


| Basic Information | |
|---|---|
| Family ID | F040773 |
| Family Type | Metagenome |
| Number of Sequences | 161 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MYIGLGVFAILAVVCVVAGAVAMKRRRDYGNSDGDGQMGEAEFRKYEGFDK |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 58.75 % |
| % of genes near scaffold ends (potentially truncated) | 27.33 % |
| % of genes from short scaffolds (< 2000 bps) | 89.44 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.280 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.180 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.224 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.236 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.30% β-sheet: 0.00% Coil/Unstructured: 55.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF03055 | RPE65 | 4.97 |
| PF00355 | Rieske | 3.11 |
| PF12867 | DinB_2 | 3.11 |
| PF03795 | YCII | 2.48 |
| PF02771 | Acyl-CoA_dh_N | 2.48 |
| PF12900 | Pyridox_ox_2 | 2.48 |
| PF01625 | PMSR | 2.48 |
| PF04978 | DUF664 | 1.86 |
| PF01427 | Peptidase_M15 | 1.86 |
| PF13561 | adh_short_C2 | 1.24 |
| PF01037 | AsnC_trans_reg | 1.24 |
| PF07991 | IlvN | 1.24 |
| PF00903 | Glyoxalase | 1.24 |
| PF01738 | DLH | 1.24 |
| PF01042 | Ribonuc_L-PSP | 1.24 |
| PF04655 | APH_6_hur | 1.24 |
| PF00211 | Guanylate_cyc | 1.24 |
| PF00378 | ECH_1 | 1.24 |
| PF00144 | Beta-lactamase | 1.24 |
| PF04909 | Amidohydro_2 | 1.24 |
| PF07077 | DUF1345 | 1.24 |
| PF01872 | RibD_C | 1.24 |
| PF03641 | Lysine_decarbox | 1.24 |
| PF02609 | Exonuc_VII_S | 1.24 |
| PF02585 | PIG-L | 0.62 |
| PF01297 | ZnuA | 0.62 |
| PF00106 | adh_short | 0.62 |
| PF04199 | Cyclase | 0.62 |
| PF00583 | Acetyltransf_1 | 0.62 |
| PF13489 | Methyltransf_23 | 0.62 |
| PF04075 | F420H2_quin_red | 0.62 |
| PF07784 | DUF1622 | 0.62 |
| PF07228 | SpoIIE | 0.62 |
| PF01641 | SelR | 0.62 |
| PF05721 | PhyH | 0.62 |
| PF00578 | AhpC-TSA | 0.62 |
| PF04542 | Sigma70_r2 | 0.62 |
| PF03729 | DUF308 | 0.62 |
| PF01494 | FAD_binding_3 | 0.62 |
| PF00271 | Helicase_C | 0.62 |
| PF13714 | PEP_mutase | 0.62 |
| PF11799 | IMS_C | 0.62 |
| PF14279 | HNH_5 | 0.62 |
| PF00589 | Phage_integrase | 0.62 |
| PF01565 | FAD_binding_4 | 0.62 |
| PF00067 | p450 | 0.62 |
| PF01497 | Peripla_BP_2 | 0.62 |
| PF03965 | Penicillinase_R | 0.62 |
| PF03706 | LPG_synthase_TM | 0.62 |
| PF00166 | Cpn10 | 0.62 |
| PF01654 | Cyt_bd_oxida_I | 0.62 |
| PF13242 | Hydrolase_like | 0.62 |
| PF13649 | Methyltransf_25 | 0.62 |
| PF08241 | Methyltransf_11 | 0.62 |
| PF14026 | DUF4242 | 0.62 |
| PF03988 | DUF347 | 0.62 |
| PF13577 | SnoaL_4 | 0.62 |
| PF01545 | Cation_efflux | 0.62 |
| PF01527 | HTH_Tnp_1 | 0.62 |
| PF01841 | Transglut_core | 0.62 |
| PF01814 | Hemerythrin | 0.62 |
| PF02515 | CoA_transf_3 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG3670 | Carotenoid cleavage dioxygenase or a related enzyme | Secondary metabolites biosynthesis, transport and catabolism [Q] | 4.97 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 2.48 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.48 |
| COG0059 | Ketol-acid reductoisomerase | Amino acid transport and metabolism [E] | 2.48 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 2.48 |
| COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.86 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.24 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 1.24 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.24 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.24 |
| COG1722 | Exonuclease VII small subunit | Replication, recombination and repair [L] | 1.24 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.24 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.24 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.24 |
| COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 1.24 |
| COG4291 | Uncharacterized membrane protein | Function unknown [S] | 1.24 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.24 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.24 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 1.24 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.62 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.62 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.62 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.62 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.62 |
| COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.62 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.62 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.62 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.62 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.62 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.62 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.62 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.62 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.62 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.62 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.62 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.62 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.62 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.62 |
