


| Basic Information | |
|---|---|
| Family ID | F041134 |
| Family Type | Metagenome |
| Number of Sequences | 160 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPVVL |
| Number of Associated Samples | 136 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.03 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.50 % |
| Associated GOLD sequencing projects | 132 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.750 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.375 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (39.375 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.57% β-sheet: 0.00% Coil/Unstructured: 81.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF09335 | SNARE_assoc | 23.75 |
| PF00581 | Rhodanese | 7.50 |
| PF09084 | NMT1 | 2.50 |
| PF00561 | Abhydrolase_1 | 1.88 |
| PF00903 | Glyoxalase | 1.25 |
| PF02371 | Transposase_20 | 1.25 |
| PF08327 | AHSA1 | 1.25 |
| PF00355 | Rieske | 1.25 |
| PF07883 | Cupin_2 | 1.25 |
| PF10142 | PhoPQ_related | 1.25 |
| PF00175 | NAD_binding_1 | 0.62 |
| PF01546 | Peptidase_M20 | 0.62 |
| PF07681 | DoxX | 0.62 |
| PF01243 | Putative_PNPOx | 0.62 |
| PF01339 | CheB_methylest | 0.62 |
| PF04187 | Cofac_haem_bdg | 0.62 |
| PF01850 | PIN | 0.62 |
| PF01978 | TrmB | 0.62 |
| PF01202 | SKI | 0.62 |
| PF05988 | DUF899 | 0.62 |
| PF13460 | NAD_binding_10 | 0.62 |
| PF04909 | Amidohydro_2 | 0.62 |
| PF07687 | M20_dimer | 0.62 |
| PF12681 | Glyoxalase_2 | 0.62 |
| PF13649 | Methyltransf_25 | 0.62 |
| PF01553 | Acyltransferase | 0.62 |
| PF09994 | DUF2235 | 0.62 |
| PF12697 | Abhydrolase_6 | 0.62 |
| PF00884 | Sulfatase | 0.62 |
| PF01425 | Amidase | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 23.75 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 23.75 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 23.75 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 2.50 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 2.50 |
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 1.25 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.25 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.62 |
| COG3016 | Putative heme-binding protein PhuW | General function prediction only [R] | 0.62 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.62 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.75 % |
| Unclassified | root | N/A | 6.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0946176 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1002243 | All Organisms → cellular organisms → Bacteria | 3100 | Open in IMG/M |
| 3300003319|soilL2_10291204 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
| 3300003321|soilH1_10042185 | All Organisms → cellular organisms → Bacteria | 7388 | Open in IMG/M |
| 3300003324|soilH2_10207545 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300003993|Ga0055468_10084772 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 870 | Open in IMG/M |
| 3300004052|Ga0055490_10168584 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300004070|Ga0055488_10052046 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 892 | Open in IMG/M |
| 3300004156|Ga0062589_101009755 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300004633|Ga0066395_10488819 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 707 | Open in IMG/M |
| 3300005166|Ga0066674_10003974 | All Organisms → cellular organisms → Bacteria | 5636 | Open in IMG/M |
| 3300005174|Ga0066680_10042753 | All Organisms → cellular organisms → Bacteria | 2629 | Open in IMG/M |
| 3300005175|Ga0066673_10433890 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300005180|Ga0066685_10109395 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300005186|Ga0066676_10075605 | All Organisms → cellular organisms → Bacteria | 1987 | Open in IMG/M |
| 3300005293|Ga0065715_10404606 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300005294|Ga0065705_10024662 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 1363 | Open in IMG/M |
| 3300005295|Ga0065707_10245687 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300005332|Ga0066388_102324032 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300005364|Ga0070673_102179872 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 526 | Open in IMG/M |
| 3300005365|Ga0070688_100166022 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
