


| Basic Information | |
|---|---|
| Family ID | F040633 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSPSGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKP |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 160 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 35.85 % |
| % of genes near scaffold ends (potentially truncated) | 84.47 % |
| % of genes from short scaffolds (< 2000 bps) | 80.12 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.335 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment (22.981 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.267 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (36.025 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.86% β-sheet: 0.00% Coil/Unstructured: 67.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 160 Family Scaffolds |
|---|---|---|
| PF08238 | Sel1 | 2.50 |
| PF08388 | GIIM | 2.50 |
| PF02371 | Transposase_20 | 1.88 |
| PF01638 | HxlR | 1.25 |
| PF01551 | Peptidase_M23 | 1.25 |
| PF07589 | PEP-CTERM | 1.25 |
| PF13683 | rve_3 | 1.25 |
| PF02518 | HATPase_c | 1.25 |
| PF00753 | Lactamase_B | 1.25 |
| PF00561 | Abhydrolase_1 | 1.25 |
| PF03401 | TctC | 0.62 |
| PF12228 | DUF3604 | 0.62 |
| PF13561 | adh_short_C2 | 0.62 |
| PF04392 | ABC_sub_bind | 0.62 |
| PF07635 | PSCyt1 | 0.62 |
| PF13637 | Ank_4 | 0.62 |
| PF00583 | Acetyltransf_1 | 0.62 |
| PF00078 | RVT_1 | 0.62 |
| PF15916 | DUF4743 | 0.62 |
| PF00114 | Pilin | 0.62 |
| PF13278 | Obsolete Pfam Family | 0.62 |
| PF00353 | HemolysinCabind | 0.62 |
| PF00400 | WD40 | 0.62 |
| PF06742 | DUF1214 | 0.62 |
| PF07228 | SpoIIE | 0.62 |
| PF02775 | TPP_enzyme_C | 0.62 |
| PF13602 | ADH_zinc_N_2 | 0.62 |
| PF16576 | HlyD_D23 | 0.62 |
| PF00027 | cNMP_binding | 0.62 |
| PF03729 | DUF308 | 0.62 |
| PF11042 | DUF2750 | 0.62 |
| PF01361 | Tautomerase | 0.62 |
| PF00211 | Guanylate_cyc | 0.62 |
| PF12146 | Hydrolase_4 | 0.62 |
| PF13581 | HATPase_c_2 | 0.62 |
| PF07929 | PRiA4_ORF3 | 0.62 |
| PF02798 | GST_N | 0.62 |
| PF07969 | Amidohydro_3 | 0.62 |
| PF10881 | DUF2726 | 0.62 |
| PF13460 | NAD_binding_10 | 0.62 |
| PF05990 | DUF900 | 0.62 |
| PF13673 | Acetyltransf_10 | 0.62 |
| PF13633 | Obsolete Pfam Family | 0.62 |
| PF09720 | Unstab_antitox | 0.62 |
| PF13751 | DDE_Tnp_1_6 | 0.62 |
| PF00210 | Ferritin | 0.62 |
| PF07479 | NAD_Gly3P_dh_C | 0.62 |
| PF01610 | DDE_Tnp_ISL3 | 0.62 |
| PF00999 | Na_H_Exchanger | 0.62 |
| PF05036 | SPOR | 0.62 |
| PF03923 | Lipoprotein_16 | 0.62 |
| PF13417 | GST_N_3 | 0.62 |
| PF13487 | HD_5 | 0.62 |
| PF12697 | Abhydrolase_6 | 0.62 |
| PF14213 | DUF4325 | 0.62 |
| PF08501 | Shikimate_dh_N | 0.62 |
| PF13544 | Obsolete Pfam Family | 0.62 |
| PF07593 | UnbV_ASPIC | 0.62 |
| PF00884 | Sulfatase | 0.62 |
| PF08530 | PepX_C | 0.62 |
| PF14236 | DUF4338 | 0.62 |
| PF08447 | PAS_3 | 0.62 |
| PF00657 | Lipase_GDSL | 0.62 |
| PF01527 | HTH_Tnp_1 | 0.62 |
| PF00950 | ABC-3 | 0.62 |
| PF13817 | DDE_Tnp_IS66_C | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 160 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.88 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.25 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.62 |
| COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 0.62 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.62 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.62 |
| COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 0.62 |
| COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.62 |
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.62 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.62 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.62 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.62 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.62 |
| COG3056 | Uncharacterized lipoprotein YajG | Function unknown [S] | 0.62 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.62 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.62 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.62 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
| COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 0.62 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.62 |
| COG4782 | Esterase/lipase superfamily enzyme | General function prediction only [R] | 0.62 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.62 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.96 % |
| Unclassified | root | N/A | 13.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000124|BS_KBA_SWE12_21mDRAFT_c10106113 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1064223 | Not Available | 719 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1074201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300001685|JGI24024J18818_10018270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2824 | Open in IMG/M |
| 3300001685|JGI24024J18818_10062076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1325 | Open in IMG/M |
| 3300001685|JGI24024J18818_10090496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1007 | Open in IMG/M |
| 3300004148|Ga0055521_10115405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 682 | Open in IMG/M |
| 3300005588|Ga0070728_10266314 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300005588|Ga0070728_10363290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
