


| Basic Information | |
|---|---|
| Family ID | F040739 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 44 residues |
| Representative Sequence | QKTATRLQDSRQTELEILTDTEIRNLVASQGIRLIDYGFVAQEA |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.38 % |
| % of genes from short scaffolds (< 2000 bps) | 90.06 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.379 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.329 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.783 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.596 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.28% β-sheet: 0.00% Coil/Unstructured: 59.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF00535 | Glycos_transf_2 | 91.93 |
| PF01613 | Flavin_Reduct | 3.11 |
| PF03301 | Trp_dioxygenase | 1.86 |
| PF00486 | Trans_reg_C | 0.62 |
| PF02700 | PurS | 0.62 |
| PF03807 | F420_oxidored | 0.62 |
| PF11412 | DsbC | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 3.11 |
| COG3483 | Tryptophan 2,3-dioxygenase (vermilion) | Amino acid transport and metabolism [E] | 1.86 |
| COG1828 | Phosphoribosylformylglycinamidine (FGAM) synthase, PurS subunit | Nucleotide transport and metabolism [F] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.38 % |
| Unclassified | root | N/A | 0.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10256303 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100008381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8242 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100519909 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101625227 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300002558|JGI25385J37094_10207366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 524 | Open in IMG/M |
| 3300004136|Ga0058889_1401125 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300004139|Ga0058897_11082760 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300004479|Ga0062595_101859623 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005332|Ga0066388_101561230 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300005537|Ga0070730_10021644 | All Organisms → cellular organisms → Bacteria | 4981 | Open in IMG/M |
| 3300005537|Ga0070730_10733403 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300005542|Ga0070732_10174307 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300005542|Ga0070732_10741873 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005553|Ga0066695_10040545 | All Organisms → cellular organisms → Bacteria | 2736 | Open in IMG/M |
| 3300005566|Ga0066693_10237706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 719 | Open in IMG/M |
| 3300005712|Ga0070764_10822677 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300006041|Ga0075023_100583969 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006102|Ga0075015_100842782 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006102|Ga0075015_100844060 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300006162|Ga0075030_100655373 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300006176|Ga0070765_100401424 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300006176|Ga0070765_100402195 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300006797|Ga0066659_11388514 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300007255|Ga0099791_10002315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7683 | Open in IMG/M |
| 3300007255|Ga0099791_10648214 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300007265|Ga0099794_10654148 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300009038|Ga0099829_10061679 | All Organisms → cellular organisms → Bacteria | 2815 | Open in IMG/M |
| 3300009088|Ga0099830_10304870 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300009088|Ga0099830_11659833 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300009089|Ga0099828_10163325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 1974 | Open in IMG/M |
