


| Basic Information | |
|---|---|
| Family ID | F040785 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 47 residues |
| Representative Sequence | LIAEAAKMDLELGFVGGADVQALVERLYRSPPEVIARAQAIVAAN |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.11 % |
| % of genes near scaffold ends (potentially truncated) | 95.03 % |
| % of genes from short scaffolds (< 2000 bps) | 93.17 % |
| Associated GOLD sequencing projects | 133 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.820 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.603 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.845 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.658 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.05% β-sheet: 0.00% Coil/Unstructured: 47.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 11.80 |
| PF00318 | Ribosomal_S2 | 5.59 |
| PF00805 | Pentapeptide | 4.35 |
| PF13561 | adh_short_C2 | 3.73 |
| PF02515 | CoA_transf_3 | 3.73 |
| PF00378 | ECH_1 | 3.11 |
| PF09084 | NMT1 | 2.48 |
| PF13599 | Pentapeptide_4 | 2.48 |
| PF03401 | TctC | 1.86 |
| PF12974 | Phosphonate-bd | 1.86 |
| PF01979 | Amidohydro_1 | 1.24 |
| PF00400 | WD40 | 1.24 |
| PF01546 | Peptidase_M20 | 1.24 |
| PF13546 | DDE_5 | 1.24 |
| PF05036 | SPOR | 1.24 |
| PF01977 | UbiD | 1.24 |
| PF07690 | MFS_1 | 1.24 |
| PF07683 | CobW_C | 1.24 |
| PF01144 | CoA_trans | 0.62 |
| PF01042 | Ribonuc_L-PSP | 0.62 |
| PF00903 | Glyoxalase | 0.62 |
| PF13565 | HTH_32 | 0.62 |
| PF00230 | MIP | 0.62 |
| PF09209 | CecR_C | 0.62 |
| PF01471 | PG_binding_1 | 0.62 |
| PF03069 | FmdA_AmdA | 0.62 |
| PF00939 | Na_sulph_symp | 0.62 |
| PF00692 | dUTPase | 0.62 |
| PF13683 | rve_3 | 0.62 |
| PF14248 | DUF4345 | 0.62 |
| PF07883 | Cupin_2 | 0.62 |
| PF13340 | DUF4096 | 0.62 |
| PF12697 | Abhydrolase_6 | 0.62 |
| PF00857 | Isochorismatase | 0.62 |
| PF01928 | CYTH | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG0052 | Ribosomal protein S2 | Translation, ribosomal structure and biogenesis [J] | 5.59 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 4.35 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 3.73 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 2.48 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 2.48 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.86 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 1.24 |
| COG0523 | Zinc metallochaperone YeiR/ZagA and related GTPases, G3E family | General function prediction only [R] | 1.24 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.62 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 0.62 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.62 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.62 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.62 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 0.62 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.62 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.62 |
| COG1788 | Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit | Lipid transport and metabolism [I] | 0.62 |
| COG2057 | Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunit | Lipid transport and metabolism [I] | 0.62 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.62 |
| COG4670 | Acyl CoA:acetate/3-ketoacid CoA transferase | Lipid transport and metabolism [I] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.06 % |
| Unclassified | root | N/A | 9.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10007732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2963 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10041918 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10025081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia | 1417 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10030630 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300000907|JGI11871J12876_104770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300001661|JGI12053J15887_10597870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 525 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100195294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1914 | Open in IMG/M |
| 3300002568|C688J35102_117891428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. YI23 | 513 | Open in IMG/M |
| 3300002911|JGI25390J43892_10068041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 823 | Open in IMG/M |
| 3300004268|Ga0066398_10074431 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
| 3300004479|Ga0062595_100890431 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