| 3300005367|Ga0070667_100442884 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300005458|Ga0070681_10368690 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300005467|Ga0070706_100266829 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300005526|Ga0073909_10165566 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300005526|Ga0073909_10604710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300005529|Ga0070741_10000081 | All Organisms → cellular organisms → Bacteria | 348416 | Open in IMG/M |
| 3300005546|Ga0070696_100186429 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300005559|Ga0066700_10238341 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300005564|Ga0070664_100792676 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 886 | Open in IMG/M |
| 3300005576|Ga0066708_10837802 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 576 | Open in IMG/M |
| 3300005598|Ga0066706_10434285 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1046 | Open in IMG/M |
| 3300005713|Ga0066905_101097588 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300005840|Ga0068870_10124710 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300005888|Ga0075289_1001992 | All Organisms → cellular organisms → Bacteria | 2594 | Open in IMG/M |
| 3300005937|Ga0081455_10972434 | Not Available | 526 | Open in IMG/M |
| 3300006049|Ga0075417_10037720 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 2035 | Open in IMG/M |
| 3300006049|Ga0075417_10202242 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300006755|Ga0079222_10141583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1350 | Open in IMG/M |
| 3300006755|Ga0079222_10462478 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300006804|Ga0079221_11513356 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 539 | Open in IMG/M |
| 3300006844|Ga0075428_100335306 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
| 3300006844|Ga0075428_100973805 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300006845|Ga0075421_100789185 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300006845|Ga0075421_102388307 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006847|Ga0075431_100058094 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3990 | Open in IMG/M |
| 3300006852|Ga0075433_10184073 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1858 | Open in IMG/M |
| 3300006865|Ga0073934_10086011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2465 | Open in IMG/M |
| 3300006880|Ga0075429_100199569 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
| 3300006880|Ga0075429_100464739 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300006904|Ga0075424_100004023 | All Organisms → cellular organisms → Bacteria | 13829 | Open in IMG/M |
| 3300006914|Ga0075436_100496230 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Nitrospira defluvii | 893 | Open in IMG/M |
| 3300007004|Ga0079218_10045385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2686 | Open in IMG/M |
| 3300009100|Ga0075418_10376233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1517 | Open in IMG/M |
| 3300009147|Ga0114129_12854726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300009147|Ga0114129_13482230 | Not Available | 504 | Open in IMG/M |
| 3300009792|Ga0126374_11130504 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 623 | Open in IMG/M |
| 3300010037|Ga0126304_10452317 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300010040|Ga0126308_10155279 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300010043|Ga0126380_11095620 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300010043|Ga0126380_11800499 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300010046|Ga0126384_12033332 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300010047|Ga0126382_11344371 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 648 | Open in IMG/M |
| 3300010166|Ga0126306_10203800 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300010166|Ga0126306_10634716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300010333|Ga0134080_10513650 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300010359|Ga0126376_11427000 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 718 | Open in IMG/M |
| 3300010359|Ga0126376_12491648 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 565 | Open in IMG/M |
| 3300010360|Ga0126372_10682503 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1000 | Open in IMG/M |