| 3300005589|Ga0070729_10768560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 514 | Open in IMG/M |
| 3300005590|Ga0070727_10318542 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300005590|Ga0070727_10339719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 836 | Open in IMG/M |
| 3300005590|Ga0070727_10357549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
| 3300005600|Ga0070726_10022536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3841 | Open in IMG/M |
| 3300005600|Ga0070726_10477960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
| 3300005601|Ga0070722_10157611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 913 | Open in IMG/M |
| 3300005601|Ga0070722_10193237 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300005601|Ga0070722_10262287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300005601|Ga0070722_10333388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 655 | Open in IMG/M |
| 3300005612|Ga0070723_10231535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 852 | Open in IMG/M |
| 3300005612|Ga0070723_10231535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 852 | Open in IMG/M |
| 3300005764|Ga0066903_102442634 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300005920|Ga0070725_10277807 | Not Available | 734 | Open in IMG/M |
| 3300006467|Ga0099972_10028898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1485 | Open in IMG/M |
| 3300006467|Ga0099972_12777179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1084 | Open in IMG/M |
| 3300006467|Ga0099972_13109680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1932 | Open in IMG/M |
| 3300006467|Ga0099972_13226553 | Not Available | 856 | Open in IMG/M |
| 3300009083|Ga0105047_10593893 | Not Available | 1009 | Open in IMG/M |
| 3300009139|Ga0114949_10877899 | Not Available | 716 | Open in IMG/M |
| 3300009505|Ga0115564_10545582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 553 | Open in IMG/M |
| 3300009513|Ga0129285_10244092 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
| 3300009700|Ga0116217_10582650 | Not Available | 698 | Open in IMG/M |
| 3300009702|Ga0114931_10189806 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300009702|Ga0114931_10353940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 999 | Open in IMG/M |
| 3300010392|Ga0118731_100914873 | Not Available | 815 | Open in IMG/M |
| 3300010392|Ga0118731_102571012 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1159 | Open in IMG/M |
| 3300010392|Ga0118731_103876661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 581 | Open in IMG/M |
| 3300010392|Ga0118731_104916549 | Not Available | 940 | Open in IMG/M |
| 3300010392|Ga0118731_105508404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 807 | Open in IMG/M |
| 3300010392|Ga0118731_107091918 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300010392|Ga0118731_107573796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1360 | Open in IMG/M |
| 3300010392|Ga0118731_110602811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2712 | Open in IMG/M |
| 3300010392|Ga0118731_110742235 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300010392|Ga0118731_112144707 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300010392|Ga0118731_112352391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1454 | Open in IMG/M |
| 3300010392|Ga0118731_113571932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4401 | Open in IMG/M |
| 3300010392|Ga0118731_114652911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1474 | Open in IMG/M |
| 3300010392|Ga0118731_114721149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 895 | Open in IMG/M |
| 3300010430|Ga0118733_100047268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9092 | Open in IMG/M |
| 3300010430|Ga0118733_100901132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1765 | Open in IMG/M |
| 3300010430|Ga0118733_101455673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1366 | Open in IMG/M |
| 3300010430|Ga0118733_101684427 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300010430|Ga0118733_102364784 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300010430|Ga0118733_102498947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1022 | Open in IMG/M |
| 3300010430|Ga0118733_102548924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1011 | Open in IMG/M |
| 3300010430|Ga0118733_102844830 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300010430|Ga0118733_103434258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 860 | Open in IMG/M |
| 3300010430|Ga0118733_103514172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 850 | Open in IMG/M |
| 3300010430|Ga0118733_103852238 | Not Available | 808 | Open in IMG/M |
| 3300010430|Ga0118733_104219219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 769 | Open in IMG/M |
| 3300010430|Ga0118733_104412023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 751 | Open in IMG/M |
| 3300010430|Ga0118733_105970056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 638 | Open in IMG/M |