| 3300005332|Ga0066388_102696893 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 906 | Open in IMG/M |
| 3300005332|Ga0066388_104826975 | Not Available | 686 | Open in IMG/M |
| 3300005367|Ga0070667_101900613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300005471|Ga0070698_101201576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
| 3300005518|Ga0070699_100303955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1431 | Open in IMG/M |
| 3300005541|Ga0070733_10120090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1689 | Open in IMG/M |
| 3300005558|Ga0066698_10490504 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300005563|Ga0068855_101157556 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300005576|Ga0066708_10129598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Chelativorans | 1530 | Open in IMG/M |
| 3300005713|Ga0066905_100116318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1854 | Open in IMG/M |
| 3300005713|Ga0066905_102314613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300005764|Ga0066903_101598481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1236 | Open in IMG/M |
| 3300005921|Ga0070766_11263242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300005985|Ga0081539_10066427 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
| 3300005994|Ga0066789_10276920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
| 3300006028|Ga0070717_11465606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300006038|Ga0075365_10220304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1331 | Open in IMG/M |
| 3300006046|Ga0066652_100671690 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300006174|Ga0075014_100233452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 942 | Open in IMG/M |
| 3300006175|Ga0070712_100966920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
| 3300006579|Ga0074054_11931978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
| 3300006604|Ga0074060_11007270 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300006796|Ga0066665_10940860 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300006796|Ga0066665_11053217 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300006845|Ga0075421_101850543 | Not Available | 648 | Open in IMG/M |
| 3300006871|Ga0075434_101788947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
| 3300006880|Ga0075429_101022046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 722 | Open in IMG/M |
| 3300006904|Ga0075424_102528544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300007076|Ga0075435_100167292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1854 | Open in IMG/M |
| 3300007258|Ga0099793_10014923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3095 | Open in IMG/M |
| 3300009090|Ga0099827_10045621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 3269 | Open in IMG/M |
| 3300009090|Ga0099827_10667336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 898 | Open in IMG/M |
| 3300009090|Ga0099827_11638075 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300009094|Ga0111539_12049231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
| 3300009143|Ga0099792_10111498 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300009162|Ga0075423_11332370 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Betulaceae → Carpinus → Carpinus fangiana | 768 | Open in IMG/M |
| 3300009162|Ga0075423_11809405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 659 | Open in IMG/M |
| 3300009177|Ga0105248_13357604 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300009792|Ga0126374_11560037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 544 | Open in IMG/M |
| 3300009795|Ga0105059_1057215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → unclassified Methyloceanibacter → Methyloceanibacter sp. | 534 | Open in IMG/M |
| 3300010040|Ga0126308_10579180 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300010046|Ga0126384_10033811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 3415 | Open in IMG/M |
| 3300010046|Ga0126384_10126388 | All Organisms → cellular organisms → Bacteria | 1932 | Open in IMG/M |
| 3300010048|Ga0126373_10458808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 1310 | Open in IMG/M |
| 3300010048|Ga0126373_12581365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300010321|Ga0134067_10176463 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300010333|Ga0134080_10615925 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300010358|Ga0126370_10087043 | All Organisms → cellular organisms → Bacteria | 2119 | Open in IMG/M |