| 3300009089|Ga0099828_11968720 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300010047|Ga0126382_11642399 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300010304|Ga0134088_10102443 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300010326|Ga0134065_10028522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1623 | Open in IMG/M |
| 3300010358|Ga0126370_10740764 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300010358|Ga0126370_11176364 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300010359|Ga0126376_10213578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1610 | Open in IMG/M |
| 3300010360|Ga0126372_10504915 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300011120|Ga0150983_14061934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1091 | Open in IMG/M |
| 3300011269|Ga0137392_11139092 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300011270|Ga0137391_11201626 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300011271|Ga0137393_10750956 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300012202|Ga0137363_11542388 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012203|Ga0137399_10126501 | All Organisms → cellular organisms → Bacteria | 2015 | Open in IMG/M |
| 3300012205|Ga0137362_10036762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3918 | Open in IMG/M |
| 3300012205|Ga0137362_10802678 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300012205|Ga0137362_11453790 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012210|Ga0137378_10378139 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300012210|Ga0137378_10453380 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300012685|Ga0137397_11195032 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012922|Ga0137394_11239139 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300012924|Ga0137413_11345960 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012924|Ga0137413_11687395 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012957|Ga0164303_11086190 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012977|Ga0134087_10156161 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300012989|Ga0164305_10893450 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300015051|Ga0137414_1004575 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300015357|Ga0134072_10408172 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300017656|Ga0134112_10090995 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300017822|Ga0187802_10199635 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300017948|Ga0187847_10717914 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300017955|Ga0187817_10759377 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300018058|Ga0187766_10128433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1558 | Open in IMG/M |
| 3300020004|Ga0193755_1022794 | All Organisms → cellular organisms → Bacteria | 2072 | Open in IMG/M |
| 3300020140|Ga0179590_1008972 | All Organisms → cellular organisms → Bacteria | 2095 | Open in IMG/M |
| 3300020199|Ga0179592_10392794 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300020199|Ga0179592_10431089 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300020199|Ga0179592_10487603 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300020579|Ga0210407_10176852 | All Organisms → cellular organisms → Bacteria | 1653 | Open in IMG/M |
| 3300020580|Ga0210403_10240596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1485 | Open in IMG/M |
| 3300020580|Ga0210403_10344269 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300020580|Ga0210403_10570939 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300020580|Ga0210403_10878409 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300020580|Ga0210403_11387653 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300020581|Ga0210399_10227089 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
