Arctic Peat Soil | CLWQEIVGCAINDRAESVEVGVHRGLQADGADDTVGFGLSALLSLGRANLVESIX* |
| JGI24137J36423_10831813 | 3300002565 | Arctic Peat Soil | CLWQEIVGCAINDRAESVEVGVHRGLQADGDIGTVGFGLSALLSLDAVGFVESII* |
| JGI24137J36423_11004172 | 3300002565 | Arctic Peat Soil | WQEIVGCAINDRAESVEVGVHRGLQADGDIGTVGFGLSALLSLDAVGFVESII* |
| JGI24136J36422_100349013 | 3300002569 | Arctic Peat Soil | ESVEVGVHRGLQADDVHDTVGFGLSALLSLGAVGFVESII* |
| JGI24136J36422_101338393 | 3300002569 | Arctic Peat Soil | DRAESVEVGVHRGLQADDANDTVGFGLSALLSLDTADLVESII* |
| JGI25320J50211_10192901 | 3300003364 | Deep Subsurface | HWQKIVGCAINVGAESVEVGVHRGLRVDGVLDTADFGLSASFSLDSMVNPVESII* |
| Ga0068714_1001097011 | 3300005254 | Enrichment Culture | RWQEVVGCAIDDRAESVEVGVHRGLRADGDFGTVGFGLSALLSLDTVNLVESII* |
| Ga0066794_101773671 | 3300005947 | Soil | CLWQEIVGCAIDDRAESVEVGVHRGLQADGADDTVGFGLSALLSLGRANLVESII* |
| Ga0075527_102116053 | 3300006640 | Arctic Peat Soil | SVEVGVHRGLQADGDLGTVGFGLSALLSLDAVRFVESIN* |
| Ga0075520_10060911 | 3300006795 | Arctic Peat Soil | SVEVGVHRGLQADGDLGTVGFGLSALLSLDRRNLVESIV* |
| Ga0075520_10258324 | 3300006795 | Arctic Peat Soil | ESVEVGVHRGLQADGDLGTVGFGLSALLSLGTAELVESII* |
| Ga0066797_10357841 | 3300006864 | Soil | ESVEVGVHRGLQADGDIGTVGFGLSALLSLDAADLVESII* |
| Ga0066797_11029931 | 3300006864 | Soil | ESVEVGVHRGLQADDANDTVGFGLSALLSLGRLNLVESII* |
| Ga0066797_11786731 | 3300006864 | Soil | QKIGGCAINDRAESVEVGVHRGLRADGDLGTVGFGLSALLSLCTADPVESII* |
| Ga0066797_13249222 | 3300006864 | Soil | SVEVGVHRGLQADDANDTVGFGLSALLSLDTADLVESII* |
| Ga0066797_13606311 | 3300006864 | Soil | INDRAESVEVGVHRGLQADDVHDTVGFGLSALLSLDRLNLVESII* |
| Ga0075528_1000076010 | 3300006949 | Arctic Peat Soil | GCAINDRAESVEVGVHRGLQADGDLGTVGFGLSALLSLDRADLVESVI* |
| Ga0075524_102192601 | 3300006950 | Arctic Peat Soil | IVGCAINDRAESVEVGVHRGLRADGDLRTVGFGLSALLSLDAVRFVESIN* |
| Ga0075524_103231231 | 3300006950 | Arctic Peat Soil | CAINDRAESVEVGVHRGLQADDANDTVGFGLSALLSLGRLNLVESII* |
| Ga0075524_103803801 | 3300006950 | Arctic Peat Soil | VEVGVHRGLQADDANDTVGFGLSALLSLDTADLVESII* |
| Ga0075524_103933082 | 3300006950 | Arctic Peat Soil | CLWQKIVGCAINDRAESVEVGVHRGLQADDVHDSVGFGLSALLSLCLPDLVESII* |
| Ga0075518_10372772 | 3300006972 | Arctic Peat Soil | SCLWQEIVGCAINDRAESVEVGVHRGLQADGDLGTVGFGLSALLSLDRADLVESVI* |
| Ga0075518_10383352 | 3300006972 | Arctic Peat Soil | VEVGVHRGLQADGDLGTVGFGLSALLSLCRANLVESII* |