| 3300010430|Ga0118733_107192894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300010430|Ga0118733_107488837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 566 | Open in IMG/M |
| 3300010430|Ga0118733_108806112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 520 | Open in IMG/M |
| 3300010968|Ga0139250_1000337 | All Organisms → cellular organisms → Bacteria | 2150 | Open in IMG/M |
| 3300010969|Ga0139246_1068927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium fuliginis | 930 | Open in IMG/M |
| 3300011078|Ga0138565_1133477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 507 | Open in IMG/M |
| 3300014159|Ga0181530_10092374 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1829 | Open in IMG/M |
| 3300015371|Ga0132258_10969133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 2149 | Open in IMG/M |
| 3300016294|Ga0182041_11526302 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300016357|Ga0182032_11151884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium fuliginis | 666 | Open in IMG/M |
| 3300016371|Ga0182034_10950355 | Not Available | 741 | Open in IMG/M |
| 3300016387|Ga0182040_11733241 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300016422|Ga0182039_10218142 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300017961|Ga0187778_10783216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300017965|Ga0190266_10919472 | Not Available | 576 | Open in IMG/M |
| 3300019720|Ga0193991_1011812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium fuliginis | 909 | Open in IMG/M |
| 3300019737|Ga0193973_1014417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium fuliginis | 845 | Open in IMG/M |
| 3300019737|Ga0193973_1042376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 596 | Open in IMG/M |
| 3300019743|Ga0193992_1051949 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300019745|Ga0194002_1046949 | Not Available | 668 | Open in IMG/M |
| 3300020199|Ga0179592_10526816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium fuliginis | 504 | Open in IMG/M |
| 3300021432|Ga0210384_11092810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium fuliginis | 701 | Open in IMG/M |
| 3300021465|Ga0193947_1002139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3231 | Open in IMG/M |
| 3300022218|Ga0224502_10160851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512 | 861 | Open in IMG/M |
| 3300022220|Ga0224513_10194216 | Not Available | 795 | Open in IMG/M |
| (restricted) 3300022913|Ga0233404_10058261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 891 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10038883 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1719 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10189841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 839 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10279831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 695 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10025788 | Not Available | 2117 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10145549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 970 | Open in IMG/M |
| 3300025564|Ga0210084_1048886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 816 | Open in IMG/M |
| 3300025599|Ga0210074_1026312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1688 | Open in IMG/M |
| 3300025599|Ga0210074_1038339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1349 | Open in IMG/M |
| 3300025823|Ga0210123_1125692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 768 | Open in IMG/M |
| 3300025883|Ga0209456_10247240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 749 | Open in IMG/M |
| 3300025895|Ga0209567_10000500 | All Organisms → cellular organisms → Bacteria | 21392 | Open in IMG/M |
| 3300026831|Ga0207738_113875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512 | 753 | Open in IMG/M |
| 3300027612|Ga0209037_1014840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1976 | Open in IMG/M |
| 3300027674|Ga0209118_1107506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 785 | Open in IMG/M |
| 3300027758|Ga0209379_10148669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 824 | Open in IMG/M |
| 3300027820|Ga0209578_10264953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 805 | Open in IMG/M |
| 3300027828|Ga0209692_10299756 | Not Available | 709 | Open in IMG/M |
| (restricted) 3300027837|Ga0255041_10341902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 545 | Open in IMG/M |
| 3300027858|Ga0209013_10083909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2129 | Open in IMG/M |
| 3300027858|Ga0209013_10112317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1764 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10408861 | Not Available | 731 | Open in IMG/M |
| 3300027967|Ga0209272_10102679 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10166505 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300028047|Ga0209526_10311668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4 | 1063 | Open in IMG/M |
| 3300028598|Ga0265306_10112662 | Not Available | 1408 | Open in IMG/M |
| 3300028599|Ga0265309_10047946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2370 | Open in IMG/M |