| 3300020581|Ga0210399_11147848 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300020582|Ga0210395_10221442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1420 | Open in IMG/M |
| 3300020582|Ga0210395_10722633 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300020583|Ga0210401_10399097 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300020583|Ga0210401_10500382 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300020583|Ga0210401_10838302 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300021086|Ga0179596_10369634 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300021088|Ga0210404_10329843 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300021168|Ga0210406_10203064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1643 | Open in IMG/M |
| 3300021168|Ga0210406_10687821 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300021168|Ga0210406_10944095 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300021170|Ga0210400_10506013 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300021170|Ga0210400_11264729 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300021171|Ga0210405_11176855 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300021401|Ga0210393_10885272 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300021404|Ga0210389_11418884 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300021420|Ga0210394_11552565 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300021432|Ga0210384_10053235 | All Organisms → cellular organisms → Bacteria | 3668 | Open in IMG/M |
| 3300021432|Ga0210384_10332088 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300021476|Ga0187846_10054246 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300021478|Ga0210402_10534430 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300021478|Ga0210402_10854005 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300021478|Ga0210402_11305459 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300021478|Ga0210402_11553427 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300021479|Ga0210410_11619177 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300022506|Ga0242648_1002164 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
| 3300022532|Ga0242655_10071963 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300022533|Ga0242662_10040334 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300022716|Ga0242673_1053222 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300022717|Ga0242661_1145192 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300022726|Ga0242654_10390261 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300024287|Ga0247690_1007855 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300024330|Ga0137417_1225100 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300025905|Ga0207685_10220219 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300025914|Ga0207671_10143497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1841 | Open in IMG/M |
| 3300026281|Ga0209863_10153358 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300026305|Ga0209688_1012460 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300026316|Ga0209155_1081087 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300026318|Ga0209471_1152033 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300026334|Ga0209377_1129804 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300026334|Ga0209377_1254791 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300026343|Ga0209159_1125334 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300026359|Ga0257163_1047170 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300026480|Ga0257177_1086323 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300026482|Ga0257172_1044035 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300026496|Ga0257157_1025649 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300026515|Ga0257158_1091975 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300026542|Ga0209805_1025024 | All Organisms → cellular organisms → Bacteria | 3090 | Open in IMG/M |