| 3300010362|Ga0126377_11432177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 764 | Open in IMG/M |
| 3300010362|Ga0126377_11526266 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 742 | Open in IMG/M |
| 3300010362|Ga0126377_13078774 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300010373|Ga0134128_11751131 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 684 | Open in IMG/M |
| 3300010398|Ga0126383_13430073 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
| 3300010399|Ga0134127_12051566 | Not Available | 650 | Open in IMG/M |
| 3300010400|Ga0134122_11378911 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 717 | Open in IMG/M |
| 3300011444|Ga0137463_1066976 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300012203|Ga0137399_10677755 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium RBG_13_43_8 | 868 | Open in IMG/M |
| 3300012355|Ga0137369_10157172 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
| 3300012357|Ga0137384_10476544 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300012483|Ga0157337_1024236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300012489|Ga0157349_1009761 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300012489|Ga0157349_1024491 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 592 | Open in IMG/M |
| 3300012493|Ga0157355_1005574 | Not Available | 840 | Open in IMG/M |
| 3300012501|Ga0157351_1036609 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012685|Ga0137397_10242783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1341 | Open in IMG/M |
| 3300012685|Ga0137397_10807719 | Not Available | 696 | Open in IMG/M |
| 3300012685|Ga0137397_11123439 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012922|Ga0137394_10650010 | Not Available | 890 | Open in IMG/M |
| 3300012930|Ga0137407_11754269 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 592 | Open in IMG/M |
| 3300012948|Ga0126375_10960048 | Not Available | 692 | Open in IMG/M |
| 3300012948|Ga0126375_12090224 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 503 | Open in IMG/M |
| 3300013102|Ga0157371_10323779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1119 | Open in IMG/M |
| 3300013297|Ga0157378_10277167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1615 | Open in IMG/M |
| 3300014150|Ga0134081_10140129 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300014263|Ga0075324_1034059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
| 3300014263|Ga0075324_1172677 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 511 | Open in IMG/M |
| 3300014314|Ga0075316_1151030 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 587 | Open in IMG/M |
| 3300014320|Ga0075342_1089353 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 792 | Open in IMG/M |
| 3300015245|Ga0137409_10089760 | All Organisms → cellular organisms → Bacteria | 2861 | Open in IMG/M |
| 3300015372|Ga0132256_100735760 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300015372|Ga0132256_102306875 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300015374|Ga0132255_100674395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1533 | Open in IMG/M |
| 3300017792|Ga0163161_10293742 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300018000|Ga0184604_10029413 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300018028|Ga0184608_10043763 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300018052|Ga0184638_1238944 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 629 | Open in IMG/M |
| 3300018064|Ga0187773_10256062 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300018072|Ga0184635_10011257 | All Organisms → cellular organisms → Bacteria | 3129 | Open in IMG/M |
| 3300018075|Ga0184632_10136124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1082 | Open in IMG/M |
| 3300018078|Ga0184612_10146622 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1234 | Open in IMG/M |
| 3300018083|Ga0184628_10460018 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300018422|Ga0190265_12343226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300018422|Ga0190265_13207706 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300018431|Ga0066655_10273348 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1090 | Open in IMG/M |
| 3300018476|Ga0190274_10784210 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1008 | Open in IMG/M |