| Ga0066793_102196112 | 3300009029 | Prmafrost Soil | MIACATHGGAIDHGAESVEVGVHRGLRADGDLSTVGFGLSALLSLDTVRLVESII* |
| Ga0066793_102982613 | 3300009029 | Prmafrost Soil | VGCAINDRAESVEVGVHRGLRADGDLRTVGFGLSALLSLDTADLVESII* |
| Ga0066793_106912081 | 3300009029 | Prmafrost Soil | SVEVGVHRGLQADDVHDTVGFGLSALLSLDRLNLVESII* |
| Ga0118673_11314022 | 3300009362 | Anaerobic Wastewater Sludge | GAEGVQVGVHRGLRAGGVLGTVGFGLSALLSLDRLNLVESII* |
| Ga0130025_11456312 | 3300009566 | Aquifer Solids | GCAINHRAESVEVGVHRGLRADGVLDTVGFGLSALLSLDIVNLVESTI* |
| Ga0116215_15282462 | 3300009672 | Peatlands Soil | VEVGVHRGLQADGDLGTVGFGLSALLSLGEADLVESII* |
| Ga0116155_101277852 | 3300009771 | Anaerobic Digestor Sludge | AESVEVGVHRGLRVDGECTVGFGLSALLSLLMPRFVESVI* |
| Ga0116243_106637041 | 3300010344 | Anaerobic Digestor Sludge | VPSRLWQKVIGCAINHGAESVEVGVHRGLRADGVFGTVGFGLSALLSLDRLNLVESII* |
| Ga0116236_102615422 | 3300010353 | Anaerobic Digestor Sludge | ESVEVGVHRGLRADGVLDTVGFGLSALLPLNIVNLVESII* |
| Ga0116236_105887431 | 3300010353 | Anaerobic Digestor Sludge | VEVGVHRGLRADGVLDTVGFGLSALLPLNIVNLVESII* |
| (restricted) Ga0172368_100662902 | 3300013123 | Freshwater | VHRGLSVDGVFGTVGFGLSALLSLGKLNLVESII* |
| (restricted) Ga0172375_108592181 | 3300013137 | Freshwater | RAESVEVGVHRGLRADDGVLGTVGFGLSALLSLDRLNLVESII* |
| Ga0170573_101429691 | 3300013232 | Sediment | RAESVEVGVHRGLQADDVHDTVGFGLSALLSLDRLNLVESII* |
| Ga0181517_101678123 | 3300014160 | Bog | QKIVGCAINHGAESVEVGVHRGLRADGVLGTVGFGLSASLSLDTVDLVESII* |
| Ga0181538_101514923 | 3300014162 | Bog | WQKVVGCAINDRTESVEVGVHRGLRVGDVLGTVGFGLPALLSFDRLKSVESII* |
| Ga0075318_11486791 | 3300014256 | Natural And Restored Wetlands | GCAIDDGAESVEVGVHRGLRADGVLGTVGFGLSALLSLDRLNLVESII* |
| Ga0182014_100006821 | 3300014491 | Bog | ESVEVGVHRGLRADGVRSTVGFGLSALFSLGTVNLVESII* |
| Ga0182014_102961101 | 3300014491 | Bog | SVEVGVHRGLRADGDIGTVGFGLSALLSLGTVNLVESII* |
| Ga0182014_103360252 | 3300014491 | Bog | VEVGVHRGLRADGVRSTVGFGLSALFSLGTVNLVESII* |
| Ga0182011_107157102 | 3300014496 | Fen | VRCAINDRAESVEVGVHRGLRVGDVLGNAGFGLSALLSSDRLKSVESII* |
| Ga0182021_110971372 | 3300014502 | Fen | VEVGVHRGLRADGDIGTVGFGLSALLSLGTVNLVESII* |
| Ga0181519_109778762 | 3300014658 | Bog | WQKVVGCAINHGAESVEVGVHRGLRADGVLGTVGFGLSASLSLDTVDLVESII* |
| Ga0182027_107402102 | 3300014839 | Fen | VRPGLWQKVVGCAINHGAESVEVGVHRGLRADGVRSTVGFGISALFSLGTVNLVESII* |