| 3300010358|Ga0126370_10648906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 919 | Open in IMG/M |
| 3300010360|Ga0126372_11209917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 780 | Open in IMG/M |
| 3300010362|Ga0126377_10280647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1634 | Open in IMG/M |
| 3300010366|Ga0126379_11677837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300010398|Ga0126383_10111766 | All Organisms → cellular organisms → Bacteria | 2467 | Open in IMG/M |
| 3300012096|Ga0137389_11580483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300012200|Ga0137382_10789176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 683 | Open in IMG/M |
| 3300012200|Ga0137382_11194520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300012203|Ga0137399_11422395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300012357|Ga0137384_11273642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 581 | Open in IMG/M |
| 3300012361|Ga0137360_11865919 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012532|Ga0137373_10379319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 1103 | Open in IMG/M |
| 3300012677|Ga0153928_1042602 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 910 | Open in IMG/M |
| 3300012927|Ga0137416_10648309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 924 | Open in IMG/M |
| 3300012944|Ga0137410_10212950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia | 1501 | Open in IMG/M |
| 3300012948|Ga0126375_10502412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 904 | Open in IMG/M |
| 3300012948|Ga0126375_10914993 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300012951|Ga0164300_10393286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 759 | Open in IMG/M |
| 3300012951|Ga0164300_10681085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300012958|Ga0164299_10365058 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300012958|Ga0164299_10761007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300012971|Ga0126369_13474500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300012975|Ga0134110_10466956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300012984|Ga0164309_11495819 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300014489|Ga0182018_10767511 | Not Available | 500 | Open in IMG/M |
| 3300014654|Ga0181525_10135203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1354 | Open in IMG/M |
| 3300014657|Ga0181522_10836246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300016270|Ga0182036_11174142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300016294|Ga0182041_11525263 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300016319|Ga0182033_10761387 | Not Available | 851 | Open in IMG/M |
| 3300016387|Ga0182040_10726411 | Not Available | 814 | Open in IMG/M |
| 3300016404|Ga0182037_10909202 | Not Available | 764 | Open in IMG/M |
| 3300016422|Ga0182039_11546080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300016445|Ga0182038_11954027 | Not Available | 531 | Open in IMG/M |
| 3300017961|Ga0187778_11289406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 514 | Open in IMG/M |
| 3300017975|Ga0187782_11210606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129 | 591 | Open in IMG/M |
| 3300018433|Ga0066667_10181410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1525 | Open in IMG/M |
| 3300020583|Ga0210401_11111590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300021170|Ga0210400_11612061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300021178|Ga0210408_10031368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4207 | Open in IMG/M |
| 3300021180|Ga0210396_10514342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129 | 1047 | Open in IMG/M |
| 3300021474|Ga0210390_11083235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 651 | Open in IMG/M |
| 3300021475|Ga0210392_11028026 | Not Available | 617 | Open in IMG/M |
| 3300021560|Ga0126371_10057408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 3742 | Open in IMG/M |
| 3300022711|Ga0242674_1062458 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300022726|Ga0242654_10109599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 878 | Open in IMG/M |
| 3300025972|Ga0207668_10666370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 912 | Open in IMG/M |