| 3300028599|Ga0265309_11205672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300028600|Ga0265303_10018974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4584 | Open in IMG/M |
| 3300028600|Ga0265303_10163189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1685 | Open in IMG/M |
| 3300031234|Ga0302325_10758482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1381 | Open in IMG/M |
| 3300031543|Ga0318516_10299816 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300031910|Ga0306923_12095825 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300031945|Ga0310913_10295133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1143 | Open in IMG/M |
| 3300032136|Ga0316201_11388534 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → unclassified Halobacteria → Halobacteria archaeon | 583 | Open in IMG/M |
| 3300032160|Ga0311301_10558225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum | 1670 | Open in IMG/M |
| 3300032231|Ga0316187_10021635 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5320 | Open in IMG/M |
| 3300032231|Ga0316187_10149897 | Not Available | 1816 | Open in IMG/M |
| 3300032231|Ga0316187_10219152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1466 | Open in IMG/M |
| 3300032231|Ga0316187_10290268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1248 | Open in IMG/M |
| 3300032231|Ga0316187_10910581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 646 | Open in IMG/M |
| 3300032251|Ga0316198_10006518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7231 | Open in IMG/M |
| 3300032251|Ga0316198_10024537 | All Organisms → cellular organisms → Bacteria | 3703 | Open in IMG/M |
| 3300032251|Ga0316198_10055391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2388 | Open in IMG/M |
| 3300032252|Ga0316196_10014724 | All Organisms → cellular organisms → Bacteria | 3641 | Open in IMG/M |
| 3300032257|Ga0316205_10042321 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2268 | Open in IMG/M |
| 3300032258|Ga0316191_10033967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3824 | Open in IMG/M |
| 3300032258|Ga0316191_11409084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 503 | Open in IMG/M |
| 3300032259|Ga0316190_10009589 | All Organisms → cellular organisms → Bacteria | 6999 | Open in IMG/M |
| 3300032259|Ga0316190_10118426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1852 | Open in IMG/M |
| 3300032259|Ga0316190_10225199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1296 | Open in IMG/M |
| 3300032259|Ga0316190_10519069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 801 | Open in IMG/M |
| 3300032260|Ga0316192_10008356 | All Organisms → cellular organisms → Bacteria | 7435 | Open in IMG/M |
| 3300032260|Ga0316192_10050427 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2935 | Open in IMG/M |
| 3300032260|Ga0316192_10055787 | All Organisms → cellular organisms → Bacteria | 2783 | Open in IMG/M |
| 3300032260|Ga0316192_10218659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1321 | Open in IMG/M |
| 3300032260|Ga0316192_10980540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rubrimonas → Rubrimonas cliftonensis | 565 | Open in IMG/M |
| 3300032261|Ga0306920_100342623 | All Organisms → cellular organisms → Bacteria | 2224 | Open in IMG/M |
| 3300032262|Ga0316194_10274871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1071 | Open in IMG/M |
| 3300032262|Ga0316194_10460968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methyloglobulus → unclassified Methyloglobulus → Methyloglobulus sp. | 802 | Open in IMG/M |
| 3300032263|Ga0316195_10396257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 731 | Open in IMG/M |
| 3300032272|Ga0316189_10052527 | All Organisms → cellular organisms → Bacteria | 3474 | Open in IMG/M |
| 3300032273|Ga0316197_10067777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2277 | Open in IMG/M |
| 3300032276|Ga0316188_10282639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 852 | Open in IMG/M |
| 3300033233|Ga0334722_10142973 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300033291|Ga0307417_10347530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYPR2.512 | 558 | Open in IMG/M |
| 3300033429|Ga0316193_10021750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4951 | Open in IMG/M |
| 3300033429|Ga0316193_10044319 | All Organisms → cellular organisms → Bacteria | 3457 | Open in IMG/M |
| 3300033429|Ga0316193_10090561 | All Organisms → cellular organisms → Bacteria | 2389 | Open in IMG/M |
| 3300033429|Ga0316193_10405460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1084 | Open in IMG/M |
| 3300033429|Ga0316193_10431425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1048 | Open in IMG/M |
| 3300033429|Ga0316193_10543135 | Not Available | 926 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 22.98% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 11.80% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 11.80% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 8.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.35% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 3.73% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.73% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.11% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 3.11% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 3.11% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.86% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.86% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine | 1.24% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.24% |