| COG4705 | Uncharacterized membrane-anchored protein | Function unknown [S] | 0.62 |
| COG4828 | Uncharacterized membrane protein | Function unknown [S] | 0.62 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.62 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.62 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.62 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.62 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.28 % |
| Unclassified | root | N/A | 44.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q01DSIQQ | Not Available | 538 | Open in IMG/M |
| 2170459015|G14TP7Y02HRKLZ | Not Available | 617 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104783762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 840 | Open in IMG/M |
| 3300002568|C688J35102_118299462 | Not Available | 546 | Open in IMG/M |
| 3300002568|C688J35102_119747256 | Not Available | 764 | Open in IMG/M |
| 3300002568|C688J35102_120073912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 869 | Open in IMG/M |
| 3300003267|soilL1_10078654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2522 | Open in IMG/M |
| 3300003987|Ga0055471_10291119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 522 | Open in IMG/M |
| 3300003996|Ga0055467_10207547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300004005|Ga0055448_10209879 | Not Available | 761 | Open in IMG/M |
| 3300004065|Ga0055481_10322830 | Not Available | 656 | Open in IMG/M |
| 3300004081|Ga0063454_100987407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae | 676 | Open in IMG/M |
| 3300004114|Ga0062593_100190292 | Not Available | 1619 | Open in IMG/M |
| 3300004114|Ga0062593_100393715 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300004463|Ga0063356_104539400 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300004480|Ga0062592_102139618 | Not Available | 556 | Open in IMG/M |
| 3300005093|Ga0062594_101072543 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300005184|Ga0066671_10551672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 743 | Open in IMG/M |
| 3300005329|Ga0070683_100874488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces fodineus | 862 | Open in IMG/M |
| 3300005329|Ga0070683_101188864 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005332|Ga0066388_101328460 | Not Available | 1242 | Open in IMG/M |
| 3300005337|Ga0070682_100417501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1019 | Open in IMG/M |
| 3300005337|Ga0070682_101592443 | Not Available | 564 | Open in IMG/M |
| 3300005338|Ga0068868_102134270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
| 3300005347|Ga0070668_100967377 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300005347|Ga0070668_101706314 | Not Available | 578 | Open in IMG/M |
| 3300005439|Ga0070711_100428962 | Not Available | 1079 | Open in IMG/M |
| 3300005456|Ga0070678_101014481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 763 | Open in IMG/M |
| 3300005466|Ga0070685_11501219 | Not Available | 519 | Open in IMG/M |
| 3300005535|Ga0070684_100207850 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300005535|Ga0070684_100814890 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300005535|Ga0070684_102050875 | Not Available | 540 | Open in IMG/M |
| 3300005548|Ga0070665_100618476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1096 | Open in IMG/M |
| 3300005548|Ga0070665_102341018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 537 | Open in IMG/M |
| 3300005764|Ga0066903_108726534 | Not Available | 515 | Open in IMG/M |
| 3300005836|Ga0074470_10985579 | Not Available | 527 | Open in IMG/M |
| 3300005843|Ga0068860_102149965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides mesophilus | 579 | Open in IMG/M |
| 3300006047|Ga0075024_100003085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6719 | Open in IMG/M |
| 3300006057|Ga0075026_100164564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1146 | Open in IMG/M |
| 3300006057|Ga0075026_100607763 | Not Available | 643 | Open in IMG/M |
| 3300006057|Ga0075026_100705474 | Not Available | 603 | Open in IMG/M |
| 3300006059|Ga0075017_100475213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 946 | Open in IMG/M |
| 3300006059|Ga0075017_100977406 | Not Available | 659 | Open in IMG/M |
| 3300006059|Ga0075017_101648321 | Not Available | 507 | Open in IMG/M |
| 3300006175|Ga0070712_100035744 | All Organisms → cellular organisms → Bacteria | 3374 | Open in IMG/M |
| 3300006237|Ga0097621_100370094 | Not Available | 1278 | Open in IMG/M |
| 3300006354|Ga0075021_10005823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6504 | Open in IMG/M |