| 3300026551|Ga0209648_10461490 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300027104|Ga0208095_1014104 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300027109|Ga0208603_1035648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300027109|Ga0208603_1054449 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300027174|Ga0207948_1046075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 527 | Open in IMG/M |
| 3300027535|Ga0209734_1036752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 918 | Open in IMG/M |
| 3300027565|Ga0209219_1175461 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300027610|Ga0209528_1122319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 573 | Open in IMG/M |
| 3300027629|Ga0209422_1009400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2408 | Open in IMG/M |
| 3300027629|Ga0209422_1027449 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300027651|Ga0209217_1029539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1721 | Open in IMG/M |
| 3300027671|Ga0209588_1175537 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300027765|Ga0209073_10238383 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300027846|Ga0209180_10478601 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300027857|Ga0209166_10025294 | All Organisms → cellular organisms → Bacteria | 3652 | Open in IMG/M |
| 3300027862|Ga0209701_10499295 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300027879|Ga0209169_10571766 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300027903|Ga0209488_10706397 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300027903|Ga0209488_11129518 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300027910|Ga0209583_10284797 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300027910|Ga0209583_10737439 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300028065|Ga0247685_1005341 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300028800|Ga0265338_10485898 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300028906|Ga0308309_11308525 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300028906|Ga0308309_11511110 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300028906|Ga0308309_11677961 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300029636|Ga0222749_10341516 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300030043|Ga0302306_10122136 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300030043|Ga0302306_10391059 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300030617|Ga0311356_10953758 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300031753|Ga0307477_10013975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5479 | Open in IMG/M |
| 3300031754|Ga0307475_11149252 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300031754|Ga0307475_11240187 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300031962|Ga0307479_11809206 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300032180|Ga0307471_104077761 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300032783|Ga0335079_10003720 | All Organisms → cellular organisms → Bacteria | 17550 | Open in IMG/M |
| 3300032783|Ga0335079_10818219 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.35% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.11% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.11% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.86% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.24% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.62% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.62% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004136 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF214 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024 (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028065 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_102563032 | 3300001593 | Forest Soil | PAHVDDELRATSTRLQVSREKEVEILTDPEIRNLVASQGIRLIDYGFMTSAA* |