| Hydrothermal Chimney Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Chimney Microbial Mat | 1.24% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.24% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.24% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.62% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.62% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.62% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.62% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.62% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.62% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.62% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.62% |
| Beach Aquifer Porewater | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.62% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000124 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21m | Environmental | Open in IMG/M |
| 3300000242 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m | Environmental | Open in IMG/M |
| 3300001685 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 | Environmental | Open in IMG/M |
| 3300004148 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300009083 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009139 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N074 metaG | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009513 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - F-1Y | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009702 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV14_V59a metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010968 | Microbial communities from the middle layer of the microbial mat covering an inactive hydrothermal chimney from the Kolumbo submarine volcano, Santorini, Greece - V16_c.mid | Environmental | Open in IMG/M |
| 3300010969 | Microbial communities from the outside layer of the microbial mat covering an inactive hydrothermal chimney from the Kolumbo submarine volcano, Santorini, Greece - V16_c.out | Environmental | Open in IMG/M |
| 3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300019720 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_2-3_MG | Environmental | Open in IMG/M |
| 3300019737 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_9-10_MG | Environmental | Open in IMG/M |
| 3300019743 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_3-4_MG | Environmental | Open in IMG/M |
| 3300019745 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_8-9_MG | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021465 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_0-1_MG | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022913 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300025564 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025599 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025823 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025883 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300025895 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300026831 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 9 (SPAdes) | Environmental | Open in IMG/M |
| 3300027612 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027837 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3 | Environmental | Open in IMG/M |
| 3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300027967 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300032252 | Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm | Environmental | Open in IMG/M |
| 3300032257 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrite | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
| 3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
| 3300032263 | Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1 | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300032273 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A oxic | Environmental | Open in IMG/M |
| 3300032276 | Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033291 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-10 | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BS_KBA_SWE12_21mDRAFT_101061131 | 3300000124 | Marine | LGVRRAKAAFSSGCESHPVMLLQPEAIGAVMEVTKWLKPLM* |
| TDF_OR_ARG05_123mDRAFT_10642232 | 3300000242 | Marine | VSAIGVRHAKAAFLSGCKSHPAMLLQPEAVGAVME |
| TDF_OR_ARG05_123mDRAFT_10742012 | 3300000242 | Marine | GVRRAKAAFLSGCKSHPAILLQPEAIGAVMEATKWLKPSM* |
| JGI24024J18818_100182703 | 3300001685 | Marine | MTGYGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTK |
| JGI24024J18818_100620762 | 3300001685 | Marine | MSSLGVRRANAAFLGVFHPATLLQPEAIGGVMEK* |
| JGI24024J18818_100904962 | 3300001685 | Marine | VRRAKAAFLSGCESHPAIMLQPEAIGAVMEVTKWLKP |
| Ga0055521_101154051 | 3300004148 | Natural And Restored Wetlands | MGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPL |
| Ga0070728_102663142 | 3300005588 | Marine Sediment | MTGFGVRRVKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPLV* |