| 3300006354|Ga0075021_10009595 | All Organisms → cellular organisms → Bacteria | 5246 | Open in IMG/M |
| 3300006354|Ga0075021_10200476 | Not Available | 1218 | Open in IMG/M |
| 3300006755|Ga0079222_11637689 | Not Available | 613 | Open in IMG/M |
| 3300006755|Ga0079222_11999037 | Not Available | 570 | Open in IMG/M |
| 3300006881|Ga0068865_101154456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 684 | Open in IMG/M |
| 3300007769|Ga0102952_1150242 | Not Available | 726 | Open in IMG/M |
| 3300009098|Ga0105245_10774186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 996 | Open in IMG/M |
| 3300009098|Ga0105245_12844037 | Not Available | 536 | Open in IMG/M |
| 3300009098|Ga0105245_13058748 | Not Available | 518 | Open in IMG/M |
| 3300009156|Ga0111538_11768044 | Not Available | 778 | Open in IMG/M |
| 3300009174|Ga0105241_10734988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 904 | Open in IMG/M |
| 3300009177|Ga0105248_10575633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1271 | Open in IMG/M |
| 3300009177|Ga0105248_12646071 | Not Available | 572 | Open in IMG/M |
| 3300009545|Ga0105237_11763395 | Not Available | 626 | Open in IMG/M |
| 3300009545|Ga0105237_12736805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300009789|Ga0126307_10013472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6013 | Open in IMG/M |
| 3300009840|Ga0126313_10379638 | Not Available | 1118 | Open in IMG/M |
| 3300009870|Ga0131092_11278669 | Not Available | 572 | Open in IMG/M |
| 3300010036|Ga0126305_11132525 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300010037|Ga0126304_11237973 | Not Available | 512 | Open in IMG/M |
| 3300010044|Ga0126310_11444617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300010166|Ga0126306_10189107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1550 | Open in IMG/M |
| 3300010362|Ga0126377_11621795 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300011119|Ga0105246_10318634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1262 | Open in IMG/M |
| 3300012212|Ga0150985_100318479 | Not Available | 849 | Open in IMG/M |
| 3300012212|Ga0150985_107679790 | Not Available | 1098 | Open in IMG/M |
| 3300012469|Ga0150984_101055904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces fodineus | 768 | Open in IMG/M |
| 3300012892|Ga0157294_10245624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 549 | Open in IMG/M |
| 3300012903|Ga0157289_10254621 | Not Available | 600 | Open in IMG/M |
| 3300012907|Ga0157283_10235876 | Not Available | 599 | Open in IMG/M |
| 3300012916|Ga0157310_10374712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → Kutzneria albida → Kutzneria albida DSM 43870 | 583 | Open in IMG/M |
| 3300012951|Ga0164300_10606493 | Not Available | 647 | Open in IMG/M |
| 3300012957|Ga0164303_10674462 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300012958|Ga0164299_10181306 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300012960|Ga0164301_10308810 | Not Available | 1068 | Open in IMG/M |
| 3300012960|Ga0164301_11066423 | Not Available | 640 | Open in IMG/M |
| 3300012987|Ga0164307_11023027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces fodineus | 674 | Open in IMG/M |
| 3300012988|Ga0164306_10271917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1224 | Open in IMG/M |
| 3300012989|Ga0164305_10092012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1922 | Open in IMG/M |
| 3300013296|Ga0157374_10637803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1077 | Open in IMG/M |
| 3300013297|Ga0157378_10882233 | Not Available | 924 | Open in IMG/M |
| 3300013306|Ga0163162_11524872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 762 | Open in IMG/M |
| 3300013308|Ga0157375_11349512 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300014325|Ga0163163_10177841 | All Organisms → cellular organisms → Bacteria | 2175 | Open in IMG/M |
| 3300014325|Ga0163163_11791972 | Not Available | 674 | Open in IMG/M |
| 3300014325|Ga0163163_12580550 | Not Available | 566 | Open in IMG/M |
| 3300014326|Ga0157380_13208153 | Not Available | 522 | Open in IMG/M |
| 3300015200|Ga0173480_10704476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 633 | Open in IMG/M |
| 3300015371|Ga0132258_10016881 | All Organisms → cellular organisms → Bacteria | 15725 | Open in IMG/M |
| 3300015371|Ga0132258_10097859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6899 | Open in IMG/M |
| 3300015371|Ga0132258_10132532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5945 | Open in IMG/M |
| 3300015371|Ga0132258_10608362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2744 | Open in IMG/M |
| 3300015371|Ga0132258_11438802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1741 | Open in IMG/M |
| 3300015374|Ga0132255_104772473 | Not Available | 574 | Open in IMG/M |
| 3300015374|Ga0132255_105449565 | Not Available | 538 | Open in IMG/M |