| 3300026376|Ga0257167_1034564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300027109|Ga0208603_1051879 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300027537|Ga0209419_1033196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 977 | Open in IMG/M |
| 3300027867|Ga0209167_10673872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300027874|Ga0209465_10127350 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300027875|Ga0209283_10816336 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300027882|Ga0209590_10068053 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
| 3300028047|Ga0209526_10335825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1015 | Open in IMG/M |
| 3300028536|Ga0137415_10517469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1002 | Open in IMG/M |
| 3300028719|Ga0307301_10095742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 938 | Open in IMG/M |
| 3300028755|Ga0307316_10371636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 527 | Open in IMG/M |
| 3300028778|Ga0307288_10066889 | Not Available | 1264 | Open in IMG/M |
| 3300028784|Ga0307282_10158146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1074 | Open in IMG/M |
| 3300028784|Ga0307282_10294067 | Not Available | 782 | Open in IMG/M |
| 3300028814|Ga0307302_10119292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1267 | Open in IMG/M |
| 3300028906|Ga0308309_11472578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 582 | Open in IMG/M |
| 3300031152|Ga0307501_10044347 | Not Available | 971 | Open in IMG/M |
| 3300031199|Ga0307495_10223193 | Not Available | 529 | Open in IMG/M |
| 3300031231|Ga0170824_120920718 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 555 | Open in IMG/M |
| 3300031543|Ga0318516_10557081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300031561|Ga0318528_10287547 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300031561|Ga0318528_10325981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 824 | Open in IMG/M |
| 3300031573|Ga0310915_10706683 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300031573|Ga0310915_11015347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300031640|Ga0318555_10671066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300031680|Ga0318574_10285143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 958 | Open in IMG/M |
| 3300031680|Ga0318574_10569331 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
| 3300031682|Ga0318560_10123300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1357 | Open in IMG/M |
| 3300031682|Ga0318560_10654174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300031708|Ga0310686_107399916 | Not Available | 711 | Open in IMG/M |
| 3300031708|Ga0310686_112962461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129 | 1059 | Open in IMG/M |
| 3300031713|Ga0318496_10143634 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300031724|Ga0318500_10446597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300031736|Ga0318501_10115401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1354 | Open in IMG/M |
| 3300031744|Ga0306918_11295677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300031748|Ga0318492_10229662 | Not Available | 956 | Open in IMG/M |
| 3300031768|Ga0318509_10571837 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300031795|Ga0318557_10440420 | Not Available | 599 | Open in IMG/M |
| 3300031819|Ga0318568_10143029 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300031835|Ga0318517_10052255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1714 | Open in IMG/M |
| 3300031845|Ga0318511_10527448 | Not Available | 547 | Open in IMG/M |
| 3300031893|Ga0318536_10572798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300031941|Ga0310912_11219433 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300032001|Ga0306922_10046769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4466 | Open in IMG/M |
| 3300032035|Ga0310911_10042557 | All Organisms → cellular organisms → Bacteria | 2332 | Open in IMG/M |
| 3300032041|Ga0318549_10182107 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300032051|Ga0318532_10363827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300032064|Ga0318510_10335112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300032066|Ga0318514_10606987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300032261|Ga0306920_101114927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1144 | Open in IMG/M |