| Ga0182027_111095892 | 3300014839 | Fen | VRPGLWQKVVGCAINHGAESVEVGVHRGLRADGVRSTVGFGLSALFSLGTVNLVESII* |
| Ga0182027_122435342 | 3300014839 | Fen | AESVEVGVHRGLRADGVFGTVGFGLSALFSLDRLNLVESII* |
| Ga0187847_107921382 | 3300017948 | Peatland | AINHGAESVEVGVHRGLRADGVLGTVGFGLSASLSLDTVDLVESII |
| Ga0180431_109033901 | 3300017987 | Hypersaline Lake Sediment | IVGCDIDDRAESVEVGVHRGLSVDGTVSTVGFDLSAFRSLSMGGFVESII |
| Ga0187867_101543321 | 3300018033 | Peatland | VVGCGINHGSESVEVGVHRGRRPDGVLFTVGFGRSASLSLDTVDLVESII |
| Ga0187774_111043591 | 3300018089 | Tropical Peatland | VGVHRGLRADGVCLSTVGFDLSALLSLAMPKSVESII |
| Ga0194039_10400602 | 3300020163 | Anoxic Zone Freshwater | ESVEVGVHRGLQADDVHDSVGFGLSALLSLCRLGFVESII |
| Ga0194127_108526462 | 3300020221 | Freshwater Lake | DDRAESVEVGVHRGLRVDGVMSTVGFDLSAFRSLSRLGFVESII |
| Ga0214071_12113461 | 3300020812 | Anaerobic Digester Digestate | KIVGCDIDDRAESVQVGVHRGLRADGDMSTVGFGLSALLSLGRLNLVESII |
| Ga0214071_12852351 | 3300020812 | Anaerobic Digester Digestate | DDRAESVQVGVHRGLRADGDMSTVGFGLSALLSLGRLNLVESII |
| Ga0214071_16682031 | 3300020812 | Anaerobic Digester Digestate | KIVGCDIDDRAESVQVGVHRGLRADGDMSTVGFGLSALLSLGRLNLGESII |
| Ga0214086_12370022 | 3300020813 | Anaerobic Digester Digestate | QVGVHRGLRADGDMSTVGFGLSALLSLGRLNLVESII |
| Ga0194062_10520962 | 3300021069 | Anoxic Zone Freshwater | AESVEVGVHRGLQADDVNDSVGFGLSALLSLCRLNLVESII |
| Ga0194056_100544571 | 3300021070 | Anoxic Zone Freshwater | EVGVHRGLQADDVNDSVGFGLSALLSLCRLNLVESII |
| Ga0194044_101869231 | 3300021074 | Anoxic Zone Freshwater | VEVGVHRGLQADDVNDTVGFGLSALLSLCVPDLVESII |
| Ga0194043_11814962 | 3300021473 | Anoxic Zone Freshwater | IGGCAINDCAESVEVGVHRGLKADDVHDSVGFGLSALLSLCRLNLVESII |
| Ga0194053_100808472 | 3300021520 | Anoxic Zone Freshwater | PSYLWQKIGGCAINDNAESVEVGVHRGLQADDVNDSVGFGLSALLSLCRLNLVESII |
| Ga0228536_10010891 | 3300022177 | Defined Medium | AESVEVGVHRGLRADGVMSTVGFDLSAFRSLVMPQFVESII |
| Ga0255812_103181282 | 3300023203 | Anaerobic Digester Digestate | RAESVQVGVHRGLRADGDMSTVGFGLSALLSLGRLNLVESII |
| Ga0255812_107633831 | 3300023203 | Anaerobic Digester Digestate | DIDDRAESVQVGVHRGLRADGDMSTVGFGLSALLSLGRLNLVESII |
| Ga0224516_10354742 | 3300023232 | Soil | IDDRTESVEVGVHRGLRADGVLGTVGFGLSALLSLGTADLVESII |
| Ga0207932_10871551 | 3300025495 | Arctic Peat Soil | CAINDRAESVEVGVHRGLQADDVHDTVGFGLSALLSLGAVGFVESII |
| Ga0209430_10288193 | 3300025575 | Arctic Peat Soil | AESVEVGVHRGLQADDANDTVGFGLSALLSLGRLNLVESII |