| 3300018469|Ga0190270_10691359 | Not Available | 1010 | Open in IMG/M |
| 3300018469|Ga0190270_11465445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 731 | Open in IMG/M |
| 3300018476|Ga0190274_11504188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
| (restricted) 3300021518|Ga0224722_1174854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacteroides → Mycobacteroides abscessus → Mycobacteroides abscessus subsp. abscessus | 700 | Open in IMG/M |
| 3300025559|Ga0210087_1089651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300025901|Ga0207688_10845556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 580 | Open in IMG/M |
| 3300025911|Ga0207654_10709004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 723 | Open in IMG/M |
| 3300025915|Ga0207693_10113042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2130 | Open in IMG/M |
| 3300025918|Ga0207662_11176252 | Not Available | 545 | Open in IMG/M |
| 3300025920|Ga0207649_11085229 | Not Available | 631 | Open in IMG/M |
| 3300025928|Ga0207700_10634587 | Not Available | 952 | Open in IMG/M |
| 3300025941|Ga0207711_10834286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 858 | Open in IMG/M |
| 3300025942|Ga0207689_10609471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 919 | Open in IMG/M |
| 3300025944|Ga0207661_11276308 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300025944|Ga0207661_11352482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Polymorphospora → Polymorphospora rubra | 654 | Open in IMG/M |
| 3300025945|Ga0207679_12096898 | Not Available | 514 | Open in IMG/M |
| 3300025972|Ga0207668_10915585 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300027894|Ga0209068_10055747 | Not Available | 2015 | Open in IMG/M |
| 3300027894|Ga0209068_10161358 | Not Available | 1218 | Open in IMG/M |
| 3300027902|Ga0209048_10178637 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300027915|Ga0209069_10030772 | All Organisms → cellular organisms → Bacteria | 2511 | Open in IMG/M |
| 3300028379|Ga0268266_11374344 | Not Available | 682 | Open in IMG/M |
| 3300028381|Ga0268264_10862997 | Not Available | 907 | Open in IMG/M |
| 3300028381|Ga0268264_11496125 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300028381|Ga0268264_11825784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 618 | Open in IMG/M |
| 3300028556|Ga0265337_1182866 | Not Available | 569 | Open in IMG/M |
| 3300028592|Ga0247822_11006271 | Not Available | 688 | Open in IMG/M |
| 3300028679|Ga0302169_10192854 | Not Available | 525 | Open in IMG/M |
| 3300028712|Ga0307285_10197338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 563 | Open in IMG/M |
| 3300028764|Ga0302260_1085057 | Not Available | 653 | Open in IMG/M |
| 3300028855|Ga0302257_1041517 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300028869|Ga0302263_10305024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 631 | Open in IMG/M |
| 3300029923|Ga0311347_10657027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 637 | Open in IMG/M |
| 3300029989|Ga0311365_10487275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1068 | Open in IMG/M |
| 3300030339|Ga0311360_10853701 | Not Available | 722 | Open in IMG/M |
| 3300031232|Ga0302323_100021304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5644 | Open in IMG/M |
| 3300031251|Ga0265327_10116104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1273 | Open in IMG/M |
| 3300031251|Ga0265327_10229765 | Not Available | 832 | Open in IMG/M |
| 3300031521|Ga0311364_10613263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1097 | Open in IMG/M |
| 3300031561|Ga0318528_10045810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2200 | Open in IMG/M |
| 3300031716|Ga0310813_11981250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
| 3300031726|Ga0302321_100540668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1291 | Open in IMG/M |
| 3300031726|Ga0302321_101427311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 797 | Open in IMG/M |
| 3300031744|Ga0306918_11437298 | Not Available | 528 | Open in IMG/M |
| 3300031746|Ga0315293_10217526 | Not Available | 1564 | Open in IMG/M |
| 3300031771|Ga0318546_11334802 | Not Available | 504 | Open in IMG/M |
| 3300031834|Ga0315290_10626480 | Not Available | 932 | Open in IMG/M |
| 3300031873|Ga0315297_10777721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 799 | Open in IMG/M |
| 3300031912|Ga0306921_10476304 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300032076|Ga0306924_11262133 | Not Available | 796 | Open in IMG/M |
| 3300032091|Ga0318577_10169246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1043 | Open in IMG/M |
| 3300032256|Ga0315271_11166624 | Not Available | 666 | Open in IMG/M |
| 3300032261|Ga0306920_102855987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 656 | Open in IMG/M |
| 3300032275|Ga0315270_11199945 | Not Available | 506 | Open in IMG/M |