| Ga0070728_103632901 | 3300005588 | Marine Sediment | MSEFGVRRVKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPLM* |
| Ga0070729_107685602 | 3300005589 | Marine Sediment | VTGFGVRRAKAAFSRGCESHPAMLLQPEAIGAVMEVTKWLK |
| Ga0070727_103185421 | 3300005590 | Marine Sediment | MTGFGVRRVKAAFLSGCESHPAMLLQPEAIGAVMEVAKWLKPLV* |
| Ga0070727_103397192 | 3300005590 | Marine Sediment | KAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPLV* |
| Ga0070727_103575491 | 3300005590 | Marine Sediment | RAKAAFLSGCKSHPAILLQPEAIGAVMEVTKWLKPSV* |
| Ga0070726_100225361 | 3300005600 | Marine Sediment | MSCFGVRRVKAAFLSGCESHPVMLLQPEAIGAVMEVTKWLKPLV* |
| Ga0070726_104779601 | 3300005600 | Marine Sediment | GVRRAKAAFLSGCKSHPAILLQPEAIGAVMEVTKWLKPLV* |
| Ga0070722_101576111 | 3300005601 | Marine Sediment | MTGSGVRRAKAAFLSGCKSHPAILLQPEAIGAVMEVTKWLKP |
| Ga0070722_101932373 | 3300005601 | Marine Sediment | GVRRAKAAFLSGCKSHPAILLQPEAIGAVMEVTKWLKPSV* |
| Ga0070722_102622872 | 3300005601 | Marine Sediment | MSEFGVRRVKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPLV* |
| Ga0070722_103333882 | 3300005601 | Marine Sediment | MTGFGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTK |
| Ga0070723_102315351 | 3300005612 | Marine Sediment | MTYAYILRRMASLGVRRVKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPL |
| Ga0070723_102315353 | 3300005612 | Marine Sediment | LCRMSKSGVRRVKAAFLSGCESHPAILLQPEAIGAVMEVT |
| Ga0066903_1024426341 | 3300005764 | Tropical Forest Soil | MPASGVRRDKAALSSGCKSHPATLQPEAAGAAMEVTKWLK |
| Ga0070725_102778072 | 3300005920 | Marine Sediment | MSTFGVRRVKAAFLSGCESHPAILLQPEAIGAVMEV |
| Ga0099972_100288981 | 3300006467 | Marine | MTGLGVRRAKAAFSSGCESHPAILLQPEAIGAVMEV |
| Ga0099972_127771791 | 3300006467 | Marine | VRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPLV* |
| Ga0099972_131096802 | 3300006467 | Marine | GVRRAKAAFLSGCKSHPAILLQPEAIGAVMEVTKWLKPSM* |
| Ga0099972_132265531 | 3300006467 | Marine | MTAFGVRRAKAAFLSGCESHPAILLQPEAIGAVME |
| Ga0105047_105938932 | 3300009083 | Freshwater | VRREKVVDFSGCESHPARVLLQPEAIGAVVVVTRLLKPSMERVALGDS |
| Ga0114949_108778993 | 3300009139 | Deep Subsurface | MSALGVRRAKAALSSGCKSHPAIVLPEATGAVMEVTKWL |
| Ga0115564_105455822 | 3300009505 | Pelagic Marine | GVRRAKAAFLSGCESHPANLLHPEAIGAVMEVTKWLKPLV* |
| Ga0129285_102440921 | 3300009513 | Beach Aquifer Porewater | GVRRAKAAFLSGCKSHPAKLLQPEAIGAVMEVTKWLKPLV* |
| Ga0116217_105826501 | 3300009700 | Peatlands Soil | MSALGVRREMAALSSGCKSHLAKMPQPEVVRAVTEVTKWLKPSMQR |
| Ga0114931_101898061 | 3300009702 | Deep Subsurface | MTGIGVRRAKAAFPSGCKSHPAILLQPEAIGAVMEVTKW |
| Ga0114931_103539401 | 3300009702 | Deep Subsurface | RMTGIGVRRAKAAFPSGCKSHPAILLQPEAIGAVMEVTKWLKPLR* |
| Ga0118731_1009148732 | 3300010392 | Marine | MTGIGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWL |
| Ga0118731_1025710123 | 3300010392 | Marine | GVRRAKAAFLSGCKSHPAMLLQPEAIGAVMEVTKWLKPLR* |
| Ga0118731_1038766611 | 3300010392 | Marine | MSHSGVRRAKAAFLSGCKSHPAILLQPEAIGAVMEVTKWL |
| Ga0118731_1049165491 | 3300010392 | Marine | MTTSGVRRVKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPL |
| Ga0118731_1055084042 | 3300010392 | Marine | GVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPLV* |
| Ga0118731_1063831472 | 3300010392 | Marine | MALRGRFALRCMSVVGVRRAKAAFLSGCKSHPAMLLQPEAIGAV |
| Ga0118731_1070919181 | 3300010392 | Marine | MSAYGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLK |
| Ga0118731_1075737963 | 3300010392 | Marine | MTDFGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPLV* |
| Ga0118731_1106028115 | 3300010392 | Marine | MTAFGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPSV* |
| Ga0118731_1107422351 | 3300010392 | Marine | KAAFLSGCKSHPAILLQPEAIGAVMEVTKWLKPSM* |
| Ga0118731_1121447071 | 3300010392 | Marine | MSLSGVRRVKAAFLSGCKSHPAILLQPEAIGAVMEVTKWLKP |
| Ga0118731_1123523912 | 3300010392 | Marine | MTGFGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPLV |
| Ga0118731_1135719321 | 3300010392 | Marine | KAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPSV* |
| Ga0118731_1146529112 | 3300010392 | Marine | MSEFGVRRVKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPSV* |
| Ga0118731_1147211493 | 3300010392 | Marine | MFEFGVRRAKAAFLSGYKSHPAILLQPEAIGAVMEVTKWLKPLV* |
| Ga0118733_10004726812 | 3300010430 | Marine Sediment | AAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPSV* |
| Ga0118733_1009011323 | 3300010430 | Marine Sediment | MSHFGVRRAKAAFLSGCEAHPAMLLQPEAIGAVMEVTKWLKPLM* |
| Ga0118733_1014556733 | 3300010430 | Marine Sediment | MSGCGVRRAKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLK |
| Ga0118733_1016844271 | 3300010430 | Marine Sediment | KAAFLSGCESHPAMLLQPEAIGVVMEVTKWLKPPG* |
| Ga0118733_1023647841 | 3300010430 | Marine Sediment | VRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPLV |
| Ga0118733_1024989473 | 3300010430 | Marine Sediment | MSCIGVRRAKAAFLSGCKSHPAILLQPEAIGAVMEVTKW |
| Ga0118733_1025489242 | 3300010430 | Marine Sediment | MTASGVRRAKAAFLSGCKSHPAILLQPEAIGAVMEATKWLKPSV* |
| Ga0118733_1028448301 | 3300010430 | Marine Sediment | KAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPLR* |
| Ga0118733_1034342581 | 3300010430 | Marine Sediment | MTAFGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKP |
| Ga0118733_1035141721 | 3300010430 | Marine Sediment | MLMFAIGVRRAKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKP |
| Ga0118733_1035174261 | 3300010430 | Marine Sediment | VFELRRSVVGVRRAKAAFLSGCKSHPAILLQPEAIGAVMEVTK |
| Ga0118733_1038522381 | 3300010430 | Marine Sediment | GVRRAKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLGTFIVLGV* |
| Ga0118733_1042192191 | 3300010430 | Marine Sediment | MTVSGVRRVKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPL |
| Ga0118733_1044120231 | 3300010430 | Marine Sediment | RRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPSM* |
| Ga0118733_1059700562 | 3300010430 | Marine Sediment | AAFLSGCKSHPAILLQPEAIGAVMEVTKWLKPLV* |
| Ga0118733_1071928941 | 3300010430 | Marine Sediment | MTAMGVCRGKAAFPSGCETHPAILLQPEAIGAVMEVTKWLKPLV |
| Ga0118733_1074888371 | 3300010430 | Marine Sediment | MTTSGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPLV |
| Ga0118733_1088061121 | 3300010430 | Marine Sediment | MSCSGVRRVKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPL |
| Ga0139250_10003373 | 3300010968 | Hydrothermal Chimney Microbial Mat | MTDFGVRRAKAAFLSGCKSHPANLLQPEAIGAVMEVTKWLKPLV* |
| Ga0139246_10689272 | 3300010969 | Hydrothermal Chimney Microbial Mat | MSVIGVRRAKAAFPSGCKSHPAILLQPEAIGAVMEVTK |
| Ga0138565_11334771 | 3300011078 | Peatlands Soil | SGDGVRRDKAALSSGCKSHPANSLQPEAIGAVMEVTR* |
| Ga0181530_100923744 | 3300014159 | Bog | MAPATSVMPVRPGKAALSSGCETHPAPLQPEATGAAMEVTKWLKPS |
| Ga0132258_109691332 | 3300015371 | Arabidopsis Rhizosphere | SAEIAVIGVRRAKAALSSGCKPHPANSLQPEAIGAVMEVTR* |
| Ga0182041_115263021 | 3300016294 | Soil | MSEMGVRRDKAALSNGCKSHPATLQPEAAGAAMEVTK |
| Ga0182032_111518842 | 3300016357 | Soil | MSEKGVRRDKAALSNGCKSHPATLQPEAAGAAMEV |
| Ga0182034_109503551 | 3300016371 | Soil | MSVQGVRRDKAALSSGCKSHPATLQPEAAGAAMEVTKWLKP |
| Ga0182040_117332411 | 3300016387 | Soil | MSGIGVRRDKAALSSGCKAHPAISLQPEAIGAVME |
| Ga0182039_102181421 | 3300016422 | Soil | LLAAGIGVRRDKAALSSGCKAHPAISLQPEAIGAVME |
| Ga0187778_107832161 | 3300017961 | Tropical Peatland | GCLLYDVRRAKAALFSGCKPHPANSLQPEAIGAVMEVTR |
| Ga0190266_109194721 | 3300017965 | Soil | MHSNVRVGCRAKEALSSGCNPTRQPLQPEAIGAVMEVTKW |
| Ga0193991_10118122 | 3300019720 | Sediment | MSVSGVRRVKAAFSSGCKSHPAILLQPEAIGAVMEVTKWLVALGKRGRGG |
| Ga0193973_10144171 | 3300019737 | Sediment | MSVSGVRRVKAAFSSGCKSHPAILLQPEAIGAVVEVTK |
| Ga0193973_10423761 | 3300019737 | Sediment | VRRVKAAFSSGCKSHPAILLQPEAIGAVVEVTKWLV |
| Ga0193992_10519491 | 3300019743 | Sediment | MTESGVRRAKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPLV |
| Ga0194002_10469491 | 3300019745 | Sediment | VRRVKAAFSSECKSHPAILLQPEAIGAVVEVTKWLVAL |
| Ga0179592_105268161 | 3300020199 | Vadose Zone Soil | MSEMGVRRAKAALSSGCNPTRQSLQPEAIGAVMEVTKWLNLR |
| Ga0210384_110928101 | 3300021432 | Soil | MTGIGVRREKAALSSGCKAHPAISLQPEAIGAVME |
| Ga0193947_10021394 | 3300021465 | Sediment | MSVSGVRRVKAAFSSGCKSHPAILLQPQAIGAVVEVTKWLVALAK |
| Ga0224502_101608512 | 3300022218 | Sediment | TGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPLM |
| Ga0224513_101942162 | 3300022220 | Sediment | MSQSGVRRAKAAFSSGCKSHPAMLLQPEAIGAVMEVTKW |
| (restricted) Ga0233404_100582611 | 3300022913 | Seawater | MSHFGVRRVKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPLV |
| (restricted) Ga0255040_100388831 | 3300024059 | Seawater | SFLGVRRAKAAFSSGCKSHPAILLQPEAIGAVMEVTKWLKPLM |
| (restricted) Ga0255040_101898411 | 3300024059 | Seawater | SCSGVRRVKAAFLSGCESHPVILLQPEATGAVMEVTKWLKPLV |
| (restricted) Ga0255040_102798311 | 3300024059 | Seawater | MSVIGVRRVKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPLTW |
| (restricted) Ga0255039_100257881 | 3300024062 | Seawater | ARRVKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPLV |
| (restricted) Ga0255039_101455493 | 3300024062 | Seawater | MSVIGVRRVKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKP |
| Ga0210084_10488862 | 3300025564 | Natural And Restored Wetlands | KAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPLM |
| Ga0210074_10263121 | 3300025599 | Natural And Restored Wetlands | MSFCGVRRAKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPLV |
| Ga0210074_10383393 | 3300025599 | Natural And Restored Wetlands | MSLCGVRRAKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPLV |
| Ga0210123_11256921 | 3300025823 | Natural And Restored Wetlands | HSGVRRAKAAFLSGCKSHPAKLLQPEAIGAVMEVTKWLEPLM |
| Ga0209456_102472401 | 3300025883 | Pelagic Marine | GVRRGKAAFLIGCESQPAILLQPEAIGAVMEVTKWLKPLV |
| Ga0209567_100005001 | 3300025895 | Pelagic Marine | MPGIGVRRGKAAFLIGCESQPAILLQPEAIGAVMEV |
| Ga0207738_1138751 | 3300026831 | Tropical Forest Soil | RRMSELGVRRGKAALSSGCKSHPATLQPEAAGAAMEVTK |
| Ga0209037_10148402 | 3300027612 | Marine | MTVVGVRRAKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPLV |
| Ga0209118_11075061 | 3300027674 | Forest Soil | LPSSVMGVRRDKAALSSGCKSHPATLQPEATGAAMEVTK |
| Ga0209379_101486692 | 3300027758 | Marine Sediment | EFGVRRVKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPLV |
| Ga0209578_102649533 | 3300027820 | Marine Sediment | MSGCGVRRAKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPLV |
| Ga0209692_102997562 | 3300027828 | Marine Sediment | MTASGVRRAKAAFLSGCKSHLAILLQPEAIGAVMEVT |