| Ga0209430_10799432 | 3300025575 | Arctic Peat Soil | VGCAINDRAESVEVGVHRGLQADGDLGTVGFGLSALLSLDRADLVESVI |
| Ga0209125_10415641 | 3300025600 | Arctic Peat Soil | VEVGVHRGLQADGDLGTVGFGLSALLSLCTPEADLVESVI |
| Ga0209744_10298706 | 3300025692 | Arctic Peat Soil | VGVHRGLQADGDLGTVGFGLSALLSLCRANLVESII |
| Ga0209744_11363753 | 3300025692 | Arctic Peat Soil | AESVEVGVHRGLRADGDLRTVGFGLSALLSLDTADLVESII |
| Ga0209746_11627392 | 3300025716 | Arctic Peat Soil | ESVEVGVHRGLQADGDLGTVGFGLSALLSLDGANLVDSII |
| Ga0209746_12032311 | 3300025716 | Arctic Peat Soil | INDSAESVEVGVHRGLQADGDIGTVGFGLSALLSLDAVGFVESII |
| Ga0209745_10784772 | 3300025739 | Arctic Peat Soil | RAESVEVGVHRGLQADGDLGTVGFGLSALLSLDGANLVESII |
| Ga0209745_11443221 | 3300025739 | Arctic Peat Soil | AESVEVGVHRGLQADGDLGTVGFGLSALLSLDTLGFVESII |
| Ga0209747_11127041 | 3300025750 | Arctic Peat Soil | SVEVGVHRGLQADGDLGTVGFGLSALLSLDGANLVESII |
| Ga0209747_12110972 | 3300025750 | Arctic Peat Soil | CAINDRAESVEVGVHRGLQADGDIGTVGFGLSALLSLDAVGFVESII |
| Ga0209539_10053251 | 3300025764 | Arctic Peat Soil | VEVGVHRGLQADDANDTVGFGLSALLSLGRLNLVESII |
| Ga0209539_10133074 | 3300025764 | Arctic Peat Soil | AESVEVGVHRGLQADGADDTVGFGLSALLSLGRANLVESII |
| Ga0209539_11010752 | 3300025764 | Arctic Peat Soil | ESVEVGVHRGLQADGDLGTVGFGLSALLSLGMADLVESII |
| Ga0209539_11266431 | 3300025764 | Arctic Peat Soil | VEVGVHRGLQADGDLGTVGFGLSALLSLCRANLVESII |
| Ga0209539_11434991 | 3300025764 | Arctic Peat Soil | NDRGESVEVGVHRGLQADGADDTVGFGLSALLSLGRANLVESII |
| Ga0209539_11927461 | 3300025764 | Arctic Peat Soil | VGVHRGLQADDANDTVGFGLSALLSLGRLNLVESII |
| Ga0209539_12457582 | 3300025764 | Arctic Peat Soil | QKIVGCAINDRAESVEVGVHRGLQADGDIGTVGFGLSALLSLDAADLVESII |
| Ga0209538_10031061 | 3300025846 | Arctic Peat Soil | ESVEVGVHRGLQADDANDTVGFGLSALLSLGRLNLVESII |
| Ga0209538_10537391 | 3300025846 | Arctic Peat Soil | RAESVEVGVHRGLQADGDLGTVGFGLSALLSLDRADLVESVI |
| Ga0209538_11604961 | 3300025846 | Arctic Peat Soil | WQKIGGCAINDRAESVEVGVHRGLQADDANDTVGFGLSALLSLGRLNLVESII |
| Ga0209124_103444792 | 3300025852 | Arctic Peat Soil | FWQKIVGCAINHRAESVEVGVHRGLRVGDAECTVGFGLSALLPLHTVRFVESII |
| Ga0209429_100617185 | 3300025864 | Arctic Peat Soil | IVGCAINDRAESVEVGVHRGLQADGDLGTVGFGLSALLSLDRRNLVESVI |
| Ga0209429_101129071 | 3300025864 | Arctic Peat Soil | IVGCAINDRAESVEVGVHRGLQADGDLGTVGFGLSALLSLDRADLVESVI |