| 3300019356|Ga0173481_10090689 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300019377|Ga0190264_10529223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
| 3300019889|Ga0193743_1045169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1958 | Open in IMG/M |
| 3300021080|Ga0210382_10122480 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300022756|Ga0222622_11295518 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300024430|Ga0196962_10270649 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 555 | Open in IMG/M |
| 3300025310|Ga0209172_10110576 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300025315|Ga0207697_10220800 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 836 | Open in IMG/M |
| 3300025792|Ga0210143_1050357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 738 | Open in IMG/M |
| 3300025893|Ga0207682_10583024 | Not Available | 528 | Open in IMG/M |
| 3300025913|Ga0207695_10582792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1000 | Open in IMG/M |
| 3300025939|Ga0207665_10084867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2186 | Open in IMG/M |
| 3300025972|Ga0207668_10823639 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300025972|Ga0207668_10842187 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300025981|Ga0207640_10444239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1067 | Open in IMG/M |
| 3300026023|Ga0207677_10417702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1142 | Open in IMG/M |
| 3300026116|Ga0207674_10952811 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300026314|Ga0209268_1039215 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300026324|Ga0209470_1060892 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1785 | Open in IMG/M |
| 3300026327|Ga0209266_1024527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3282 | Open in IMG/M |
| 3300026535|Ga0256867_10299892 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300027722|Ga0209819_10237806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300027748|Ga0209689_1126615 | All Organisms → cellular organisms → Bacteria → Nitrospirae | 1276 | Open in IMG/M |
| 3300027765|Ga0209073_10163426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| 3300027909|Ga0209382_11893993 | Not Available | 576 | Open in IMG/M |
| 3300028381|Ga0268264_12285889 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300028885|Ga0307304_10565062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300031226|Ga0307497_10013233 | All Organisms → cellular organisms → Bacteria | 2396 | Open in IMG/M |
| 3300031231|Ga0170824_105304305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 894 | Open in IMG/M |
| 3300031538|Ga0310888_10251404 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300031538|Ga0310888_10353181 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300031548|Ga0307408_100071282 | All Organisms → cellular organisms → Bacteria | 2569 | Open in IMG/M |
| 3300031716|Ga0310813_10023840 | All Organisms → cellular organisms → Bacteria | 4221 | Open in IMG/M |
| 3300031852|Ga0307410_11261048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300031908|Ga0310900_10888308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300032075|Ga0310890_10455282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae | 963 | Open in IMG/M |
| 3300033412|Ga0310810_10170657 | All Organisms → cellular organisms → Bacteria | 2500 | Open in IMG/M |
| 3300033412|Ga0310810_10661508 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300033412|Ga0310810_10878124 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300033480|Ga0316620_10691560 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300033480|Ga0316620_11324697 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300033513|Ga0316628_103279431 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 588 | Open in IMG/M |