| JGIcombinedJ26739_1000083811 | 3300002245 | Forest Soil | DAALKKTPTRLQDSRETELRILTDTGIRNLVASLGIRLIDYGFVTQEA* |
| JGIcombinedJ26739_1005199092 | 3300002245 | Forest Soil | ATRLQASRQAEVEILTDTEIRNLVASQGIRLVDYGFAAQEA* |
| JGIcombinedJ26739_1016252271 | 3300002245 | Forest Soil | THTRLQASRQTELEILTDVEIRNLVASQGIRLIDYGLVASET* |
| JGI25385J37094_102073662 | 3300002558 | Grasslands Soil | GYADAALKKTATRLQDSRQAELEILTDTGVRNLVASQGIRLIDYGFVTQEA* |
| Ga0058889_14011252 | 3300004136 | Forest Soil | ENSATRLQASRQAEVEILTDTGIRNLVASQGIRLIDYGFVAQEA* |
| Ga0058897_110827601 | 3300004139 | Forest Soil | DAELANSATRLQASRQAEVEILTDAGIRNLVASQGIRLIDYGFVAQEA* |
| Ga0062595_1018596231 | 3300004479 | Soil | VDAALQNSPTRLQASRQTELEILTDVEIRNIVASQGIRLIDYGFVASEL* |
| Ga0066388_1015612302 | 3300005332 | Tropical Forest Soil | KKSATRLQKSREEELRILTDTSIRNTIASQGIRLIDYSFVAEAA* |
| Ga0070730_100216447 | 3300005537 | Surface Soil | DEALQKTATRLQASRQKELEILTDTRIRKLVASRGIRLIDYGSVTQEA* |
| Ga0070730_107334031 | 3300005537 | Surface Soil | KSPTRLQESRATELAILTDPDVRNLVASQGIRLIDYSLASSQI* |
| Ga0070732_101743071 | 3300005542 | Surface Soil | YVDDDLAKSSTRLQTSRETEVEILTDIAVRNNVASQGIRLIDYGFVAQEA* |
| Ga0070732_107418731 | 3300005542 | Surface Soil | PGYVDEALQKSATRLQESRATELAILTDPDVRNLVASQGIRLIDYSLSQI* |
| Ga0066695_100405454 | 3300005553 | Soil | YADEALEKTATRLQASRQKELEILTDTGIRNLVASQGIRLIDYGFLTRDA* |
| Ga0066693_102377061 | 3300005566 | Soil | HPGYVDAELRTSATRLQASREKEVAIFTDADVRNLVASQGIRLIDYAFVASEA* |
| Ga0070764_108226771 | 3300005712 | Soil | RTRLQGSRQTELEILTDTAVRKIVATRGIRLINYAFLAQAA* |
| Ga0075023_1005839691 | 3300006041 | Watersheds | PGYADAELEKSATRLQYSRQTELEILTDKGIRKLVASQGIRLIDYGLVASEA* |
| Ga0075015_1008427822 | 3300006102 | Watersheds | ELGESATRLQASRQTEVEILTDTGIRNLVASQGIRLIDYGLVASEA* |
| Ga0075015_1008440602 | 3300006102 | Watersheds | SRQTELEILTDTAVRKIVAMRGIHLINYGFLAQAA* |
| Ga0075030_1006553731 | 3300006162 | Watersheds | KTRTRLQGSRQTELEILTDTSIRKIVAMRGIRLINYGFLAQAA* |
| Ga0070765_1004014242 | 3300006176 | Soil | RQAEVEILTDTGIRNLVASQGIRLIDYGFAAQEA* |
| Ga0070765_1004021951 | 3300006176 | Soil | RATELAILTDPDVRNLVASQGIRLIDYGLASSQV* |
| Ga0066659_113885141 | 3300006797 | Soil | PGYADAALQKSPTRLQNSRQTELKILTGTGIRNLIASLAIRLIDYGFVSQEA* |
| Ga0099791_100023151 | 3300007255 | Vadose Zone Soil | TPTRLQGSRQNELEILTDTEIRNLVASQGIRLIDYAFLASMV* |
| Ga0099791_106482141 | 3300007255 | Vadose Zone Soil | ADAALQKSPTRLQDSRETELQILTDTGIRNLVASLGIRLIDYGFVAQEV* |
| Ga0099794_106541482 | 3300007265 | Vadose Zone Soil | DAALQKTQTRLQDSRQTELQILTDTGVRNLVASLGIRLIDYGFVTQEA* |
| Ga0099829_100616791 | 3300009038 | Vadose Zone Soil | DAALEKTPTRLQDSRQTELQILTDTGIRNLVASQGIRLIDYAFVTQEA* |
| Ga0099830_103048701 | 3300009088 | Vadose Zone Soil | ATRLQGSRQKEVEILTDTEIRNLVASQGIRLIDYAFLASTV* |
| Ga0099830_116598332 | 3300009088 | Vadose Zone Soil | GSREKEVEILTDTEIRNLVASQGIRLIDYGFVTSAV* |
| Ga0099828_101633253 | 3300009089 | Vadose Zone Soil | LQDSRQTELQILTDTGIRNLVASLGIRLIDYGFVSQEA* |
| Ga0099828_119687202 | 3300009089 | Vadose Zone Soil | PGYVDEELRKTATRLQGSREKEVEILTDTEIRNLVASQGIRLIDYGFVTSAV* |
| Ga0126382_116423992 | 3300010047 | Tropical Forest Soil | EVLEKTATRLQASRQAELEILTDTQIRKLVASQGIRLIDYGFVPQEA* |
| Ga0134088_101024431 | 3300010304 | Grasslands Soil | RLQDSRQTELQILTDTGIRNLVASLGIRLIDYGFVVQEA* |
| Ga0134065_100285223 | 3300010326 | Grasslands Soil | GYADAVLQKSPTRLQNSRQTELKILTDTGIRNLVASLGIRLIDYGFVSQEA* |
| Ga0126370_107407641 | 3300010358 | Tropical Forest Soil | RQKELEILTDTRIRNLVASRGIRLIDYGLVTQEA* |
| Ga0126370_111763641 | 3300010358 | Tropical Forest Soil | RTATRLQASRQKELEILTSPRIRNLVASQGIRLIDYGYITQEA* |
| Ga0126376_102135781 | 3300010359 | Tropical Forest Soil | ESREQEIRILTDTGIRNVVASEGIRLIDYGFVAEAA* |
| Ga0126372_105049151 | 3300010360 | Tropical Forest Soil | LQGSREEEVRILTDTGIRNVVASEGIRLIDYGFVAEAA* |