| 3300032397|Ga0315287_12049480 | Not Available | 629 | Open in IMG/M |
| 3300032516|Ga0315273_10936490 | Not Available | 1115 | Open in IMG/M |
| 3300033290|Ga0318519_10595502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 671 | Open in IMG/M |
| 3300033803|Ga0314862_0192011 | Not Available | 508 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.18% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 8.07% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 6.21% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.59% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.35% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.35% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.73% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.86% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.24% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.24% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.24% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.62% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.62% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.62% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.62% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.62% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.62% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.62% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.62% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.62% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.62% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004005 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D2 | Environmental | Open in IMG/M |
| 3300004065 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007769 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D1_MG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021518 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR1_MetaG | Environmental | Open in IMG/M |
| 3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028764 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300028855 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300034281 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_10093380 | 2170459005 | Grass Soil | MYIGLGVFAVLAVVCVFAGAAAMKRRREYGDGEGDGEMGEAEFRKYEGFDK |
| 4PV_03690520 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | MFYGLLIFAVVAIVCIFAGAVAMKRRRDYENSEGDDPMSDAEFRRIEGVRRLA |
| INPhiseqgaiiFebDRAFT_1047837621 | 3300000364 | Soil | MFAVVAIVCIVVGAVVMKRRSDYENSDGDDPMSDAEFRRIEGFDE* |
| C688J35102_1182994621 | 3300002568 | Soil | MYIGIGIFAVLAVIVVIAGAVAMKRSRDYGDSDGEGEMGEAEFRKYEGFDD* |
| C688J35102_1197472561 | 3300002568 | Soil | MYYGIFAFAVVAVLCIAVGASVMRKRRDYGNSEGDDGMTDAEFRKIEGFDE* |
| C688J35102_1200739121 | 3300002568 | Soil | MYIGLGIFAVLAIVVVIVGAVAMKRSRDYGDSDGEGEMGEAEFRKYEGFDE* |
| soilL1_100786545 | 3300003267 | Sugarcane Root And Bulk Soil | MVYGLLIFAVVAIVCIVAGGVAMKRRRDYEHSEGEDPMSDAEFRRIEGFDD* |
| Ga0055471_102911192 | 3300003987 | Natural And Restored Wetlands | MYLGLGIFAVLAIVCVIAGVVAMMRRRSDDSDDAGGMSEAEFRKYEGFDE* |
| Ga0055467_102075472 | 3300003996 | Natural And Restored Wetlands | MYIGLGVFAVLAVVVVIVGAIAMKRQRDYGDSDGEGEMGEAEFRKYEGFDD* |
| Ga0055448_102098792 | 3300004005 | Natural And Restored Wetlands | MYIGLGVFAILAVVVVIAGAIAMKRQRDYGNSDGEGEMGEAEFRKYEGFDD* |
| Ga0055481_103228301 | 3300004065 | Natural And Restored Wetlands | *NGGDTLRDMYIGLGVFAVLAAVCVFAGAVAMKRRREYGDSEGEGEMGEAEFRKYEGFDE |
| Ga0063454_1009874072 | 3300004081 | Soil | MYWGLRIFAVLAVVCVIAGAVAMSRRRNDYSDEEGGMSEAEFRKYEGFDD* |
| Ga0062593_1001902922 | 3300004114 | Soil | MLIGWLVFAVIAVVCVVAGGVAMKRRRDYESSEGDDDPMSDAEFRRIEGFDE* |
| Ga0062593_1003937152 | 3300004114 | Soil | MFYGLLIFAVVAIVCIFAGAVAMKRRRDYENSEGDDPMSDAEFRRIEGFDD* |
| Ga0063356_1045394001 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLIGWLVFAFIAVVCVIAGAVVMKRRREYEDSEGEDPMSDAEFRRIEGFDD* |
| Ga0062592_1021396181 | 3300004480 | Soil | VVCVIAGAVVMKRRREYEDSDGEDPMSDAEFRRIEGFDD* |
| Ga0062594_1010725432 | 3300005093 | Soil | MLIGWLVFAVIAVVCVVAGGVAMKRRRDYENSDGDDPMSDAEFRRIEGFDE* |
| Ga0066671_105516721 | 3300005184 | Soil | LLAFAVVAVVCVVAGAAVMRRRRDYGNSEGDGGMTDAEFRKIEGFDE* |
| Ga0070683_1008744881 | 3300005329 | Corn Rhizosphere | MYFGIIAFAIVAVVCVVAGAAAMRRRRDYGNSEGDGGGMTEAEFRKIEGFDD* |
| Ga0070683_1011888642 | 3300005329 | Corn Rhizosphere | MYIGIGVFAVLAIIVVLAGTVAMKRRREYGDADGDGEMGEAEFRKYEGFDD* |
| Ga0066388_1013284602 | 3300005332 | Tropical Forest Soil | MLIGWLVFAFIAVVCIFAGGVAMKRRRDYGNSEGDDVMSDAEFRKIEGFDE* |
| Ga0070682_1004175012 | 3300005337 | Corn Rhizosphere | MYIGLGVFAVLAAVCVFAGAAAMKRRREYGDSDADGEMGEAEFRKYEGFDK* |
| Ga0070682_1015924432 | 3300005337 | Corn Rhizosphere | MYWGLGIFAVLAVVCVIAGAVTMSRRRSDYSDEEGGMSEAEFRKYEGFDD* |
| Ga0068868_1021342701 | 3300005338 | Miscanthus Rhizosphere | MWIGLGVFAVLAIVVVFVGAVAMKRSRDYGDSDGEGEMGEAEFRKYEGFDD* |
| Ga0070668_1009673772 | 3300005347 | Switchgrass Rhizosphere | MYWGLGIFAVLAVVCIIAGAVAMSRRRSDYSDEEGGMSEAEFRKYEGFDD* |