| 3300034149|Ga0364929_0205120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.62% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.38% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.12% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.50% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.50% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.50% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.88% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.88% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.88% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.25% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.25% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.25% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.25% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.25% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.62% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.62% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.62% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.62% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.62% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.62% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_09461761 | 2228664021 | Soil | VALLLRTKGITRVRPLEGGIDAWLADDFPFVTESLAKKPIVP |
| AF_2010_repII_A01DRAFT_10022435 | 3300000580 | Forest Soil | VALLLRAKGITRVRPLEGGIEAWLARNFPFVTESLVKKPVVL* |
| soilL2_102912041 | 3300003319 | Sugarcane Root And Bulk Soil | ATSARVALRLRAKGITRVRPLEGGLDAWLAHSFPFVTESLAKKPVVL* |
| soilH1_1004218510 | 3300003321 | Sugarcane Root And Bulk Soil | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPGII* |
| soilH2_102075452 | 3300003324 | Sugarcane Root And Bulk Soil | VALQLRAKGITRVRPLEGGIDAWLAYDFPFVTESLAKEPVLP* |
| Ga0055468_100847722 | 3300003993 | Natural And Restored Wetlands | VALLLVAKGITRVRPLEGGIDAWLAHDFPFATEDLVKKSAFL* |
| Ga0055490_101685841 | 3300004052 | Natural And Restored Wetlands | VALVLRAKGITRVRPLEGGIDAWLAYNFPSVTESLVKKPVVL* |
| Ga0055488_100520462 | 3300004070 | Natural And Restored Wetlands | VALLLRAKGITRVRPLEGGIDAWLAYNFPSVTESLVKKPVVL* |
| Ga0062589_1010097551 | 3300004156 | Soil | VALLLRTKGITRVRPLEGGIDAWLADDFPFVTESLAKKPIVP* |
| Ga0066395_104888191 | 3300004633 | Tropical Forest Soil | VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVVL* |
| Ga0066674_100039742 | 3300005166 | Soil | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTETLIKKSVVF* |
| Ga0066680_100427533 | 3300005174 | Soil | VALLLRAKGITRVRPLEGGIDAWLADNFPSVTESLVNKPVVL* |
| Ga0066673_104338902 | 3300005175 | Soil | VALQLRAKGITRVRPLEGGIDAWLADNFPFVTESLENKPVVL* |
| Ga0066685_101093952 | 3300005180 | Soil | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVNKPVVL* |
| Ga0066676_100756053 | 3300005186 | Soil | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTETLVKKSVVF* |
| Ga0065715_104046062 | 3300005293 | Miscanthus Rhizosphere | VALLLRAKGITRVRPLEGGIDGWLADNFPFVTESFVEKPVVL* |
| Ga0065705_100246622 | 3300005294 | Switchgrass Rhizosphere | VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTXSLVKKPVVL* |
| Ga0065707_102456872 | 3300005295 | Switchgrass Rhizosphere | VALLLRAKGITRVRPLEGGIDAWLASNFPFVTENLVEKSALP* |
| Ga0066388_1023240322 | 3300005332 | Tropical Forest Soil | VALLLRAKGITRVRPLEGGLDAWLEYNYPFVTENLVKKPAIL* |
| Ga0070673_1021798721 | 3300005364 | Switchgrass Rhizosphere | VALLLRAKGITGVRPLEGGIDAWLASNFPFVTESLVKKSVVL* |
| Ga0070688_1001660222 | 3300005365 | Switchgrass Rhizosphere | VALLLRAKGITRVRPLEGGIDAWLASNFPFVTESLVKKSVVL* |
| Ga0070667_1004428841 | 3300005367 | Switchgrass Rhizosphere | VALRLQAKGITRVRPLEGGIDAWLAHDFPFITESLVKKPVVL* |
| Ga0070681_103686902 | 3300005458 | Corn Rhizosphere | VALLLRGKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVVL* |
| Ga0070706_1002668292 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VALQLRAKGITRVRPLEGGIDAWLSDNFPFVTENLDRKPVVL* |
| Ga0073909_101655661 | 3300005526 | Surface Soil | EATSARVALQLRAKGITRVRPLEGGIAAWLAYNFPFVTESLVEKPVVL* |
| Ga0073909_106047101 | 3300005526 | Surface Soil | LRAKGITRVRPLEGGIAAWLAYNFPFVTESLVEKPVVL* |
| Ga0070741_10000081343 | 3300005529 | Surface Soil | VALQLRAKGITRVRPLEGGIDAWLSDNFPVVTEAPVDKSVVL* |
| Ga0070696_1001864292 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTENLDRKPVVL* |
| Ga0066700_102383414 | 3300005559 | Soil | RAKGITRVRPLEGGIDAWLAHNFPFATENLVKKPVAL* |
| Ga0070664_1007926761 | 3300005564 | Corn Rhizosphere | VALLLRAKGITRVRPLEGGIDAWLASNFPFVTESL |
| Ga0066708_108378022 | 3300005576 | Soil | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVETPVVL* |
| Ga0066706_104342853 | 3300005598 | Soil | VALLLRAKGITRVRPLEGGIDAWLAHNFPFATENLVKKPVAL* |
| Ga0066905_1010975882 | 3300005713 | Tropical Forest Soil | VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVIL* |
| Ga0068870_101247102 | 3300005840 | Miscanthus Rhizosphere | VALRLQAKGITRVRPLEGGIDAWLAHDFPFITESLVNKPVVL* |