| Ga0126381_1035333822 | 3300010376 | Tropical Forest Soil | LKESREQELGILTDPAIRKLVATNGIRLINYAFLAQAV* |
| Ga0150983_140619343 | 3300011120 | Forest Soil | YVDKELGESATRLQASRQREVEILTDTGIRNLVASQGIRLIDYGLVASEA* |
| Ga0137392_111390921 | 3300011269 | Vadose Zone Soil | ATRLQDSRQAELEILTDTGVRNLVASQGIRLIDYGFVTQEA* |
| Ga0137391_112016262 | 3300011270 | Vadose Zone Soil | TRLQDSRQAELEILTDTGVRNLVASQGIRLIDYGFVTQEA* |
| Ga0137393_107509561 | 3300011271 | Vadose Zone Soil | TATRLQDSRQAELEILTDTGVRNLVASQGIRLIDYGFVTQEA* |
| Ga0137363_115423881 | 3300012202 | Vadose Zone Soil | QDSRQAELEILTDTGVRNLVASQGIRLIDYGFVTQEA* |
| Ga0137399_101265013 | 3300012203 | Vadose Zone Soil | REKEVEILTDTEIRNLVASQGIRLIDYGFVGSAV* |
| Ga0137362_100367621 | 3300012205 | Vadose Zone Soil | RQTELEILTDTSVRKIVATRGIRLINYGFLAQAV* |
| Ga0137362_108026782 | 3300012205 | Vadose Zone Soil | RLQGSREKEVQILTDTEIRNLVASQGIRLIDYGFVTSAV* |
| Ga0137362_114537902 | 3300012205 | Vadose Zone Soil | RLQDSRQTELQILTDTGIRNLVASQGIRLIDYAFLASTV* |
| Ga0137378_103781393 | 3300012210 | Vadose Zone Soil | RQTELQILTDTGIRNLVASLGIRLIDYGFVTQEA* |
| Ga0137378_104533801 | 3300012210 | Vadose Zone Soil | RKTPTRLQDSRQTELRILTDTAIRNLVASLGIRLIDYGFVAQEA* |
| Ga0137397_111950321 | 3300012685 | Vadose Zone Soil | DAALRKTATRLQDSRQKELEILTDTGIRNLVASQGIRLIDYGFVTQEA* |
| Ga0137394_112391391 | 3300012922 | Vadose Zone Soil | TRLQDSRQEELGILTDTGIRNLVASQGIRLIDYGFVTQEA* |
| Ga0137413_113459601 | 3300012924 | Vadose Zone Soil | PGYMDEELEKSATRLQDSRPAEVEILTHAEVRNLVASQGIRLIDYAFLAQKA* |
| Ga0137413_116873952 | 3300012924 | Vadose Zone Soil | AALQKTPTRLQDSRQTELRILTDTGIRNLVASMGIRLIDYGFVAQEA* |
| Ga0164303_110861901 | 3300012957 | Soil | QNSATRLQASRQTELEILTDVEIRNLVASQGIRLIDYGFVASEI* |
| Ga0134087_101561612 | 3300012977 | Grasslands Soil | RQKELDIFTDTRIRNLVASQGIRLIDYAYVTQEA* |
| Ga0164305_108934501 | 3300012989 | Soil | QGSRQTELLILTDVEIRNLVASQGIRLIDYGFVASEI* |
| Ga0137414_10045751 | 3300015051 | Vadose Zone Soil | HGCLQESREKEVEILTDTTIRNLVASQGIRLIDYAFLASTV* |
| Ga0134072_104081722 | 3300015357 | Grasslands Soil | YADAALEKTRTRLQDSRQTELQILTDTGIRNLVASLGIRLIDYGFVTQEA* |
| Ga0134112_100909952 | 3300017656 | Grasslands Soil | LQKSATRLQHSRQTELQILTDTGIRNLVASLGIRLIDYGFVSQEA |
| Ga0187802_101996351 | 3300017822 | Freshwater Sediment | TATRLQDSREAELQILTDTRIRNLVASQGIRLIDYGFVAQEA |
| Ga0187847_107179142 | 3300017948 | Peatland | DDLRKSETRLQESRRAEVEILTDKGIRNLVAEQGIRLIDYAFVAQEA |
| Ga0187817_107593772 | 3300017955 | Freshwater Sediment | TRLQDSREAELQILTDTRIRNLVASQGIRLIDYGFVSQEA |
| Ga0187766_101284333 | 3300018058 | Tropical Peatland | GKTATRLKESRQTELEILTDTHIRKLVASRGIRLIDYGFVTQEA |
| Ga0193755_10227943 | 3300020004 | Soil | DSRQKELEILMDMGVRNLVASQGIRLIDYGFVTQEA |
| Ga0179590_10089724 | 3300020140 | Vadose Zone Soil | QESREKEVEILTDTKIRNLVASQGIRLIDYGFVGSAV |
| Ga0179592_103927941 | 3300020199 | Vadose Zone Soil | ALRKTATRLQESREKEVEILTDTKIRNLVASQGIRLIDYGFVGSAV |
| Ga0179592_104310891 | 3300020199 | Vadose Zone Soil | SATRLRESRQEEVRILTDTRIRNVVASEGIRLIDYSFVAEAA |
| Ga0179592_104876032 | 3300020199 | Vadose Zone Soil | PGYADAALQKTPTRLQDSRQTELRILTDTGIRNLVASLGIRLIDYGFVAQEA |
| Ga0210407_101768521 | 3300020579 | Soil | LRKSATRLQHSRQTELEILTDTGIRNLVASQGIRLIDYAFVTQEA |
| Ga0210403_102405963 | 3300020580 | Soil | ALQKTPTRLQNSRQTELQILTDTGIRNLVASLGIRLIDYGFVAQEA |
| Ga0210403_103442692 | 3300020580 | Soil | TATRLQDSRQTELAILTNMEIRNLVASQGIRLIDYGFVTQEA |
| Ga0210403_105709391 | 3300020580 | Soil | QKTPTRLQDSRETELRILTDTGIRNLVASLGIRLIDYGFVTQEA |
| Ga0210403_108784092 | 3300020580 | Soil | QDSRQTELQILTDPGIRNLVASLGIRLIDYGFVAQEV |
| Ga0210403_113876532 | 3300020580 | Soil | RLQASRQTEMEILTNTGLRNLVAQQGIRLINYMQVAEQA |
| Ga0210399_102270891 | 3300020581 | Soil | ALQKTSTRLQRSRETELQILTDTGIRNLVASLGIRLIDYGFVAQEA |
| Ga0210399_111478482 | 3300020581 | Soil | VDKELGESATRLQASRQGEVEILTDTEIRNLVALQGIRLIDYGLVASEA |
| Ga0210395_102214423 | 3300020582 | Soil | DDALQKSPTRLQESRATELAILTDPDVRNLVASQGIRLIDYSLASSQI |