| 3300032261|Ga0306920_103718469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300033289|Ga0310914_11893453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300033290|Ga0318519_10081833 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300033290|Ga0318519_10663584 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300033550|Ga0247829_11477940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.60% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.83% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.86% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.24% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.24% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.24% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.62% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.62% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.62% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.62% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.62% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000907 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012677 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ012 MetaG | Host-Associated | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022711 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100077321 | 3300000597 | Forest Soil | MRDPQFIAEAAKMDLELGFVGGADVQALVDRLYRSPPKVIARAQAIVAAN* |
| AF_2010_repII_A1DRAFT_100419182 | 3300000597 | Forest Soil | ELGFLGGADVQSLVERLYSSPPDVIARARAIATAN* |
| AF_2010_repII_A001DRAFT_100250811 | 3300000793 | Forest Soil | PQFIAEAAKMDLELGFVGGADVQALVDRLYRSPPKVIARAQAIVAAN* |
| AF_2010_repII_A001DRAFT_100306301 | 3300000793 | Forest Soil | ELIAEAAKMDLELGFLGGADVQSLVERLYSSPPDVIARARAIATAN* |
| JGI11871J12876_1047702 | 3300000907 | Forest Soil | RLGTALREAFAEAMHDPQLIAEGAKMDLELGFVSGVDVQALVERLYKSPPEVIARAQAIVATN* |
| JGI12053J15887_105978701 | 3300001661 | Forest Soil | PRVAQALRQAFADAMRDPQLIAEGAKMDLELGFVSGADVQATVERLYRSPPDVIARAQAIAAAN* |
| JGIcombinedJ26739_1001952943 | 3300002245 | Forest Soil | AAAMRDPQLIAEAAKMDLELGFVPGAEVQGMVERLYQSPPEVIARAQGIAAGN* |
| C688J35102_1178914281 | 3300002568 | Soil | AFAEAMRDPQLIAEGAKMDLELGFVSGVDVQALVERLYKSPPEVIGRAQAIVATN* |
| JGI25390J43892_100680411 | 3300002911 | Grasslands Soil | MRDPQLIAEAAKMDLELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN* |
| Ga0066398_100744311 | 3300004268 | Tropical Forest Soil | PQLIAEAAKMDLELGFVGGADVQALVERLYRSPPEVIARAQAIVAAN* |
| Ga0062595_1008904311 | 3300004479 | Soil | AMRDPQLIAEAAKMDLELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN* |
| Ga0066388_1026968932 | 3300005332 | Tropical Forest Soil | PQLIAEGAKMELELNFVSGGEVQAMVDRLYQAPPDVVARAQAIASAN* |
| Ga0066388_1048269751 | 3300005332 | Tropical Forest Soil | KIGLELNFVSGADVQALVERVYRSPPNVVARAQAIASAN* |
| Ga0070667_1019006131 | 3300005367 | Switchgrass Rhizosphere | GLDPRVVQALRQAFAEAMRDPQFIAEGAKMNLELEFVGGDAVQRLVERLYQSAPNVIARAQAIVAAN* |
| Ga0070698_1012015761 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AAAMRDPQLIAEAAKMDLELGFVGGADVQALVDRLYRSPPNVIARAQAIAAAN* |
| Ga0070699_1003039553 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | AEAAKMDLELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN* |
| Ga0070733_101200903 | 3300005541 | Surface Soil | IDLELNYVSGEDVQALIERLYRSPPDVIARAQAIAAAN* |
| Ga0066698_104905042 | 3300005558 | Soil | LELGFVSGADVQALVERLYSSPPEVIARAHAIVAAN* |
| Ga0068855_1011575561 | 3300005563 | Corn Rhizosphere | AKMDLELGFVSGIEVQALIERLYKSPTEVIARAQAIVATN* |
| Ga0066708_101295983 | 3300005576 | Soil | AVAATMRDPQFIAEGARLDLETNFINGGDVQALVQRLYRSPPDVVRRAQAIVSAD* |
| Ga0066905_1001163183 | 3300005713 | Tropical Forest Soil | EAAKMDLELGFVSGLDVQTLVERLYRSPPEVIARAQAIVATN* |
| Ga0066905_1023146131 | 3300005713 | Tropical Forest Soil | QLIAEAAKMDLELGFVSGVDVQTMVERLYQSPPEVIARAQAIVATN* |
| Ga0066903_1015984813 | 3300005764 | Tropical Forest Soil | LELNYVSGTKVQAIVERLYKAPADVVARAQAIASTN* |
| Ga0070766_112632422 | 3300005921 | Soil | AEAAKIDLELNFVSGEQVQALVERLYHSPPDVVARAQAIAAAN* |
| Ga0081539_100664271 | 3300005985 | Tabebuia Heterophylla Rhizosphere | KMDLELGFVSGVEVQSLVERLYKSPPEVIARAQAIVATN* |
| Ga0066789_102769202 | 3300005994 | Soil | EGARTGLEINFVGGDDVQTLVEGLYRSPPAVVARAQAIAAAK* |
| Ga0070717_114656062 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PQLIAEAAKMDLELGFVGGADVQALVDRLYRSPPNVIARAQAIAAAN* |
| Ga0075365_102203041 | 3300006038 | Populus Endosphere | KMDLELNFVSGSDVQTLIERLYKAPSDVIARAQAIAAAN* |
| Ga0066652_1006716902 | 3300006046 | Soil | EAAKMDLELGFVSGADVQALVERLYSSPPEVIARAHAIVAAN* |
| Ga0075014_1002334521 | 3300006174 | Watersheds | LNFVSGEDVQALVEQLYHSPPDVVARAQAIAAAN* |