| Ga0075289_10019924 | 3300005888 | Rice Paddy Soil | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPVVL* |
| Ga0081455_109724341 | 3300005937 | Tabebuia Heterophylla Rhizosphere | RAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPVVL* |
| Ga0075417_100377202 | 3300006049 | Populus Rhizosphere | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTENLDKQPVVL* |
| Ga0075417_102022422 | 3300006049 | Populus Rhizosphere | VALLLRAKGITRVRPLEGGIDAWLAFNFPSVTESLVNKPVVL* |
| Ga0079222_101415832 | 3300006755 | Agricultural Soil | ALRLQAKGITRVRPLEGGIDAWLAHDFPFITESLVKKPVVL* |
| Ga0079222_104624782 | 3300006755 | Agricultural Soil | VALLLRAKGITRVRPLEGGIDAWLAHNFPFVTESVVEKSVML* |
| Ga0079221_115133561 | 3300006804 | Agricultural Soil | VALLLRAKGITRVRPLEGGIDAWLAQNFPFVTESLVNKSVVL* |
| Ga0075428_1003353064 | 3300006844 | Populus Rhizosphere | VALLLRAKGITRVRPLEGGIDAWLAHNFPFVTENLVKKPVVL* |
| Ga0075428_1009738053 | 3300006844 | Populus Rhizosphere | VALQLRAKGITRVRPLENEIDAWLADNFPFVTESLVEKPVVL* |
| Ga0075421_1007891851 | 3300006845 | Populus Rhizosphere | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPVEL* |
| Ga0075421_1023883072 | 3300006845 | Populus Rhizosphere | VALQLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPAVL* |
| Ga0075431_1000580943 | 3300006847 | Populus Rhizosphere | VALQLRAKGITRVRPLENEIDAWLADNFPFVTESLVKKSVVL* |
| Ga0075433_101840733 | 3300006852 | Populus Rhizosphere | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLENKPVVL* |
| Ga0073934_100860112 | 3300006865 | Hot Spring Sediment | VALLLRAKGITRVRPLEGGIDAWLAHNFPFSTEELGKRSVIL* |
| Ga0075429_1001995691 | 3300006880 | Populus Rhizosphere | SARVALLLRAKGITRVRPLEGGIDAWLAYNFPFVTESLVKKPVVL* |
| Ga0075429_1004647393 | 3300006880 | Populus Rhizosphere | VALQLRAKGITRVRPLENEIDAWLADNFPFVTESLV |
| Ga0075424_1000040237 | 3300006904 | Populus Rhizosphere | VALLLRAKGITRVRPLEGGIDAWLAHDFPFVPENLGNKPVVL* |
| Ga0075436_1004962302 | 3300006914 | Populus Rhizosphere | VALLLRAKGITRVRPLEGGIDAWLASNFPFVTESLV |
| Ga0079218_100453856 | 3300007004 | Agricultural Soil | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVEKPVVL* |
| Ga0075418_103762331 | 3300009100 | Populus Rhizosphere | LLRAKGITRVRPLEGGIDAWLAHNFPFVTENLVKKPVVL* |
| Ga0114129_128547261 | 3300009147 | Populus Rhizosphere | LLRAKGITRVRPLEGGIDAWLAHNLPFVTENLDKQPVVL* |
| Ga0114129_134822301 | 3300009147 | Populus Rhizosphere | KGITRVRPLEGGIDAWLADNFPFVTESLENKPVVL* |
| Ga0126374_111305041 | 3300009792 | Tropical Forest Soil | TSARVALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVVL* |
| Ga0126304_104523172 | 3300010037 | Serpentine Soil | VALLLRAKGIIRVRPLEGGIDAWLADSLPFVTNGVVKKPFVL* |
| Ga0126308_101552791 | 3300010040 | Serpentine Soil | VALLLRAKGITRVRPLEGGIDAWRADNLPFVTDGVVKRPDGL* |
| Ga0126380_110956202 | 3300010043 | Tropical Forest Soil | VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLDKKPVVL* |
| Ga0126380_118004992 | 3300010043 | Tropical Forest Soil | VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKP |
| Ga0126384_120333321 | 3300010046 | Tropical Forest Soil | VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTKSLVKKPVVL* |
| Ga0126382_113443711 | 3300010047 | Tropical Forest Soil | SARVALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVVL* |
| Ga0126306_102038001 | 3300010166 | Serpentine Soil | ATSARVALLLRAKGITRVRPLEGGIDAWRADNLPFVTDGVVKKPFVL* |
| Ga0126306_106347162 | 3300010166 | Serpentine Soil | VALLLRAKGITRVRPLEGGIDAWRADNLPFVSDGVVKRPDGL* |
| Ga0134080_105136501 | 3300010333 | Grasslands Soil | VALLLRAKGITRVRPLQGGIDGWLADNFPFVTESLVEKPVV |
| Ga0126376_114270001 | 3300010359 | Tropical Forest Soil | RVALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVIL* |
| Ga0126376_124916481 | 3300010359 | Tropical Forest Soil | RVALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVVL* |
| Ga0126372_106825033 | 3300010360 | Tropical Forest Soil | RAKGITRVRPLEGGIDAWLAYDFPFVTDSLVKKPVVL* |
| Ga0126377_114321771 | 3300010362 | Tropical Forest Soil | LRAKGITRVRPLEGGIDAWLADNFPFVTESLVQKPVT* |
| Ga0126377_115262661 | 3300010362 | Tropical Forest Soil | VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTDSLVKKPVVL* |
| Ga0126377_130787741 | 3300010362 | Tropical Forest Soil | AKGITRVRPLEGGIDAWLAYDFPFVTESLDKKPVVL* |
| Ga0134128_117511312 | 3300010373 | Terrestrial Soil | VALLLRAKGITRVRPLEGGIDGWLADNFPFVTESYVEKPVVL* |
| Ga0126383_134300732 | 3300010398 | Tropical Forest Soil | SARVALLLRAKGITRVRPLEGGIDAWLAHDFPFVTESLVKKPVVL* |