| (restricted) Ga0255041_103419021 | 3300027837 | Seawater | RVKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPLV |
| Ga0209013_100839093 | 3300027858 | Marine | MTGVGVRRVKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKP |
| Ga0209013_101123171 | 3300027858 | Marine | MTGYGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWL |
| (restricted) Ga0255055_104088611 | 3300027881 | Seawater | MAAKGVRRGKAAFPSGCKSHPAILLQPVAIGAVMEVTKWLKPLV |
| Ga0209272_101026792 | 3300027967 | Marine Sediment | MTGFGVRRVKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPLV |
| (restricted) Ga0233413_101665052 | 3300027996 | Seawater | GARRVKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLKPLV |
| Ga0209526_103116683 | 3300028047 | Forest Soil | MSALGVRRAKAALSSGCKPRPATLQPEAIGAVMEVTKWL |
| Ga0265306_101126621 | 3300028598 | Sediment | MGACRTAVHGVRRAKAAFLSGCESHPAILLQPEAIGAVTEVTKWL |
| Ga0265309_100479464 | 3300028599 | Sediment | VRRVKAAFLSGCKSHPAILLQPEAIGAVMEVTKWLGNLAMF |
| Ga0265309_112056722 | 3300028599 | Sediment | MTDSGVRRAKAAFLSGCKSHPAILLQPEAIGAVME |
| Ga0265303_100189745 | 3300028600 | Sediment | MSAFGVRRVKAAFLSGCESHPAILLQPEAIGAVMEVMKWLKPLV |
| Ga0265303_101631891 | 3300028600 | Sediment | PSRGMAVPGVRRAKAAFLSGCESHPAILLQPEAIGAVTEVTKWLKPLV |
| Ga0302325_107584821 | 3300031234 | Palsa | MAGIGVRREKEALSSGCEAHPAKSLQPEAIGAVMEVTK |
| Ga0318516_102998162 | 3300031543 | Soil | MSEMGVRRDKAALSSGCKSHPATLQPEAAGAAMEVT |
| Ga0306923_120958251 | 3300031910 | Soil | VRRDKAALSSGCKSHPATLQPEAAGAAMEVTKWLKHSE |
| Ga0310913_102951334 | 3300031945 | Soil | MTASGVRRGKAALSSGCKSHPATLQPEAAGAAMEV |
| Ga0316201_113885341 | 3300032136 | Worm Burrow | MSLFGVRRAKAAFLSGCKSHPAMLLQPEAIGAVMEV |
| Ga0311301_105582253 | 3300032160 | Peatlands Soil | MLSEAPQPGLGVRRDKAALSSGCKSHPANSLQPEAIGAVM |
| Ga0316187_100216356 | 3300032231 | Worm Burrow | CGVRRAKAAFLSGCESHPVMLLQPEAIGAVMEVTKWLKPLR |
| Ga0316187_101498971 | 3300032231 | Worm Burrow | MSVAGVRRAKAAFLSGCKSHPAMLLQPEAIGAVMEVTKWLEPL |
| Ga0316187_102191523 | 3300032231 | Worm Burrow | MTESGVRRAKAAFLSGCESHPAMLLQPEAIGAVMEATKWLEPLM |
| Ga0316187_102902682 | 3300032231 | Worm Burrow | MTVVGVRRAKAAFLSGCKSHPAMLLQPEAIGAVMEVTKWLEPLM |
| Ga0316187_109105812 | 3300032231 | Worm Burrow | MSLFGVRRAKAAFLSGCKSHPAMLLQPEAIGAVMEVTKWLVALGK |
| Ga0316198_100065182 | 3300032251 | Sediment | MSEVGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPLM |
| Ga0316198_100245372 | 3300032251 | Sediment | MSEVGVRRAKAAFLSGCKSHPAMLLQPEAIGAVMEVTKWLKPLR |
| Ga0316198_100553913 | 3300032251 | Sediment | MSGSGVRRAKAAFLSGCKSHPAILLQPEAIGAVMEATKWLKPSV |
| Ga0316196_100147241 | 3300032252 | Sediment | MSLFGVRRAKAAFLSGCKSHPAMLLQPEAIGAVMEVTKWLVALGKRG |
| Ga0316205_100423212 | 3300032257 | Microbial Mat | MSVSGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKPLV |
| Ga0316191_100339672 | 3300032258 | Worm Burrow | MSLFGVRRAKAAFLSGCKSHPAMLLQPEAIGAVMEVTKWLEPLM |
| Ga0316191_114090842 | 3300032258 | Worm Burrow | MPXESTSGVRRAKAAFLSGCESHPAMLLQPEAIGAVMEVTKWL |
| Ga0316190_1000958911 | 3300032259 | Worm Burrow | MTVVGVRRAKAAFLSGCKSHPAMLLQPEAIGAVMEVTKWLE |
| Ga0316190_101184262 | 3300032259 | Worm Burrow | NPGMTVSGVRRAKAAFLSGCKSHPAMLLQPEATGAVMEVTKWLKPLV |
| Ga0316190_102251991 | 3300032259 | Worm Burrow | VRRAKAAFLSGCKSHPAMLLQPEAIGAVMEVTKWLEPL |
| Ga0316190_105190691 | 3300032259 | Worm Burrow | MTGSGVRRAKAAFLSGCKSHPAMLLQPEAIGAVMEVTKWLE |
| Ga0316192_100083567 | 3300032260 | Worm Burrow | MSCSGVRRAKAAFLSGCKSHPAILLQPEAIGAVMEVTKWLKPLV |
| Ga0316192_100504272 | 3300032260 | Worm Burrow | RLCCMSEFGVRRAKAAFLSGCKSHPAILLQPEAIGAVMEATKWLKPSV |
| Ga0316192_100557872 | 3300032260 | Worm Burrow | MTDFGVRRAKAAFSSGYESHPAILLQPEAIGAVMEVTKWLKPSM |
| Ga0316192_102186591 | 3300032260 | Worm Burrow | MSVVGVRRAKAAFLSGCESHPAMLLQPEAIGAVME |
| Ga0316192_109805402 | 3300032260 | Worm Burrow | MTVVGVRRAKAAFLSGCKSHPAMLLQPEAIGAVMEVTKWLVALG |
| Ga0306920_1003426231 | 3300032261 | Soil | LLAAGIGVRRDKAALSSGCKAHPAISLQPEAIGAVMEVT |
| Ga0316194_102748712 | 3300032262 | Sediment | MTGSGVRRAKAAFLSGCKSHPAMLLQPEAIGAVMEVTKWLEPLM |
| Ga0316194_104609681 | 3300032262 | Sediment | MSPSGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKP |
| Ga0316195_103962571 | 3300032263 | Sediment | MTVVGVRRAKAAFLSGCESHPAMLLQPEAIGAVMEVTKWLEPLM |
| Ga0316189_100525271 | 3300032272 | Worm Burrow | VRRAKAAFLSGCKSHPAMLLQPEAIGAVMEVTKWL |
| Ga0316197_100677771 | 3300032273 | Sediment | PMAGVGVRRVKAAFLSGCESHPAILLQPEAIGAVMEVMKWLKPLV |
| Ga0316188_102826391 | 3300032276 | Worm Burrow | MSLFGMRRAKAAFFSGCKSHPAMLLQPEAIGAVMEVT |
| Ga0334722_101429731 | 3300033233 | Sediment | MAAQGVRRDKAALSSGCESHPATLQPEATGAVVEETKWLK |
| Ga0307417_103475302 | 3300033291 | Salt Marsh | AKAAFLSGCKAHPANLLQPEAIGAVMEVTKWLEPLM |
| Ga0316193_100217505 | 3300033429 | Sediment | MSPSGVRRAKAAFLSGCESHPAILLQPEAIGAVMEVTKWLKL |
| Ga0316193_100443194 | 3300033429 | Sediment | MSLFGVRRAKAAFLSGCKSHPAMLLQPEAIGAVMEVTK |
| Ga0316193_100905615 | 3300033429 | Sediment | MSLCGVRRVKAAFLSGCETHPAILLQPEAIGAVME |
| Ga0316193_104054602 | 3300033429 | Sediment | VRRAKAAFLSGCKSHPAILLQPEAIGAVMEVTKWLVALG |
| Ga0316193_104314251 | 3300033429 | Sediment | VRRAKAAFLSGCKSHPAMLLQPEAIGAVMEVTKWLKP |
| Ga0316193_105431353 | 3300033429 | Sediment | MASFGVRRDKAAFLSGCESHPVILLQPEAIGAVMEVTKWLPGQIED |
| ⦗Top⦘ |