| Ga0070668_1017063141 | 3300005347 | Switchgrass Rhizosphere | MFYGLLIFAVVAIVCIFAGAVAMKRRRDYENSEGDDPMSDAE |
| Ga0070711_1004289621 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MYIGLGVFAVLAAVCVFAGAVAMKRRREYGDSDADGEMGEAEFRKYEGFDK* |
| Ga0070678_1010144812 | 3300005456 | Miscanthus Rhizosphere | MWIGLGVFAVLAIVVVFVGAVAMKRSRDYGDSDGEGEMGEAEFRKYEGFDE* |
| Ga0070685_115012192 | 3300005466 | Switchgrass Rhizosphere | MYIGIGIFAVLAVVVVIVGAVAMKRQRDYGDSDGEGEMGEAEF |
| Ga0070684_1002078502 | 3300005535 | Corn Rhizosphere | MYIGIGVFAVLAVIVVFAGMVAMKRRREYGDADGDGEMGEAEFRKYEGFDD* |
| Ga0070684_1008148902 | 3300005535 | Corn Rhizosphere | MYFGLLAFALVAVVCVVAGAAAMRRRRDYGNSEGDGGMTEAEFRKIEGFDE* |
| Ga0070684_1020508752 | 3300005535 | Corn Rhizosphere | MYFGIIAFAIVAVVCVVAGAAAMRRRRDYGNSEGDGGGMTEAEFRKIEGFD |
| Ga0070665_1006184762 | 3300005548 | Switchgrass Rhizosphere | MYIGLGAFAFLAIVCVIAGAVAMKRRKDDYGDGPGSMDEAEFRKYEGFDE* |
| Ga0070665_1023410182 | 3300005548 | Switchgrass Rhizosphere | MYWGLGIFAVLAVVCIIAGAVAMSRRRNDYSDEEGGMSEAEFRKYEGFDD* |
| Ga0066903_1087265342 | 3300005764 | Tropical Forest Soil | MLIGWLVFAVIAVVCVVAGGVAMKRRRDYESSDGDDPMSDAEFRRIEGFDE* |
| Ga0074470_109855792 | 3300005836 | Sediment (Intertidal) | MLVGGLVFAVVAILCIVVGVVAMKRRSDYGNSDGDGGMSDAEFRRIEGIDE* |
| Ga0068860_1021499652 | 3300005843 | Switchgrass Rhizosphere | LAIVVVFVGAVAMKRSRDYGDSDGEGEMGEAEFRKYEGFDE* |
| Ga0075024_1000030855 | 3300006047 | Watersheds | MYIGLGVFAILAIVCVFAGAAAMKRNRDYGDSDGDGDGEMGEAEFRKYEGFDK* |
| Ga0075026_1001645643 | 3300006057 | Watersheds | MYIGIGIFAVLAVIVVIAGAVSMKRSRDYGDSDGEGEMGEAEFRKYEGFDD* |
| Ga0075026_1006077632 | 3300006057 | Watersheds | MWIGFGVFAVLAVVVVVVGAIAMKRSRDYGDSDGEGEMGEAEFRKYEGFDD* |
| Ga0075026_1007054742 | 3300006057 | Watersheds | MYIGLGVFAVIAILCVFAGAVAMKRRRDYGNSEGDGDGGMSEAEFRKYEGFDD* |
| Ga0075017_1004752131 | 3300006059 | Watersheds | MYVGLGIFAVAAAVCIFAGAVAMKRRRDYGNSDGDGEMGEAEFRKYEGFDE* |
| Ga0075017_1009774063 | 3300006059 | Watersheds | MYVGLGVFAILAVVVVFAGAVAMKRRRDYGNSDGDGEMGEAEFRKYEGFDE* |
| Ga0075017_1016483212 | 3300006059 | Watersheds | MYVGLGVFAILAVVVVFAGAVAMKRSRDYGNSDDEGEMGEAEFRKYEGFDE* |
| Ga0070712_1000357446 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MYIGLGVFAVLAAVCVFAGAVAMKRRRVYGDSDADGEMGEAEFRKYEGFDK* |
| Ga0097621_1003700944 | 3300006237 | Miscanthus Rhizosphere | PRWTIRVGSMWIGLGVFAVLAIVVVFVGAVAMKRSRDYGDSDGEGEMGEAEFRKYEGFDE |
| Ga0075021_100058234 | 3300006354 | Watersheds | MYIGLGVFAVIAILCVIAGSVAMKRRRDYGNSEGEGDGGMSEAEFRKYEGFDD* |
| Ga0075021_100095955 | 3300006354 | Watersheds | MYFGLLAFFLVAIVCVVVGAAAMKKRRDYGNSEGDGGMSDAEFRKIEGFDE* |
| Ga0075021_102004762 | 3300006354 | Watersheds | MYIGLGVFAILAVVCVVAGAVAMKRRRDYGNSDGDGQMGEAEFRKYEGFDK* |
| Ga0079222_116376892 | 3300006755 | Agricultural Soil | MYFGLLAFALVAIVCVVAGAAAMKRRREYGDSEGDGGMSDAEFRKIEGFDD* |
| Ga0079222_119990372 | 3300006755 | Agricultural Soil | LSHGRTGRYLLPMLIGWLVFAVIAGVCVVAGGVAMKRRRDYENRDGDDPMSDAEFRRIEGFDD* |
| Ga0068865_1011544562 | 3300006881 | Miscanthus Rhizosphere | MYIGIGIGAFAILAIICIFAGAAVMKRNREYGDSDGEGEMGEAEFRKYEGFDD* |
| Ga0102952_11502421 | 3300007769 | Soil | MYIGLGVFAVLAAVCVFAGAVAMKRRREYGDSEGEGEMGEAEFRKYEGFDE* |
| Ga0105245_107741862 | 3300009098 | Miscanthus Rhizosphere | MYIGLGIFAILAVVVVFAGAVAMKRSRDYGDSDGEGEMGEAEFRKYEGFDD* |
| Ga0105245_128440372 | 3300009098 | Miscanthus Rhizosphere | MYFGIIAFAIVAVVCVVAGAAAMRKRRDYGNSEGDGGMTEAEFRKIEGFDE* |
| Ga0105245_130587481 | 3300009098 | Miscanthus Rhizosphere | MYIGLGVFAVLAVVCVFAGAAAMKRRREYGDSDADGEMGEAEFRKYEGFDK* |
| Ga0111538_117680442 | 3300009156 | Populus Rhizosphere | MYIGIGIFAVLAVVVVIVGAVAMKRQRDYGDSDGEGEMGEAEFRKYEGFDE* |
| Ga0105241_107349882 | 3300009174 | Corn Rhizosphere | MYIGLGVFAVLAVVCVFAGAVAMKRRRDDDGDPDAEGQMGEAEFRRYEGFDE* |
| Ga0105248_105756333 | 3300009177 | Switchgrass Rhizosphere | MYIGIGIFAVLAVVVVIVGAVAMKRQRDYGDSDGEGEMGEAEFRKYEGFDD* |
| Ga0105248_126460712 | 3300009177 | Switchgrass Rhizosphere | MYWGLGIFAVLAVVCVIAGAVTMSRRRSDYSDDEGGMSEAEFRKYEGFDD* |
| Ga0105237_117633952 | 3300009545 | Corn Rhizosphere | MYFGLLAFALVAVVCVVAGAAAMRRRRDYGNSEGDGGMSEAEFRKIEGFDD* |
| Ga0105237_127368051 | 3300009545 | Corn Rhizosphere | VYIGLGVFAVLAVVCVFAGAVAMKRRRDDYGDPDAEGQMGEAEFRKYEGFDE* |
| Ga0126307_100134727 | 3300009789 | Serpentine Soil | MYIGLGIFAVLAVVVVVAGAVAMKRSRDYGDSEGEGEMGEAEFRKYEGFDD* |
| Ga0126313_103796383 | 3300009840 | Serpentine Soil | MYIGLGVFAILAVVCIFAGAAAMKRRREYGDSDVEGEMGEAEFRKYEGFDK* |
| Ga0131092_112786691 | 3300009870 | Activated Sludge | MYFGVLAFFVIAVVCVVAGAAAMRRRRDYGNRDGDGEMGEAEFRKYEGFDD* |
| Ga0126305_111325251 | 3300010036 | Serpentine Soil | MYIGLGIFAVLAVVVVIAGAVAMKRSRDYGDSNGDGEGEGEMGEAEFRKYEGFDD* |
| Ga0126304_112379731 | 3300010037 | Serpentine Soil | MYIGLGIFAVLAVIVVIAGAVAMKRSRDYGDSDGEGEMGEAE |
| Ga0126310_114446172 | 3300010044 | Serpentine Soil | MYIGLGIFAVLAIVVVVAGAVAMKRSRDYGDSEGEGEMGEAEFRKYEGFDD* |
| Ga0126306_101891074 | 3300010166 | Serpentine Soil | MWIGLGVFAVLAIVVVFAGAIAMKRSRDYGDSDGDGGMSEAEFRKIEGFDE* |