| Ga0134127_120515662 | 3300010399 | Terrestrial Soil | ARVALLLRAKGITRVRPLEGGIDGWLADNFPFVTESFVEKPVVL* |
| Ga0134122_113789112 | 3300010400 | Terrestrial Soil | VALLLRAKGITRVRPLEGGIDGWLADNFPFVTESFVEKPIVL* |
| Ga0137463_10669763 | 3300011444 | Soil | MALLLRAKGIAKVRPLEGGIDAWLAYNFPFFTESLVRKPVVL* |
| Ga0137399_106777552 | 3300012203 | Vadose Zone Soil | VALQLRAKGITRVRPLEGGIDAWLAYNLPFVTESLVEKPVVLGETVSVIVTA |
| Ga0137369_101571722 | 3300012355 | Vadose Zone Soil | VALLLRAKGITRVRPLEGGIDGWLADNFPFVTESLVEKPVVL* |
| Ga0137384_104765442 | 3300012357 | Vadose Zone Soil | VALLLRAKGITRVRPLEGGIDAWLADTFPFVTETLIKKIGVF* |
| Ga0157337_10242362 | 3300012483 | Arabidopsis Rhizosphere | VALLLRAKGITRVRPLEGGIAAWLAYNFPFVTESLVEKPVVL* |
| Ga0157349_10097611 | 3300012489 | Unplanted Soil | VALQLRAKGITRVRPLEGGIAAWLAYNFPFVTESLVEKPV |
| Ga0157349_10244912 | 3300012489 | Unplanted Soil | VALLLRAKGITRVRPLEGGIDAWLASDFPFVTESLVEKSVVL* |
| Ga0157355_10055742 | 3300012493 | Unplanted Soil | QLRAKGITRVRPLEGGIDAWLAYNFPFVTESLVEKPVVL* |
| Ga0157351_10366091 | 3300012501 | Unplanted Soil | VALQLRAKGITRVRPLEGGIDAWLASDFPFVTESLVEKS |
| Ga0137397_102427832 | 3300012685 | Vadose Zone Soil | QLRAKGITRVRPLEGGIAAWLAYNFPFVTESLVEKPVVL* |
| Ga0137397_108077191 | 3300012685 | Vadose Zone Soil | MRVALLLRAKGITRVRPLEGGIDAWLANNFPFVTESLVKKPVVPL |
| Ga0137397_111234393 | 3300012685 | Vadose Zone Soil | VALQLGAKGITRVRPLEGGIDAWLADNFPFVTESLVEKPVVL* |
| Ga0137394_106500101 | 3300012922 | Vadose Zone Soil | MRVALLLRAKGITRVRPLEGGIDAWLAYNFPFVTESLVKKPVVL* |
| Ga0137407_117542691 | 3300012930 | Vadose Zone Soil | TSARVALLLRAKGITRVRPLEGGIDAWLADNFPSVTESLVNKPVVL* |
| Ga0126375_109600482 | 3300012948 | Tropical Forest Soil | LRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPVVL* |
| Ga0126375_120902241 | 3300012948 | Tropical Forest Soil | VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVVF* |
| Ga0157371_103237791 | 3300013102 | Corn Rhizosphere | RVALRLQAKGITRVRPLEGGIDAWLAHDFPFITESLVKKPVVL* |
| Ga0157378_102771672 | 3300013297 | Miscanthus Rhizosphere | VALLLRAKGINRVRPLEGGIDAWLASNFPFVTESLVKKSVVL* |
| Ga0134081_101401292 | 3300014150 | Grasslands Soil | LLLRAKGITRVRPLEGGIDAWLADNFPSVTESLVNKPVVL* |
| Ga0075324_10340592 | 3300014263 | Natural And Restored Wetlands | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPVVF* |
| Ga0075324_11726772 | 3300014263 | Natural And Restored Wetlands | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVNKPVVRDQLQL* |
| Ga0075316_11510302 | 3300014314 | Natural And Restored Wetlands | LSSSATLALLLRAKGITRVRPLEGGIDAWLAHEFPFDSHDIVKKSVVL* |
| Ga0075342_10893531 | 3300014320 | Natural And Restored Wetlands | VALLLRAKGIIRVRPLEGGIDAWLAHNFPFVTENLVKNPVAL* |
| Ga0137409_100897603 | 3300015245 | Vadose Zone Soil | VALQLRAKGITRVRPLEGGIDAWLAFNFPFVTERLVNKPVVL* |
| Ga0132256_1007357601 | 3300015372 | Arabidopsis Rhizosphere | AKGITRVRPLEGGIDAWLAYNFPFVTESLVEKPVVL* |
| Ga0132256_1023068752 | 3300015372 | Arabidopsis Rhizosphere | MALLLRAKGITKVRPLEGGIDAGLAYNFPFFTESLVRKPVVL* |
| Ga0132257_1018154551 | 3300015373 | Arabidopsis Rhizosphere | KGITRVRPLEGGIDAWLASNFPFVTESLVKNPFSERSSPF* |
| Ga0132255_1006743954 | 3300015374 | Arabidopsis Rhizosphere | VALLLRAKGITRVRPLEGGIDAWLASDFPFVTESLVE |
| Ga0163161_102937422 | 3300017792 | Switchgrass Rhizosphere | VALLLRAKGITRVRPLEGGIAAWLAYNFPFVTESLVEKPVVL |
| Ga0184604_100294132 | 3300018000 | Groundwater Sediment | VALLLRAKGIIRVRPLEGGIDGWLADNFPFVTESLVEKPVVL |
| Ga0184608_100437632 | 3300018028 | Groundwater Sediment | VALLLRAKGITRVRPLEGGIDGWLADNFPFVTESLVEKPVVL |
| Ga0184638_12389441 | 3300018052 | Groundwater Sediment | VALLLRAEGITRVRPLEGGIDGWLADNFPFVTESLVEKPVVL |
| Ga0187773_102560622 | 3300018064 | Tropical Peatland | VALLLRAKGITRVRPLEGGIDAWLADNFPFVIESLVKKPVVL |
| Ga0184635_100112572 | 3300018072 | Groundwater Sediment | MALLLRAKGITRVRPLEGGIAAWLAYNFPFFTESLVRKPVVL |
| Ga0184632_101361241 | 3300018075 | Groundwater Sediment | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPVVL |
| Ga0184612_101466222 | 3300018078 | Groundwater Sediment | VALLLRAKGITRVRPLEGGIDGWLADNFPFVTESLVKKPVVL |
| Ga0184628_104600182 | 3300018083 | Groundwater Sediment | DRPRAKGITRVHPLEGGIDAWLAYNLPFVTESLVKKPVVL |
| Ga0190265_123432261 | 3300018422 | Soil | VALLLTAKGITRVRPLEGGIDAWLAHNFPFDTQDVIKKSVVL |
| Ga0190265_132077061 | 3300018422 | Soil | VALLLRAKGITRVRPLEGGIDAWLADNFSFVTESLVKKPVEL |
| Ga0066655_102733481 | 3300018431 | Grasslands Soil | VALLLRAKGITRVRPLEGGIDAWLADNFPSVTESLVNKPVVL |