| Ga0070712_1009669202 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EAMRDPQLIAEGAKMDLELGFVSGVDVQALVERLYNSPPEVIARAQAIVATN* |
| Ga0074054_119319782 | 3300006579 | Soil | FAEAMRDPQLIAEGAKMDLELGFVSGVDVQALVERLYKSPPEVIARAQAIVATN* |
| Ga0074060_110072702 | 3300006604 | Soil | GLAIAKALIAEGAKMDLELGFVSGVDVQALVDRLYKAPPEVIARAQAIVATN* |
| Ga0066665_109408601 | 3300006796 | Soil | ELGFVSGADVQALVERLYSSPPEVIARAHAIVAAN* |
| Ga0066665_110532172 | 3300006796 | Soil | AKMDLELGFVPGDEVQAMVERLYRSAPEVIARAQAIAAGN* |
| Ga0075421_1018505432 | 3300006845 | Populus Rhizosphere | FVSGVDVQTMVERLFQSPPEDIPRAQAIVATNRGAML* |
| Ga0075434_1017889471 | 3300006871 | Populus Rhizosphere | EAMHDPQLIAEAARMDLEIDYASGEEVQALVERLYRTPPEVVARARAIAATN* |
| Ga0075429_1010220462 | 3300006880 | Populus Rhizosphere | TALRDAFAEAMRDPQLVAEAAKMDLELGFVSGLDVQTLVERLYQSPPEVITRAQAIVATN |
| Ga0075424_1025285442 | 3300006904 | Populus Rhizosphere | DAMRDPQFIAEGARMRMELNFVSGEEVQEMVARLYQSPAQVIARAQAIAAAN* |
| Ga0075435_1001672921 | 3300007076 | Populus Rhizosphere | AEAAKMDLELGFLGGADVQALVQRLYASAPEVIARAQAIVAAN* |
| Ga0099793_100149235 | 3300007258 | Vadose Zone Soil | PELIAEAARMDLELGFLGGADVQVLVERLYGSPPEVIARAQAIVAAN* |
| Ga0099827_100456215 | 3300009090 | Vadose Zone Soil | DPQLIAEAAKMDLELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN* |
| Ga0099827_106673361 | 3300009090 | Vadose Zone Soil | DAMHDLQFIAEGAKIDMELDFVSGAEVQALVERLYHSPPHVVARAQAIAAANYRARLLHR |
| Ga0099827_116380751 | 3300009090 | Vadose Zone Soil | DPALVAEAARMDLEINFVGGAGVQALVERLYRTPPDVVARAQAIASPHQ* |
| Ga0111539_120492312 | 3300009094 | Populus Rhizosphere | DPQLIAEGARMNLELEFVAGADVQALVERLYHSPPAIITRAQAIVATP* |
| Ga0099792_101114982 | 3300009143 | Vadose Zone Soil | EALRAAFATAMHDPELIAEAARMDLELGFLGGADVQVLVERLYGSPPEVIARAQAIVAAN |
| Ga0075423_113323701 | 3300009162 | Populus Rhizosphere | LIAEGARMNLELEFVAGAEVQALVERLYRSPPEVIARAQTIAAAP* |
| Ga0075423_118094052 | 3300009162 | Populus Rhizosphere | MHDPQLIAEGAKIGLELDFVSGPDVQTLVERAYGSPSGVIARAQAIAAAN* |
| Ga0105248_133576041 | 3300009177 | Switchgrass Rhizosphere | GLDPRLGAALREGFAEAMRDPQLIAEGAKMDLELGFVSGIEVQALIERLYKSPTEVIARAQAIVATN* |
| Ga0126374_115600371 | 3300009792 | Tropical Forest Soil | GLELNFVGGADVQAMVDRLYQAPANVVARAQAIATAN* |
| Ga0105059_10572152 | 3300009795 | Groundwater Sand | GLELNFVSGSDVQALVERVYRSPPNVVTRAQAIASAN* |
| Ga0126308_105791801 | 3300010040 | Serpentine Soil | QFIAEGQKIDMELNYVGGEEVQALIERLYKSAPEVISRAQAIAAAN* |
| Ga0126384_100338114 | 3300010046 | Tropical Forest Soil | AAMRDPQLIAEAAKMDLELGFVGGADVQGLVDRLYRSPPEVIARAQAIVAAN* |
| Ga0126384_101263883 | 3300010046 | Tropical Forest Soil | LELNFVNGADVQAMIDRLYQAPADVIARAQAIATAN* |
| Ga0126373_104588081 | 3300010048 | Tropical Forest Soil | KMDLELGFVGGADVQGLVDRLYRSPPEVIARAQAIVAAN* |
| Ga0126373_125813652 | 3300010048 | Tropical Forest Soil | AAMRDPQLIAEAAKMDLELGFVGGADVQALVDRLYRSPPEVIARTQAIVAAN* |
| Ga0134067_101764632 | 3300010321 | Grasslands Soil | RVVEALREAFAEAMRDPQLIAEGAKMDLELSFVSGAEVQAIVERLYRSPADVIARAQAIASAN* |
| Ga0134080_106159252 | 3300010333 | Grasslands Soil | PELIAEAAKMDLELGFVNGADVQALVERLYSSPPEVIARAHAIVAAN* |
| Ga0126370_100870433 | 3300010358 | Tropical Forest Soil | AKMDLELGFVGGADVQGLVDRLYRSPPEVIARAQAIVAAN* |
| Ga0126370_106489062 | 3300010358 | Tropical Forest Soil | RDPQLIADAAKMDLELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN* |
| Ga0126372_112099171 | 3300010360 | Tropical Forest Soil | PGLDPRLGTALREAFAEAMRDPQLIAESAKMDLELGFVSGVEVQALVERLYKSPAEVIARAQAIVASN* |
| Ga0126377_102806471 | 3300010362 | Tropical Forest Soil | EAMHDPQFIAEGDKIGLELNFVSGADVQALVERVYRSPPNVVTRAQAIASAN* |
| Ga0126379_116778371 | 3300010366 | Tropical Forest Soil | FAAAMRDPQLIAEAAKMDLELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN* |
| Ga0126383_101117661 | 3300010398 | Tropical Forest Soil | KMDLELGFVGGADVQALVDRLYRSPPEVIARAQAIVAAN* |
| Ga0137389_115804831 | 3300012096 | Vadose Zone Soil | PPVALLLKQAFADAMRDPQLIAEAAKMDLELGFVPGDEVQAMVERLYRSAPDVIARAQAIAAGN* |
| Ga0137382_107891762 | 3300012200 | Vadose Zone Soil | EGGRMELEFNYVSGADVQAMVEMLYQSPPAVVARAQAIAAAN* |
| Ga0137382_111945201 | 3300012200 | Vadose Zone Soil | VGEALRAAFATAMHDPELIAEAARMDLELGFLGGADVQVLVERLYGSPPEVIARAQAIVAAN* |
| Ga0137399_114223951 | 3300012203 | Vadose Zone Soil | MELEIDVVSGVEVQALIERLYRSSPAVIARAQAIASAKALSDK* |
| Ga0137384_112736421 | 3300012357 | Vadose Zone Soil | DPALIAEAAKMDLELNFVSGTDVQSMVERLFMASPAVVARAQAIATAN* |
| Ga0137360_118659191 | 3300012361 | Vadose Zone Soil | MDLELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN* |