| Ga0209226_102430172 | 3300025865 | Arctic Peat Soil | VEVGVHRGLQADDANDTVGFGLSALLSLDTADLVESII |
| Ga0209226_102518042 | 3300025865 | Arctic Peat Soil | EIVGCAINDRAESVEVGVHRGLQADGDLGTVGFGLSALLSLDGANLVDSII |
| Ga0209226_102715191 | 3300025865 | Arctic Peat Soil | VGCAINDRAESVEVGVHRGLQADGDIGTVGFGLSALLSLDAVGFVESII |
| Ga0209540_100235996 | 3300025888 | Arctic Peat Soil | EVGVHRGLQADDANDTVGFGLSALLSLDTADLVESII |
| Ga0209540_100250641 | 3300025888 | Arctic Peat Soil | PCLWQKIGGCAINDRAESVEVGVHRGLQADDVHDTVGFGLSALLSLGRLNLVESII |
| Ga0209540_100459714 | 3300025888 | Arctic Peat Soil | INDRAESVEVGVHRGLQADDVHDTVGFGLSALLSLGAVGFVESII |
| Ga0209540_100702271 | 3300025888 | Arctic Peat Soil | SVEVGVHRGLQADDANDTVGFGLSALLSLDTADLVESII |
| Ga0209585_102991642 | 3300025891 | Arctic Peat Soil | INDRAESVEVGVHRGLQADDANDTVGFGLSALLSLDTADLVESII |
| Ga0209840_10693522 | 3300026223 | Soil | AESVEVGVHRGLQADDVHDTVGFGLSALLSLDRLNLVESII |
| Ga0209913_10028088 | 3300026272 | Soil | GELPAGIPSCRWQKIGGCAINDRAESVEVGVHRGLQADDANDTVGFGLSALLSLGRLNLVESII |
| Ga0209881_10141481 | 3300026273 | Soil | ESVEVGVHRGLQADDANDTVGFGLSALLSLDTADLVESII |
| Ga0255360_10278901 | 3300026365 | Soil | ESVEVGVHRGLRADGDIGTVGFGLSALLSLGTVNLVESII |
| Ga0247847_10049741 | 3300026450 | Soil | TESVEVGVHRGLRADGVLGTVGFGLSALLSLGTADLVESII |
| Ga0209269_10565301 | 3300027051 | Enrichment Culture | RSSAESVEVGVHRGLSVDGVSGTVGFDLSVLSSLDRLNLVESII |
| Ga0207862_11973812 | 3300027703 | Tropical Forest Soil | DGAESVEVGVHRGLRVDGVLGTVGFDLSAFLSLRTLKFVESLI |
| (restricted) Ga0255340_10188791 | 3300028576 | Wastewater | WQKIVGCAINHRAESVEVGVHRGLRADGVLDTVGFGLSALLSLDRLNLVESII |
| Ga0315556_12973152 | 3300031256 | Salt Marsh Sediment | RLWQEIVGCGVDERAESVEVGVHRGLRADGVFGTVGFGLSALLSLDAADLVESII |
| Ga0315291_105360411 | 3300031707 | Sediment | VEVGVHRGLRADGVLDTVGFGLSALLSLRRLKVVESII |
| Ga0315288_1001979210 | 3300031772 | Sediment | AESVEVGVHRGLQADGVHDTVGFGLSALLSLCRLNLVESII |
| Ga0315297_100920654 | 3300031873 | Sediment | VGVHRGLQADGDLGTVGFGLSALLSLRTAEADLVESII |
| Ga0315297_105821101 | 3300031873 | Sediment | CLWQEIVGCAINDRAESVEVGVHRGLQADGDLGTVGFGLSALLSLGRLNLVESII |
| Ga0315278_103140061 | 3300031997 | Sediment | AESVEVGVHRGLRADGDLGTVGFGLSALLSLDTADLVESII |
| Ga0315274_106751133 | 3300031999 | Sediment | SVEVGVHRGLRVDGDLSTVGFGLSALLSLRRLNLVESII |
| Ga0315296_101424171 | 3300032020 | Sediment | AESVEVGVHRGLRADGVLDTVGFGLSVSLSLRRLKVVESII |