| Ga0126377_116217953 | 3300010362 | Tropical Forest Soil | MLIGGLVFAVIAVVCVVAGAVAMKRRRDYESSGGEDPMSDAEFRRIEGFDD* |
| Ga0105246_103186342 | 3300011119 | Miscanthus Rhizosphere | MWIGLGVFAVLAIVVVFVGAVAMKRSRDYGDSDGEGEMGEAEFRTYEGFDE* |
| Ga0150985_1003184792 | 3300012212 | Avena Fatua Rhizosphere | MYWGLGIFAVLAVVCVIAGAVAMSRRRNDYSDEEGGMSEAEFRKYEGFDD* |
| Ga0150985_1076797902 | 3300012212 | Avena Fatua Rhizosphere | MYFGLAAFFVVAVVCVVAGAAAMRRRRDYGNSEGDGGMTDAEFRKIEGFDE* |
| Ga0150984_1010559042 | 3300012469 | Avena Fatua Rhizosphere | VVAVVCVVAGAAAMRKRRDYEHSEGDDGGMSEAEFRKIEGFDD* |
| Ga0157294_102456242 | 3300012892 | Soil | WIGLGVFAVLAIVVVFVGAVAMKRSRDYGNSDGEGEMGEAEFRKYEGFDE* |
| Ga0157289_102546212 | 3300012903 | Soil | FAVLAVVCVIAGAVAMSRRRSDYSDEEGGMSEAEFRKYEGFDD* |
| Ga0157283_102358761 | 3300012907 | Soil | LAVVCIIAGAVAMSRRRSDYSDEEGGMSEAEFRKYEGFDD* |
| Ga0157310_103747122 | 3300012916 | Soil | MYWGLGIFAVLAVVCVIAGAVAMSRRRSDYSDEEGGMSEAEFRKYEGFD |
| Ga0164300_106064933 | 3300012951 | Soil | MLIGWLVFAVIAVVCVVAGGVAMKRRRDYENSDGDDPMSDAEFRRIEGFD |
| Ga0164303_106744621 | 3300012957 | Soil | MYGGIIAFAVGAVVCVVAGAAAMRKRRDYGNSEGDGGGMTEAEFRKIEGFDE* |
| Ga0164299_101813061 | 3300012958 | Soil | MYIGLGVFAILAVVVIFAGAVAMKRRRDYGNSEGDAGMTDAEFRKYE |
| Ga0164301_103088103 | 3300012960 | Soil | LGIFAVLAIVVVIVGAVAMKRQRDYGDSDGEGEMGEAEFRKYEGFDD* |
| Ga0164301_110664233 | 3300012960 | Soil | MLIGWLVFAIIAVVCVAAGGVAMKLRRDYENSDGDDPMSDAEFRRIEGFDE* |
| Ga0164307_110230272 | 3300012987 | Soil | GMYFGIIAFAIVAVVCVVAGAAAMRKRRDYGNSEGDGGGMTEAEFRKIEGFDE* |
| Ga0164306_102719171 | 3300012988 | Soil | MYFGLLAFALVAVVCVVAGAAAMKRRREYGDSEGDGGMSDAEFRKIEGFDD* |
| Ga0164305_100920121 | 3300012989 | Soil | MYFGIIAFAVVAVVCVVAGAAAMRRRRDYGNSEGDGGGMTEAEFRKIEGFDE |
| Ga0157374_106378031 | 3300013296 | Miscanthus Rhizosphere | MYFGIIAFAVVAVVCVVAGAAAMRKRRDYGNSEGDGGMTEAEFRKIEGFDE* |
| Ga0157378_108822332 | 3300013297 | Miscanthus Rhizosphere | LGVFAVLAAVCVFAGAAAMKRRREYGDSDADGEMGEAEFRKYEGFDK* |
| Ga0163162_115248722 | 3300013306 | Switchgrass Rhizosphere | FAVLAAVCVFAGAAAMKRRREYGDSDADGEMGEAEFRKYEGFDK* |
| Ga0157375_113495123 | 3300013308 | Miscanthus Rhizosphere | MFYGLLIFAIVAIVCVVTGGVAMKRRRDYENSDGDDPMSDAEFR |
| Ga0163163_101778414 | 3300014325 | Switchgrass Rhizosphere | MYIGLGVFAVLAVVCVIAGAMTMKRRRDDYEDGDGGMSEAEFRKYEGFDD* |
| Ga0163163_117919722 | 3300014325 | Switchgrass Rhizosphere | MYFGLLAFAVVAVVCVVAGAAAMRRRRDYGNSEGDGGMTDAEFRKIEGFDD* |
| Ga0163163_125805502 | 3300014325 | Switchgrass Rhizosphere | MYIGIGIFAVLAVVVVIVGAVAMKRQRDYGDSDGEGEMGEAEFRKYEGFD |
| Ga0157380_132081531 | 3300014326 | Switchgrass Rhizosphere | MFYGLLIFAIVAIVCVVAGGVAMKRRRDYENSDGDDPMSDAEFRRIEGFDD* |
| Ga0173480_107044761 | 3300015200 | Soil | MWIGLGVFAVLAIVVVFVGAVAMKRSRDYGNSDGEGEMGEAEFRKYEGFDE* |
| Ga0132258_100168813 | 3300015371 | Arabidopsis Rhizosphere | MYIGLGVFAILAIVCVVAGAMAMKRRRDDYDGDAGMGEAEFRKYEGLDQ* |
| Ga0132258_100978591 | 3300015371 | Arabidopsis Rhizosphere | VVAVVCVVAGAVAMKRRRDYENSEGDDPMSDAEFRRIEGFDD* |
| Ga0132258_101325324 | 3300015371 | Arabidopsis Rhizosphere | MFIGWLVFALIAVICVVAGGVAMKRRRDYENSEGEDPMTDAEFRRIEGFDD* |
| Ga0132258_106083623 | 3300015371 | Arabidopsis Rhizosphere | MFYGLLIFAIVAIVCVVAGGVALKRRRDYENSDGDDPMSDAEFRRIEGFDD* |
| Ga0132258_114388021 | 3300015371 | Arabidopsis Rhizosphere | MYIGLGVFAILAVVVIFAGAVAMKRRRDYGNSEGDAGMTDAEFRKYEGFDK* |
| Ga0132255_1047724732 | 3300015374 | Arabidopsis Rhizosphere | MFIGWLVFALIAVVCVVAGGVAMKRRRDYENSEGEDPMTDAEFRRIEGFDD* |
| Ga0132255_1054495651 | 3300015374 | Arabidopsis Rhizosphere | MYFGLAAFFLVAVVCVVAGAAAMRRRRDYGNSEGDGGMTDAEFRKIEGFDD* |
| Ga0190270_106913593 | 3300018469 | Soil | MWIGMGVFAVLAVVVVIAGAVAMKRQRDYGNSDGEGEMGEAEFRKYEGFD |
| Ga0190270_114654452 | 3300018469 | Soil | MYIGLGIFAVLAVVVVIAGAIAMKRQRDYGNSDGEGEMGEAEFRKYEGFDE |
| Ga0190274_115041882 | 3300018476 | Soil | MWIGMGVFAVLAVVVVIAGAVAMKRQRDYGNSDGEGEMGEAEFRKYEGFDE |
| (restricted) Ga0224722_11748541 | 3300021518 | Freshwater Sediment | MGYGIAIFAVVAIGCVIAGAVAMRRRGDAGDDDTMSDAEFRRIEGFDEP |
| Ga0210087_10896511 | 3300025559 | Natural And Restored Wetlands | MYIGLGVFAVLAVVVVIVGAIAMKRQRDYGDSDGEGEMGEAEFRKYEGFDD |
| Ga0207688_108455562 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MYIGIGIFAVLAVVVVIVGAVAMKRQRDYGDSDGEGEMGEAEFRKYEGFDE |
| Ga0207654_107090041 | 3300025911 | Corn Rhizosphere | VYIGLGVFAVLAVVCVFAGAVAMKRRRDDYGDPDAEGQMGEAEFRKYEGFDE |
| Ga0207693_101130422 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VFAVLAAVCVFAGAVAMKRRRVYGDSDADGEMGEAEFRKYEGFDK |
| Ga0207662_111762522 | 3300025918 | Switchgrass Rhizosphere | WLVFAVIAVVCVVAGGVAMKRRRDYENSDGDDPMSDAEFRRIEGFDE |
| Ga0207649_110852291 | 3300025920 | Corn Rhizosphere | MYFGIIAFAIVAVVCVVAGAAAMRKRRDYGNSEGDGGMTEAEFRKIEGFDE |
| Ga0207700_106345871 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VFAVLAAVCVFAGAAAMKRRREYGDSDADGEMGEAEFRKYEGFDK |
| Ga0207711_108342862 | 3300025941 | Switchgrass Rhizosphere | MYIGIGIFAVLAVVVVIVGAVAMKRQRDYGDSDGEGEMGEAEFRKYEGFDD |