| Ga0137373_103793191 | 3300012532 | Vadose Zone Soil | MELEINVVGGGEVQALIDRLYKSAPAVIARAQAIAAAKAP* |
| Ga0153928_10426022 | 3300012677 | Attine Ant Fungus Gardens | AGALRQAFSQAMHDPPLLAEAAKIDLELNFVSGEEVQALVERLYHSPPGVVARAQAIAAAK* |
| Ga0137416_106483091 | 3300012927 | Vadose Zone Soil | GRDPALIAEGAKMDLELNFVSGTDVQSMVERLFMASPAVVARAQAIATAN* |
| Ga0137410_102129503 | 3300012944 | Vadose Zone Soil | DLELNFVSGTGVQSMVERLFMASPAVVARAQAIATAN* |
| Ga0126375_105024122 | 3300012948 | Tropical Forest Soil | AAMHDSELIAEAAKMDLELGFLGGADVQSLVERLYRSPPDVIARARAIATAN* |
| Ga0126375_109149932 | 3300012948 | Tropical Forest Soil | MHDPELIAEAAKMDLELDFVGGADVQALVERLYRSSPKVIERAQAIVAAN* |
| Ga0164300_103932861 | 3300012951 | Soil | MRDPQLIAEGAKMDLELGFVSGVDVQALVERLYKSPPDVIARAQAIVATN* |
| Ga0164300_106810851 | 3300012951 | Soil | MRDPQLIAEGAKMDLELGFVSGVDVQALVGRLYKSPPEVIARAQAIVATN* |
| Ga0164299_103650581 | 3300012958 | Soil | DLELGFVSGVDVQALVDRLYKSPPEVIARAQAIVATN* |
| Ga0164299_107610072 | 3300012958 | Soil | IAEAAKMDLELGFVPGAEVQGMVERLYQSPPEVIARAQGIAAGN* |
| Ga0126369_134745002 | 3300012971 | Tropical Forest Soil | EAAKMDLELGFVGGADVQALVERLYRSPPDVIARAQAIAAAN* |
| Ga0134110_104669562 | 3300012975 | Grasslands Soil | DPQLIAEGAKMDLELSFVSGAEVQAIVERLYRSPADVIARAQAIASAN* |
| Ga0164309_114958192 | 3300012984 | Soil | AEGAKMDLELGFVSGVDVQALVDRLYKSPPEVIARAQAIVATN* |
| Ga0182018_107675112 | 3300014489 | Palsa | MHDPELIAEAAKIDLELNFVSGEEVQALVERRYHSPPDVIARAQAIAAAN* |
| Ga0181525_101352033 | 3300014654 | Bog | LLAKAAKLNFVSGEEVQALVERLYQSPPDVVARAQAIAVAN* |
| Ga0181522_108362462 | 3300014657 | Bog | SERTGLEINFVSGEEVQALVARLYQSPPTVVARAQAIAAAK* |
| Ga0182036_111741421 | 3300016270 | Soil | AEAAKMDLELGFLDGADVQSLVERLYRSPPDVIARARAIATAN |
| Ga0182041_115252631 | 3300016294 | Soil | KMDLELGFVGGADVQALVDRLYRSPPDVIARAQAIVAAN |
| Ga0182033_107613871 | 3300016319 | Soil | DLELGIFSGKDVQSLVERLYQSSPEVIARAQAIASGN |
| Ga0182040_107264111 | 3300016387 | Soil | LLRRAFDQAMQDPDLIAEAAKMDLELGIFSGKDVQSLVERLYQSSPEVIARAQAIASGN |
| Ga0182037_109092021 | 3300016404 | Soil | QAMQDPDLIAEAAKMDLELGIFSGKDVQSLVERLYQSSPEVIARAQAIASGN |
| Ga0182039_115460802 | 3300016422 | Soil | MCDPQLIAEGAKMDLELSYVSGADVQAIVERGYKSPPEVIARAQAIAATN |
| Ga0182038_119540271 | 3300016445 | Soil | QAMRDPQLIAEGAKMDLELSYVSGADVQAIVERGYKSPPEVIARAQAIAATN |
| Ga0187778_112894062 | 3300017961 | Tropical Peatland | LEINLELNFVSGQDVQALVDRLYHSPPGVITPAQAIALAIRP |
| Ga0187782_112106062 | 3300017975 | Tropical Peatland | LIAEAAKINLELNFVGGEDVQALVERLYHFPPDVIARAQTIAAAN |
| Ga0066667_101814101 | 3300018433 | Grasslands Soil | EAAKMDLELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN |
| Ga0210401_111115901 | 3300020583 | Soil | QLIAEAAKMDLELGFVPGAEVQAMVERLYQSPPEVIARAQAIAAGN |
| Ga0210400_116120611 | 3300021170 | Soil | LRAAIAAAMRDPQLIAEAARMDLELGFVPGAEVQGMVERLYQSPPEVIARAQGIAAGN |
| Ga0210408_100313681 | 3300021178 | Soil | QLIAEAAKMDLELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN |
| Ga0210396_105143421 | 3300021180 | Soil | IAEAAKIDLELNFVGGEEVQAMVERLYRLPPDVLRRAQAIAAAN |
| Ga0210390_110832352 | 3300021474 | Soil | RNAVAAAMHDPDLIAEAAKIDLELNFVRGEDVQALVERLYHSPSEVVARAQAIAGAN |
| Ga0210392_110280262 | 3300021475 | Soil | ARMDLELGFVPGAEVQGMVERLYQSPPEVIARAQGIAAGN |
| Ga0126371_100574081 | 3300021560 | Tropical Forest Soil | KMDLELGFLGGADVQALVERLYRSPPEVIARAQAIATAN |
| Ga0242674_10624581 | 3300022711 | Soil | KINLELNFVSGEEVQALVERLYRSPPDVMTRAQAIAAAD |
| Ga0242654_101095991 | 3300022726 | Soil | LLRAAIAAAMRDPQLIAEAARMDLELGFVPGAEVQGMVERLYQSPPEVIARAQGIAAGN |
| Ga0207668_106663703 | 3300025972 | Switchgrass Rhizosphere | LREAFAEAMRDPQLIAEGAKMDLELGFVSGVDVQALVERLYKSPPEVIGRAQSIVATN |
| Ga0257167_10345642 | 3300026376 | Soil | AAAMRDPQLIAEAAKMDLELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN |
| Ga0208603_10518792 | 3300027109 | Forest Soil | IADAAKIGLELNFVSGEEVQALVERLYHSPPDVLARAQAIAGAN |
| Ga0209419_10331963 | 3300027537 | Forest Soil | AEAAKMDLELGFLSGTDVQSLVERLYQSPPEVIARAQAIAAGN |
| Ga0209167_106738721 | 3300027867 | Surface Soil | IDLELNYVSGEDVQALIERLYRSPPDVIARAQAIAAAN |
| Ga0209465_101273502 | 3300027874 | Tropical Forest Soil | LLAEAAKMDLELGFVGGTDVQALVDRLYRSPPDVIARAQAIAAAN |
| Ga0209283_108163362 | 3300027875 | Vadose Zone Soil | IAEAAKMDLELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN |
| Ga0209590_100680534 | 3300027882 | Vadose Zone Soil | MDLELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN |
| Ga0209526_103358251 | 3300028047 | Forest Soil | DPQLIAEAAKMDLELGFVPGAEVQGMVERLYQSPPEVIARAQGIAAGN |