| Ga0210395_107226331 | 3300020582 | Soil | QASRQAELEILTNTQIRNLVASQGIRLVDYGFAAQEA |
| Ga0210401_103990972 | 3300020583 | Soil | VDAELANSATRLQASRQAEVEILTDAGIRNLVASQGIRLIDYGFVAQEA |
| Ga0210401_105003822 | 3300020583 | Soil | QRSRETELQILTDTGIRNLVASLGIRLIDYGFVAQEA |
| Ga0210401_108383021 | 3300020583 | Soil | PTRLQHSRQTELEILTDTEIRNLVASQGIRLIDYGFATQEA |
| Ga0179596_103696341 | 3300021086 | Vadose Zone Soil | RKTATRLQESREKEVEILTDTTIRNLVASQGIRLIDYAFLASTV |
| Ga0210404_103298432 | 3300021088 | Soil | QKTATRLQDSRQTELEILTDTEIRNLVASQGIRLIDYGFVAQEA |
| Ga0210406_102030643 | 3300021168 | Soil | ATRLQASRQTELTILTDTQVRNLVASQGIRLIDYGFVAQEA |
| Ga0210406_106878211 | 3300021168 | Soil | KSATRLQASRQAEVEILTDTEIRNLVASQGIRLVDYGFAAQEA |
| Ga0210406_109440952 | 3300021168 | Soil | RKTSTRLQGSRQKEVEILTDQEIRNLVASQGIRLIDYAFLASTV |
| Ga0210400_105060131 | 3300021170 | Soil | VHPGYVDERLRNSATRLRESREAEVRILTDKGIRNVVASEGIRLIDYSFVAEAA |
| Ga0210400_112647291 | 3300021170 | Soil | RKTATRLQASRQKEVEILTDTEVRNLVASQGIRLIDYGFVSSAV |
| Ga0210405_111768552 | 3300021171 | Soil | AALQKTATRLQDSRQTELEILTDTEIRNLVASQGIRLIDYGFVAQEA |
| Ga0210393_108852722 | 3300021401 | Soil | GYADDALRKTATRLQASRQKEVEILTDTEIRNLVASQGIRLIDYAFLASTV |
| Ga0210389_114188842 | 3300021404 | Soil | GYADEALRKTATRLQGSREKEVEILTDTEIRNLVASQGIRLIDYGFVGSAV |
| Ga0210394_115525652 | 3300021420 | Soil | SAARLQASRQAELEILTNTQIRNLVASQGIRLVDYGFAAQEA |
| Ga0210384_100532355 | 3300021432 | Soil | GSRQTELEILTDTSVRKIVAMRGIRLINYGFLAQAA |
| Ga0210384_103320881 | 3300021432 | Soil | HELQKTATRLQASRQMEVEILTDAGIRNLVASQGIRLIDYGFVASEA |
| Ga0187846_100542461 | 3300021476 | Biofilm | KSATRLQASRQKELEILTDTSIRNLVASQGIRLIDYGFVTQEA |
| Ga0210402_105344302 | 3300021478 | Soil | RLQNSRQTELQILTDTGIRNLVASLGIRLIDYGFVAQEA |
| Ga0210402_108540051 | 3300021478 | Soil | YADAALQQTATRLQNSRQTELEILTDTGVRNLVASQGIRLIDYGFVTQEA |
| Ga0210402_113054591 | 3300021478 | Soil | EALRKTATRLQESREKELEILTDTDVRNLVASQGIRLIDYSFVGSAA |
| Ga0210402_115534271 | 3300021478 | Soil | DSELEKSATRLQDSRRLEVEILTDTGIRNLVASLGIRLIDYAFVAQEA |
| Ga0210410_116191771 | 3300021479 | Soil | SDLEKSPTRLQDSRRIELEILTDTAIRNLVASQGIRLIDYAFLAQEA |
| Ga0242648_10021644 | 3300022506 | Soil | QGSRQTELEILTDTSVRKIVATRGIRLINYAFLAQAA |
| Ga0242655_100719632 | 3300022532 | Soil | ASRQAEVEILTDMGIRNLVASQGIRLIDYGFVAQEA |
| Ga0242662_100403341 | 3300022533 | Soil | RLQGSRQAELEILTDTSVRKIVATRGIRLINYGFLAQAA |
| Ga0242673_10532222 | 3300022716 | Soil | AKSGTRLQGSRQAEVDILTNAERRNLVASQGIRLIDYGFAAQEA |
| Ga0242661_11451921 | 3300022717 | Soil | KTNTRLQGSRQTELEILTDTSVRKIVATRGIRLINYGFLAQAA |
| Ga0242654_103902611 | 3300022726 | Soil | ATRLQESREKELEILTDTDVRNLVASQGIRLIDYSFVGSAA |
| Ga0247690_10078552 | 3300024287 | Soil | TRLQASRQKEVEILTDTEIRNLVASQGIRLIDYAFVAQEA |
| Ga0137417_12251001 | 3300024330 | Vadose Zone Soil | RCGAPEIAHADAALQKSPTRLQDSRQTELQILTDTGIRNLVASLGIRLIDYGFVAQEV |
| Ga0207685_102202192 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | DEALRRTATRLQASREIEVQIFTDTEIRNLVASQGIRLIDYESVGSAV |
| Ga0207671_101434971 | 3300025914 | Corn Rhizosphere | DEALQKSATRLQESRATELAILTDPDVRNLVASQGIRLIDYSLSQI |
| Ga0209863_101533581 | 3300026281 | Prmafrost Soil | CHPGFMDAELEKSATRLQDSRALEVDILTNPEVRNLVASQGIRLIDYALVAQKA |
| Ga0209688_10124603 | 3300026305 | Soil | TLQKSPTRLQNSRQTELKILTGTGIRNLVASLGIRLIDYGFVAQEA |
| Ga0209155_10810871 | 3300026316 | Soil | LQHSRQTELQILTDTGIRNLVASLGIRLIDYGFVSQEA |
| Ga0209471_11520331 | 3300026318 | Soil | SDAALEKTRTRLQDSRQTELQILTDTGIRNLVASLGIRLIDYGFVAQEA |
| Ga0209377_11298041 | 3300026334 | Soil | RLQNSRQTELKILTDTGIRNLIASLGIRLIDYGFVSQEA |
| Ga0209377_12547912 | 3300026334 | Soil | DLQKSPTRLQASRQTELQILTDTRIRNLVASLGIRLIDYGCVSQEA |
| Ga0209159_11253341 | 3300026343 | Soil | EALEKTATRLQASRQKELEILTDTGIRNLVASQGIRLIDYGFLTRDA |
| Ga0257163_10471702 | 3300026359 | Soil | QDSRQTELQILTDTGIRNLVASMGIRLIDYGLIAEEA |
| Ga0257177_10863232 | 3300026480 | Soil | ALQKTSTRLQDSRQTELQILTDTGIRNLVASLGIRLIDYGFVTQEA |
| Ga0257172_10440352 | 3300026482 | Soil | QKTPTRLQDSRQTELRILTDTGIRNLVASMGIRLIDYSFVAEEA |