| Ga0207689_106094711 | 3300025942 | Miscanthus Rhizosphere | MYWGLGIFAVLAIVCVIAGAVAMSRRRADYSDEEGGMSE |
| Ga0207661_112763082 | 3300025944 | Corn Rhizosphere | MYIGIGVFAVLAIIVVLAGTVAMKRRREYGDADGDGEMGEAEFRKYEGFDD |
| Ga0207661_113524822 | 3300025944 | Corn Rhizosphere | MYFGIIAFAIVAVVCVVAGAAAMRRRRDYGNSEGDGGGMTEAEFRKIEGFDD |
| Ga0207679_120968982 | 3300025945 | Corn Rhizosphere | IVAIVCVVAGGVAMKRRRDYENSEGDDPMSDAEFRRIEGFDE |
| Ga0207668_109155852 | 3300025972 | Switchgrass Rhizosphere | MYWGLGIFAVLAVVCIIAGAVAMSRRRSDYSDEEGGMSEAEFRKYEGFDD |
| Ga0209068_100557474 | 3300027894 | Watersheds | MYIGLGVFAVIAILCVIAGSVAMKRRRDYGNSEGEGDGGMSEAEFRKYEGFDD |
| Ga0209068_101613582 | 3300027894 | Watersheds | MYIGLGVFAILAVVCVVAGAVAMKRRRDYGNSDGDGQMGEAEFRKYEGFDK |
| Ga0209048_101786372 | 3300027902 | Freshwater Lake Sediment | MYFGLAIFAIVAVVCVFGGAIAMKRSRDYGNSDGDGDMGEAEFRKYEGFDK |
| Ga0209069_100307722 | 3300027915 | Watersheds | MYIGLGVFAILAIVCVFAGAAAMKRNRDYGDSDGDGDGEMGEAEFRKYEGFDK |
| Ga0268266_113743441 | 3300028379 | Switchgrass Rhizosphere | MYWGLGIFAVLAVVCVIAGAVAMSRRRSDYSDEEGGMSEAEFRKYEGFDD |
| Ga0268264_108629971 | 3300028381 | Switchgrass Rhizosphere | MYIGLGAFAFLAIVCVIAGAVAMKRRKDDYGDGPGSMDEAEFRKYEGFDE |
| Ga0268264_114961252 | 3300028381 | Switchgrass Rhizosphere | MYIGLGVFAVLAVVCVIAGAMAMKRRRDDYEDGDGGMSEAEFRKYEGFDD |
| Ga0268264_118257841 | 3300028381 | Switchgrass Rhizosphere | MYFGLLAFAVVAVVCVVAGAAAMRRRRDYGNSEGDGGMTDAEFRKIEGFDD |
| Ga0265337_11828662 | 3300028556 | Rhizosphere | MYIGLGVFAVLAIVVVFAGAVAMKRRRDYGDSDGTDEMNEAEFRKYEGFDD |
| Ga0247822_110062713 | 3300028592 | Soil | MFYGLLIFAVVAIVCIFAGAVAMKRRRDYENSEGDDPMSDAEFRRIEGFDD |
| Ga0302169_101928542 | 3300028679 | Fen | MVVGGLVFAVIAVLCIFAGTVAMKRRRDYGNSDGDGGMSEAEFRKIEGFDE |
| Ga0307285_101973381 | 3300028712 | Soil | MWIGLGVFAVLAVVVVIVGAVAMKRQRDYGNSDGEGEMGEAEFRKYEGFDE |
| Ga0302260_10850571 | 3300028764 | Fen | VVGGLIFAVLAIVCIVAGGMAMKRRSDYGNSDGDGGMSDAEFRKIEGFDE |
| Ga0302257_10415172 | 3300028855 | Fen | MVVGGLIFAVLAIVCIVAGGMAMKRRSDYGNSDGDGGMSDAEFRKIEGFDE |
| Ga0302263_103050241 | 3300028869 | Fen | ARRSSEPDRVGGMVVGGLIFAVLAIVCIVAGGMAMKRRSDYGNSDGDGGMSDAEFRKIEGFDE |
| Ga0311347_106570271 | 3300029923 | Fen | SSEPDRVGGMVVGGLIFAVLAIVCIVAGGMAMKRRSDYGNSDGDGGMSDAEFRKIEGFDE |
| Ga0311365_104872752 | 3300029989 | Fen | SEPDRVGGMVVGGLIFAVLAIVCIVAGGMAMKRRSDYGNSDGDGGMSDAEFRKIEGFDE |
| Ga0311360_108537013 | 3300030339 | Bog | MFFGFLIFAILAFLCVIAGAIAMKRSRDYGNSDGGDDDF |
| Ga0302323_1000213043 | 3300031232 | Fen | VFAVIAVLCIFAGTVAMKRRRDYGNSDGDGGMSEAEFRKIEGFDE |
| Ga0265327_101161044 | 3300031251 | Rhizosphere | MYIGLGIFAVLAVLAVIAGAVSMRRRRDYVDTDEPGEMGEAEFRKYEGFDD |
| Ga0265327_102297652 | 3300031251 | Rhizosphere | MYIGIGIFAVLAVVVVIAGGVAMKRRRDYGNSGGEGDGEMGEAEFRKYEGFDK |
| Ga0311364_106132633 | 3300031521 | Fen | MVIGGLVFAVIAVLCIFAGAVAMKRRRDYGDSDGDGGMSEAEFRKIEGFDD |
| Ga0318528_100458101 | 3300031561 | Soil | MQEGEYRLSMYIGLGVFAVLAIVCVFAGVTAMKRRRDDYGEGDGEMGEAEFRKYEGFDN |
| Ga0310813_119812502 | 3300031716 | Soil | MFYGLLIFAIVAIVCVVAGGVAMKRRRDYENSDGDDPMSDAEFRRIEGFDD |
| Ga0302321_1005406681 | 3300031726 | Fen | LGVFAVLAIVVVWAGAVAMKRRRDYGDSDGSDEMNEADFRKYEGFDD |
| Ga0302321_1014273113 | 3300031726 | Fen | RAMVIGGLVFAVIAVLCIFAGAVAMKRRRDYGDSDGDGGMSEAEFRKIEGFDD |
| Ga0306918_114372982 | 3300031744 | Soil | GGSTLPVMYIGLGVFAVLAILCIVAGAVAMKRRRSDYGDGDAGMGEAEFRKYEGLDD |
| Ga0315293_102175262 | 3300031746 | Sediment | MLVGGLVFAVVALVCIVVGAVVMKRRSNYGNSDGDDVMSDAEFRKIEGFDE |
| Ga0318546_113348021 | 3300031771 | Soil | GGVRDGGSTLPVMYIGLGVFAVLAILCIVAGAVAMKRRRSDYGDNDAGMGEAEFRKYEGLDD |
| Ga0315290_106264801 | 3300031834 | Sediment | MLVGGLVFAVVALVCIVAGAVVMKRRSDYGNSDGDDVMSDAEFRKIEGFDE |
| Ga0315297_107777211 | 3300031873 | Sediment | MLVGGLVFAVVALVCIVAGAVVMKRRSEYGNSDGDDVMSDAEFRKIEGFDE |
| Ga0306921_104763042 | 3300031912 | Soil | MYIGLGVFAVLAILCIVAGAVAMKRRRSDYGDGDAGMGEAEFRKYEGLDD |
| Ga0306924_112621332 | 3300032076 | Soil | MYIGLGIFAVLAIVCVIAGAVAMKRRGDDYGDAEGEMSEAEFRKYEGFDE |
| Ga0318577_101692463 | 3300032091 | Soil | IGLGIFAVLAIVCVIAGAVAMKRRGDDYGDAEGEMSEAEFRKYEGFDE |
| Ga0315271_111666242 | 3300032256 | Sediment | MYVGLGVFAFVAVLCIVAGAVAMKRRRDYGDSDGEGEMGEAEFRKYEGFDE |
| Ga0306920_1028559872 | 3300032261 | Soil | VFAVLAILCIVAGAVAMKRRRSDYGDGDAGMGEAEFRKYEGLDD |
| Ga0315270_111999451 | 3300032275 | Sediment | MYVGLGVFAFVAVLCIVAGAVAMKRRRDYGDSDGEGEMGEA |
| Ga0315287_120494802 | 3300032397 | Sediment | MLIGGLVFAVVALVCIVAGAVVMKRRSDYGNSDGDDPMSDAEFRKIEGFDE |
| Ga0315273_109364902 | 3300032516 | Sediment | MYVGLGVFAFVAVLCIVAGAVAMKRRRDYGDSEGEGEMGEAEFRKYEGFDE |
| Ga0318519_105955022 | 3300033290 | Soil | VQRVNCRREIAAMQEGEYRLSMYIGLGVFAVLAIVCVFAGVTAMKRRRDDYGEGDGEMGEAEFRKYEGFDN |
| Ga0314862_0192011_333_485 | 3300033803 | Peatland | MYIGLGIFAVLAILCIVVGAVGMSRRRADYGEGKGQMGEAEFRKYEGFDE |
| Ga0370481_0232487_2_145 | 3300034281 | Untreated Peat Soil | MWFGIIAFALVAILCIGVGAAAMKKRRDYGNSEGEDVMSDAEFRRIEG |
| ⦗Top⦘ |