| Ga0137415_105174692 | 3300028536 | Vadose Zone Soil | GRDPALIAEGAKMDLELNFVSGTDVQSMVERLFMASPAVVARAQAIATAN |
| Ga0307301_100957422 | 3300028719 | Soil | EAFAEAMRDPQLIAEGAKMDLELGFVSGVDVQALVERLYKSPPEVIARAQAIVATN |
| Ga0307316_103716362 | 3300028755 | Soil | EAFAEAMRDPQLIAEGAKMDLELGFVSGVDVQALVERLYKSPPDVIARAQAIVATN |
| Ga0307288_100668892 | 3300028778 | Soil | AEAMRDPQLIAEGAKMDLELGFVSGVDVQALVERLYKSPPDVIARAQAIVATN |
| Ga0307282_101581462 | 3300028784 | Soil | TALREAFAEAMRDPQLIAEGAKMDLELGFVSGVDVQALVERLYKSPPEVIARAQAIVATN |
| Ga0307282_102940671 | 3300028784 | Soil | MRDPQLIAEGAKMDLELGFVSGVDVQALVERLYKSPPEVIARAQAIVATN |
| Ga0307302_101192922 | 3300028814 | Soil | NLELEFVGGDAVQRLVERLYQSAPNVIARAQAIVAAN |
| Ga0308309_114725781 | 3300028906 | Soil | HDPDLVAEAEKINLELNFVSGEEVQALVERLYQFPPDVIARAQAIAAAN |
| Ga0307501_100443472 | 3300031152 | Soil | DAMRDPQLIAEGAKMDLELGFVGGADVQATVERGYKSPPEVIARAQAIAAAN |
| Ga0307495_102231931 | 3300031199 | Soil | EGAKMDLELGFVSGVDVQALVERLYKSPPEVIARAQAIVATN |
| Ga0170824_1209207182 | 3300031231 | Forest Soil | ELNYVSGDAVQALIERLYQSPPSVISRAQAIVNAH |
| Ga0318516_105570811 | 3300031543 | Soil | MHDSELIAEAAKMDLELGFLDGADVQSLVERLYRSPPDVIARARAIATAN |
| Ga0318528_102875472 | 3300031561 | Soil | LIAEAAKMDLELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN |
| Ga0318528_103259811 | 3300031561 | Soil | LIAEAAKMDLELGFVGGADVQALVERLYRSPPEVIARAQAIVAAN |
| Ga0310915_107066832 | 3300031573 | Soil | QLIAEAAKMDLELGFVGGADVQALVDRLYRSPPDVIARAQAIVAAN |
| Ga0310915_110153472 | 3300031573 | Soil | AMRDPQLIAEAAKMDLELGFVGGADVQALVDRLYRSPPEVIARAQAIVAAN |
| Ga0318555_106710661 | 3300031640 | Soil | AKMDLELGFVGGADVQALVERLYRSPPEVIARAQAIVAAN |
| Ga0318574_102851431 | 3300031680 | Soil | DLELGFVGGADVQALVERLYRSPPEVIARAQAIVTAN |
| Ga0318574_105693311 | 3300031680 | Soil | SELIAEAAKMDLELGFLDGADVQSLVERLYRSPPDVIARARAIATAN |
| Ga0318560_101233004 | 3300031682 | Soil | IAEAAKMDLELGFLDGADVQSLVERLYRSPPDVIARARAIATAN |
| Ga0318560_106541742 | 3300031682 | Soil | QLIAEAAKMDLELGFVGGADVQALVERLYRSPPEVIARAQAIVAAN |
| Ga0310686_1073999161 | 3300031708 | Soil | DPDLIAEAAKINLELNFVGGEEVQALVERLYRSPPDVIARAQAIAAAD |
| Ga0310686_1129624611 | 3300031708 | Soil | NLELNVVSGEDVQALVERLYHFPPDAIARAQAIAAAN |
| Ga0318496_101436341 | 3300031713 | Soil | LELGFVGGADVQALVERLYRSPPEVIARAQAIVAAN |
| Ga0318500_104465972 | 3300031724 | Soil | MDLELGFVGGADVQALVDRLYRSPPEVIARAQAIVAAN |
| Ga0318501_101154011 | 3300031736 | Soil | LDPHVGESLRAAFAAAMHDSELIAEAAKMDLELGFLDGADVQSLVERLYRSPPDVIARARAIATAN |
| Ga0306918_112956771 | 3300031744 | Soil | AAMRDPQLIAEAAKMDLELGFVGGADVQALVDRLYRSPPEVIARAQAIVAAN |
| Ga0318492_102296621 | 3300031748 | Soil | LIAEGAKMDLELSFVGGAEVQAIVERLFRSPSDVIARAQAIASAN |
| Ga0318509_105718371 | 3300031768 | Soil | FAAAMHDPQLIAEAAKMDLELGFVAGADVQTLVDRLYRSPPDVIARAQAIAAAN |
| Ga0318557_104404202 | 3300031795 | Soil | AFAEAMHDPQLIAEGAKMDLELSFVGGAEVQAIVERLFRSPSDVIARAQAIASAN |
| Ga0318568_101430292 | 3300031819 | Soil | HDPQLIAEAAKMDLELGFVGGADVQALVGRLYRSPPEVIARAQAIVAAN |
| Ga0318517_100522552 | 3300031835 | Soil | MHLELGFVGGADVQALVERLYRSPPEVIARAQAIVTAN |
| Ga0318511_105274481 | 3300031845 | Soil | PSVSALLRRAFDQAMQDPDLIAEAAKMDLELGIFSGKDVQSLVERLYQSSPEVIARAQAIASGN |
| Ga0318536_105727981 | 3300031893 | Soil | KMDLELGFVGGADVQALVERLYRSPPEVIARAQAIVAAN |
| Ga0310912_112194331 | 3300031941 | Soil | AAKMDLELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN |
| Ga0306922_100467691 | 3300032001 | Soil | DLELGFVGGADVQALVERLYRSPPEVIARAQAIVAAN |
| Ga0310911_100425575 | 3300032035 | Soil | DPQLIAEAAKMDLELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN |
| Ga0318549_101821072 | 3300032041 | Soil | ELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN |
| Ga0318532_103638271 | 3300032051 | Soil | PQLIAEAAKMDLELGFVGGADVQALVERLYRSPPEVIARAQAIVAAN |
| Ga0318510_103351122 | 3300032064 | Soil | AAKMDLELGFVGGADVQALVGRLYRSPPEVIARAQAIVAAN |
| Ga0318514_106069871 | 3300032066 | Soil | AAKMDLELGFVGGVDVQALVERLYRSPLEVIARAQAIVAAN |
| Ga0306920_1011149271 | 3300032261 | Soil | AAKMDLELGIFSGKDVQSLVERLYQSSPEVIARAQAIASGN |
| Ga0306920_1037184692 | 3300032261 | Soil | AAMRNPQLIAEAAKMDLELGFVGGADVQALVDRLYRSPPEVIARAQAIVAAN |
| Ga0310914_118934531 | 3300033289 | Soil | LELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN |
| Ga0318519_100818333 | 3300033290 | Soil | IAEAAKMDLELGFVGGADVQALVGRLYRSPPEVIARAQAIVAAN |
| Ga0318519_106635841 | 3300033290 | Soil | AEAAKMDLELGFVGGADVQALVDRLYRSPPDVIARAQAIAAAN |
| Ga0247829_114779402 | 3300033550 | Soil | LGTALREAFAEAMRDPQLIAETAKMDLELGFVSGVDVQALVERLYKSPPDVIARAQAIVATN |
| ⦗Top⦘ |