| Ga0315284_100480611 | 3300032053 | Sediment | SVEVGVHRGLQADGVHDTVGFGLSALLSLCRLNLVESII |
| Ga0315284_107535351 | 3300032053 | Sediment | GVHRGLQADGVHDTVGFGLSALLSLCRLNLVESII |
| Ga0315292_101356261 | 3300032143 | Sediment | NDRAESVEVGVHRGLQADGDLGTVGFGLSALLSLDRRNLVESII |
| Ga0315292_104942431 | 3300032143 | Sediment | GCAINDRAESVEVGVHRGLQADGDLGTVGFGLSALLSLCTADLVESII |
| Ga0315292_106746903 | 3300032143 | Sediment | CAINDRAESVEVGVHRGLQADGDLGTVGFGLSALLSLGTAEADLVESII |
| Ga0315295_101449971 | 3300032156 | Sediment | IDDRAESVEVGVHRGLRVDGVVSTVGFDLSASRSLSMPRFVESII |
| Ga0315283_102227541 | 3300032164 | Sediment | AESVEVGVHRGLRADGDPGTVGFGLSALLSLDTADLVESII |
| Ga0315283_114094491 | 3300032164 | Sediment | NDRAESVEVGVHRGLQADGDLGTVGFGLSALLSLCTADLVESII |
| Ga0315283_115515341 | 3300032164 | Sediment | QKVVGCAINDRAESVEVGVHRGLQADGDLGTVGFGLSALLSLGTADLVESII |
| Ga0315276_101808673 | 3300032177 | Sediment | RADSVEVGVHRGLQADGDIGTVGFGLSALLSLDTVGFVESTI |
| Ga0315276_104429361 | 3300032177 | Sediment | AESVEVGVHRGLQADDVHDTVGFGLSALLSLDRLNLVESIV |
| Ga0315286_105527542 | 3300032342 | Sediment | INDRAESVEVGVHRGLRADGDLGTVGFGLSALPSLDTADLVESII |
| Ga0315286_106525541 | 3300032342 | Sediment | ESVEVGVHRGLQADGVHDTVGFGLSALLSLCRLNLVESII |
| Ga0315286_110345853 | 3300032342 | Sediment | SVEVGVHRGLRADGDLGTVGFGLSALLSLDTADLVESII |
| Ga0315287_112769502 | 3300032397 | Sediment | KVVGCAINDRAESVEVGVHRGLQADGDLGTVGFGLSALLSLGTADLVESII |
| Ga0315287_121330052 | 3300032397 | Sediment | PRLWQEIVGCAINDRAESVEVGVHRGLQADGDLGTVGFGLSALLSLGRLNLVESII |
| Ga0315275_106649612 | 3300032401 | Sediment | LWQEIGGCAINDRAESVEVGVHRGLQADGDLGTVGFGLSALLSLCTADLVESII |
| Ga0315275_109007001 | 3300032401 | Sediment | QEIVGCAINDRAESVEVGVHRGLQADGDLGTVGFGLSALLSLGTPEADLVESII |
| Ga0315275_117735701 | 3300032401 | Sediment | AESVEVGVHRGLQADGDLGTVGFGLSALLSLGRLNLVESII |
| Ga0315273_106807751 | 3300032516 | Sediment | AESVEVGVHRGLRADGVLDTVGFGLSALLSLRVADLVESII |
| Ga0315273_111601701 | 3300032516 | Sediment | RVEVGVHRGLRVDGDLSTVGFGLSALLSLRRLNLVESII |
| Ga0315273_116799981 | 3300032516 | Sediment | EIVSCAINDRAESVEVGVHRGLRADGVLDTVGFGLSALLSLRMADLVESII |
| Ga0315273_131812682 | 3300032516 | Sediment | VEVGVHRGLRADGVLDTVGFGLSALLSLRVADLVESII |
| Ga0334883_101053811 | 3300033177 | Sludge | EVGVHRGLRADGVMSTVGFDLSAFRSLVMPQFVESII |
| Ga0371487_0106600_1330_1464 | 3300033982 | Peat Soil | CAINHGAESVEVGVHRGLRVDDAMSTVGFGLSASLSLRSLNLVE |
| ⦗Top⦘ |