| Ga0257157_10256492 | 3300026496 | Soil | QKTPTRLQDSRQTELQILTDTGIRNLVASLGIRLIDYGFVAQEA |
| Ga0257158_10919751 | 3300026515 | Soil | QDSRELEVQILTSPDIRNLVASQGIRLIDYAFVAGKA |
| Ga0209805_10250245 | 3300026542 | Soil | ALQQSPTRLQASRQEELEILTDTRVRNLVASQGIRLIDYGYVTQ |
| Ga0209648_104614902 | 3300026551 | Grasslands Soil | QNSRQTELQILTDTGIRNLVASLGIRLIDYGFVAQEA |
| Ga0208095_10141041 | 3300027104 | Forest Soil | RKSATRLQHSRQTELEILTDTGIRNLVASQGIRLIDYAFVTQEA |
| Ga0208603_10356482 | 3300027109 | Forest Soil | RKSATRLQDSRQTELEILTDTSIRNLVASQGIRLIDYAFVTQEA |
| Ga0208603_10544491 | 3300027109 | Forest Soil | LAKSATRLQASRQAEVEILTNTQIRNLVASQGIRLVDYGFAAQEA |
| Ga0207948_10460751 | 3300027174 | Forest Soil | RKSATRLQDSRQTELEILTDTSVRNLVASQGIRLIDYAFVTQEA |
| Ga0209734_10367521 | 3300027535 | Forest Soil | NTRLQGSRQTELEILTDTSVRKIVATRGIRLINYTFLAQAA |
| Ga0209219_11754611 | 3300027565 | Forest Soil | HPGDVDAELAKSATRLQASRQTEVEILTDTGIRNLVASQGIRLIDYGFAAQEA |
| Ga0209528_11223191 | 3300027610 | Forest Soil | KALQNTATRLQASRQKELEILTDAGIRNLVASQGIRLIDYGCVASET |
| Ga0209422_10094004 | 3300027629 | Forest Soil | KTKTRLQGSRQTELEILTDTSVRKIVATRGIRLINYGFLAQAA |
| Ga0209422_10274491 | 3300027629 | Forest Soil | DKELEESATRLQDSRELEVEILTSTDIRNLVASQGIRLIDYSFVAEKA |
| Ga0209217_10295393 | 3300027651 | Forest Soil | TPTRLQDSRQTELQILTDTGIRNLVASLGIRLIDYEFVAQEA |
| Ga0209588_11755372 | 3300027671 | Vadose Zone Soil | GTRQKEVEILTDTEIRNLVASQGIRLIDYAFLASTV |
| Ga0209073_102383831 | 3300027765 | Agricultural Soil | TRLQASRQKELEILTDTRVRNLVASQGIRLIDYGFVTQEA |
| Ga0209180_104786011 | 3300027846 | Vadose Zone Soil | ALRKTPTRLQDSRQTELQILTDTGIRNLVASLGIRLIDYGFVSQEA |
| Ga0209166_100252941 | 3300027857 | Surface Soil | LQASRQKEVELLTDTGIRNLVASQGIRLIDYAFVAQEA |
| Ga0209701_104992951 | 3300027862 | Vadose Zone Soil | PTRLQDSRQTELQILTDTGIRNLVASLGIRLIDYGFVAQEV |
| Ga0209169_105717662 | 3300027879 | Soil | LRQTRTRLQGSRQTELEILTDTAVRKIVATRGIRLINYAFLAQAA |
| Ga0209488_107063971 | 3300027903 | Vadose Zone Soil | DEALRKTPTRLQGSRQNELEILTDTEIRNLVASQGIRLIDYAFLASMV |
| Ga0209488_111295182 | 3300027903 | Vadose Zone Soil | LQDSRQSELQILTDTGIRNLVASLGIRLIDYGFVAQEV |
| Ga0209583_102847972 | 3300027910 | Watersheds | DDALRKTATRLQASRQKEVEILTDKEIRNLVASQGIRLIDYAFLASTV |
| Ga0209583_107374391 | 3300027910 | Watersheds | PGYADAELEKSATRLQYSRQTELEILTDKGIRKLVASQGIRLIDYGLVASEA |
| Ga0247685_10053413 | 3300028065 | Soil | VDDELRTTRTRLQGSRQTELEILTDTSVRKIVAMRGIRLINYGFLAQAA |
| Ga0265338_104858982 | 3300028800 | Rhizosphere | KSATRLQASRQSELEILTDTCIRNLVASQGIRLIDYGFAAQEA |
| Ga0308309_113085251 | 3300028906 | Soil | VDDALQKSPTRLQESRATELAILTDPDVRNLVASQGIRLIDYGMTSSQI |
| Ga0308309_115111102 | 3300028906 | Soil | PTRLQESRATELAILTDPDVRNLVASQGIRLIDYSLASSQI |
| Ga0308309_116779611 | 3300028906 | Soil | DDDLAKSATRLQASRQTELAILTDTQVRNLVASQGIRLIDYGFVAQEA |
| Ga0222749_103415161 | 3300029636 | Soil | ELQKTATRLQASRQMELEILTDAGIRNLVASQGIRLIDYGFVASEA |
| Ga0302306_101221363 | 3300030043 | Palsa | PGYVDADLRKSGTRLQDSRRLEVEILTDKGIRNLVAERGIRLIDYAFVAQEA |
| Ga0302306_103910592 | 3300030043 | Palsa | SRQMELEILTNVDIRKLVASESIRLIDYGSVANAA |
| Ga0311356_109537581 | 3300030617 | Palsa | GYVDHDLRTTATRLQSSRLMELEILTNVDIRKLVASESIRLIDYGSVANAA |
| Ga0307477_100139751 | 3300031753 | Hardwood Forest Soil | ADEALRKTATRLQGSRQKEVEILTDTEIRNLVASQGIRLIDYAFLASTV |
| Ga0307475_111492521 | 3300031754 | Hardwood Forest Soil | LRKTATRLQDSRQTELEILTDTGVRNLVASQGIRLIDYAFVTQEA |
| Ga0307475_112401871 | 3300031754 | Hardwood Forest Soil | QKSPTRLQDSRQTELQILTDTGIRNLVASLGIRLIDYGFVAQEV |
| Ga0307479_118092062 | 3300031962 | Hardwood Forest Soil | RLQGSRQKEVEILTDTEIRNLVASQGIRLIDYAFLASTV |
| Ga0307471_1040777611 | 3300032180 | Hardwood Forest Soil | LQASRQTELEILTDTNIRNLVASQGIRLIDYGFVTQEA |
| Ga0335079_1000372019 | 3300032783 | Soil | EKSPTRLKGSRQTEVAILTDMHIRNLVASQGIRLIDYAFVAQEA |
| Ga0335079_108182191 | 3300032783 | Soil | VDEALRKTATRLQQSRQTELEILTDTQIRKLVASQGIRLIDYEFVTQEA |
| ⦗Top⦘ |