| Ga0190274_107842102 | 3300018476 | Soil | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVEKPVVL |
| Ga0173481_100906892 | 3300019356 | Soil | VALRLQAKGITRVRPLEGGIDAWLAHDFPFITESLVKKPVVL |
| Ga0190264_105292232 | 3300019377 | Soil | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPAVL |
| Ga0193743_10451693 | 3300019889 | Soil | VALLLRAKGITRVRPLEGGIDGWLADNFPFVTEGLVEKPVVL |
| Ga0210382_101224802 | 3300021080 | Groundwater Sediment | VALLLRAKGIIRVRPLEGGIDAWLADNFPFVTESLLKKPVVL |
| Ga0222622_112955182 | 3300022756 | Groundwater Sediment | VALLLRAKGITRVRPLEGGIAAWLADNFPFVTESLVEKPVVL |
| Ga0196962_102706492 | 3300024430 | Soil | VALLLIAKGITRVRPLEGGIEAWLAHEFPFDNVVLVKKSVAF |
| Ga0209172_101105762 | 3300025310 | Hot Spring Sediment | VALLLRAKGITRVRPLEGGIDAWLAHNFPFSTEELGKRSVIL |
| Ga0207697_102208002 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | VALLLRAKGITRVRPLEGGIDAWLASNFPFVTESLVKNPFSSERKYFS |
| Ga0210143_10503572 | 3300025792 | Natural And Restored Wetlands | VALLVRAKGITRVRPLEGGIDAWLAYNFPFVTESLVKKPIIP |
| Ga0207682_105830242 | 3300025893 | Miscanthus Rhizosphere | LLLRAKGITRVRPLEGGIDAWLADNLPFVAYGLVKKADDL |
| Ga0207695_105827922 | 3300025913 | Corn Rhizosphere | ARVALRLQAKGITRVRPLEGGIDAWLAHDFPFITESLVKKPVIL |
| Ga0207665_100848672 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTENLDRKPVVL |
| Ga0207668_108236392 | 3300025972 | Switchgrass Rhizosphere | RVALLLRAKGITRVRPLEGGIDGWLAYNFPFVTESLVEKPVVL |
| Ga0207668_108421871 | 3300025972 | Switchgrass Rhizosphere | VALLLRAKGITRVRPLEGGIDGWLAYNFPFVTESLVEKPVAL |
| Ga0207640_104442391 | 3300025981 | Corn Rhizosphere | LRLQAKGITRVRPLEGGIDAWLAHDFPFITESLVKKPVVL |
| Ga0207677_104177022 | 3300026023 | Miscanthus Rhizosphere | VALRLRAKGITRVRPLEGGIDAWLASNFPFVTESLVKNPFSSERKYFS |
| Ga0207674_109528111 | 3300026116 | Corn Rhizosphere | VALRLQAKGITRVRPLEGGIDAWLAHDFPFITESLVKKPVIL |
| Ga0209268_10392151 | 3300026314 | Soil | KGITRVRPLEGGIDAWLADNFPFVTETLIKKSVVF |
| Ga0209470_10608922 | 3300026324 | Soil | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTETLVKKSVVF |
| Ga0209266_10245274 | 3300026327 | Soil | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTETLIKKSVVF |
| Ga0256867_102998921 | 3300026535 | Soil | VALLLRAKGITRVRPLEGGIDAWLAGNFPFVTESLVKKPVVL |
| Ga0209819_102378062 | 3300027722 | Freshwater Sediment | LLRAKGITRVRPLEGGIDAWLAYDFPFVTESLVKKPVVL |
| Ga0209689_11266151 | 3300027748 | Soil | TSARVALLLRAKGITRVRPLEGGIDAWLAHNFPFATENLVKKPVAL |
| Ga0209073_101634262 | 3300027765 | Agricultural Soil | VALLLRAKGITRVRPLEGGIDAWLAQNFPFVTESLVNKSVVL |
| Ga0209382_118939932 | 3300027909 | Populus Rhizosphere | VALQLRAKGITRVRPLENEIDAWLADNFPFVTESLVEKPVVL |
| Ga0268264_122858891 | 3300028381 | Switchgrass Rhizosphere | VALQLRAKGITRVRPLEGGIAAWLAYNFPFVTESLV |
| Ga0307304_105650621 | 3300028885 | Soil | VALQLRAKGITRVRPLEGGIDAWLADNFPFVTESLENK |
| Ga0307497_100132331 | 3300031226 | Soil | VALLLRAKGITRVRPLEGGIDAWLAYNFPFVTESLVEKPVVL |
| Ga0170824_1053043051 | 3300031231 | Forest Soil | VALQLRAKGITKVRLLEGRIDAWLAYNFPFFTESLVRKPVVL |
| Ga0310888_102514042 | 3300031538 | Soil | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVKKPAIP |
| Ga0310888_103531812 | 3300031538 | Soil | VALLLRAKGITRVRPLEGGIDAWLAFNFPSVTESLVNKPVVL |
| Ga0307408_1000712825 | 3300031548 | Rhizosphere | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTEGLVKKSVIP |
| Ga0310813_100238402 | 3300031716 | Soil | VALLLRAKGITRVRPLEGGIDAWLAYDFPFVTEGLVKQPAVL |
| Ga0307410_112610481 | 3300031852 | Rhizosphere | VALLLRAKGITRVRPLEGGIDGWLADNFPFVSEGLVKKSVIP |
| Ga0310900_108883081 | 3300031908 | Soil | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTEGLVKKAVIP |
| Ga0310890_104552821 | 3300032075 | Soil | MIGNTRVALLLRAKGITGVRPLEGGTDAWLAHNFPSVT |
| Ga0310810_101706575 | 3300033412 | Soil | VALLLRAKGITRVRPLEGGIDAWLASNFPFVTENLVENPFSSERRFPF |
| Ga0310810_106615082 | 3300033412 | Soil | VALLLRAKGITRVRPLEGGIDAWLASNFPFVTENLVEKSALP |
| Ga0310810_108781242 | 3300033412 | Soil | VALLLRAKGITRVRPLEGGIDAWLAQNFPFVTESLVNKSVIL |
| Ga0316620_106915601 | 3300033480 | Soil | VALLLRAKGITRVRPLEGGIDAWLADNFPFVTESLVNKPVVRDQLQL |
| Ga0316620_113246972 | 3300033480 | Soil | VALLLRAKGITRVRPLEGGIDAWLAYNFPFVTESLVNKPVVL |
| Ga0316628_1032794311 | 3300033513 | Soil | VALLLRAKGITRVRPLEGGIDAWLAYNFPFVTESLVKKSVVL |
| Ga0364929_0205120_547_651 | 3300034149 | Sediment | MALLLRAKGITRVRPLEGGIDAWLADNFPFVTESL |
| ⦗Top⦘ |