


| Basic Information | |
|---|---|
| Family ID | F040575 |
| Family Type | Metagenome |
| Number of Sequences | 161 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MQTELIEIQNIPCTVCQECGLEQIGQQVQKKIDKLLERAAKGKLKARVVVM |
| Number of Associated Samples | 137 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 26.25 % |
| % of genes near scaffold ends (potentially truncated) | 38.51 % |
| % of genes from short scaffolds (< 2000 bps) | 84.47 % |
| Associated GOLD sequencing projects | 129 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.273 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (13.043 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.646 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (39.752 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.11% β-sheet: 0.00% Coil/Unstructured: 70.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF01734 | Patatin | 3.11 |
| PF04392 | ABC_sub_bind | 2.48 |
| PF08450 | SGL | 2.48 |
| PF00873 | ACR_tran | 1.86 |
| PF09084 | NMT1 | 1.86 |
| PF13416 | SBP_bac_8 | 1.86 |
| PF00528 | BPD_transp_1 | 1.24 |
| PF08241 | Methyltransf_11 | 1.24 |
| PF13193 | AMP-binding_C | 1.24 |
| PF01370 | Epimerase | 1.24 |
| PF10142 | PhoPQ_related | 1.24 |
| PF05598 | DUF772 | 0.62 |
| PF13483 | Lactamase_B_3 | 0.62 |
| PF07811 | TadE | 0.62 |
| PF00899 | ThiF | 0.62 |
| PF01738 | DLH | 0.62 |
| PF02560 | Cyanate_lyase | 0.62 |
| PF16277 | DUF4926 | 0.62 |
| PF12728 | HTH_17 | 0.62 |
| PF01850 | PIN | 0.62 |
| PF01590 | GAF | 0.62 |
| PF03241 | HpaB | 0.62 |
| PF13400 | Tad | 0.62 |
| PF01135 | PCMT | 0.62 |
| PF00044 | Gp_dh_N | 0.62 |
| PF02776 | TPP_enzyme_N | 0.62 |
| PF03631 | Virul_fac_BrkB | 0.62 |
| PF01547 | SBP_bac_1 | 0.62 |
| PF05559 | DUF763 | 0.62 |
| PF00210 | Ferritin | 0.62 |
| PF07719 | TPR_2 | 0.62 |
| PF10387 | DUF2442 | 0.62 |
| PF03972 | MmgE_PrpD | 0.62 |
| PF13343 | SBP_bac_6 | 0.62 |
| PF00565 | SNase | 0.62 |
| PF03358 | FMN_red | 0.62 |
| PF07394 | DUF1501 | 0.62 |
| PF00550 | PP-binding | 0.62 |
| PF02604 | PhdYeFM_antitox | 0.62 |
| PF00583 | Acetyltransf_1 | 0.62 |
| PF00140 | Sigma70_r1_2 | 0.62 |
| PF00571 | CBS | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 3.11 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 3.11 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 3.11 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.48 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 2.48 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 2.48 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.86 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.86 |
| COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 0.62 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.62 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.62 |
| COG1415 | Uncharacterized conserved protein, DUF763 domain | Function unknown [S] | 0.62 |
| COG1513 | Cyanate lyase | Inorganic ion transport and metabolism [P] | 0.62 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.62 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.62 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.62 |
| COG2368 | Aromatic ring hydroxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.62 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.62 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.89 % |
| Unclassified | root | N/A | 3.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0694952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1210 | Open in IMG/M |
| 3300000890|JGI11643J12802_10376241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1232 | Open in IMG/M |
| 3300000956|JGI10216J12902_100663798 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300000956|JGI10216J12902_102163175 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300003993|Ga0055468_10201757 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Chlorobiaceae → Chloroherpeton → Chloroherpeton thalassium | 612 | Open in IMG/M |
| 3300003996|Ga0055467_10009394 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300003999|Ga0055469_10130775 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300004156|Ga0062589_101090378 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300004157|Ga0062590_100698055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 913 | Open in IMG/M |
| 3300004463|Ga0063356_106192714 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300004479|Ga0062595_101427529 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005166|Ga0066674_10013895 | All Organisms → cellular organisms → Bacteria | 3392 | Open in IMG/M |
| 3300005167|Ga0066672_10440527 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300005172|Ga0066683_10246264 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300005174|Ga0066680_10350549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 941 | Open in IMG/M |
| 3300005186|Ga0066676_10014360 | All Organisms → cellular organisms → Bacteria | 3994 | Open in IMG/M |
| 3300005289|Ga0065704_10029511 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300005294|Ga0065705_10936082 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005295|Ga0065707_10382070 | Not Available | 834 | Open in IMG/M |
| 3300005338|Ga0068868_100277777 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300005340|Ga0070689_100503029 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300005345|Ga0070692_11417177 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005437|Ga0070710_11294534 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005439|Ga0070711_101414280 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005446|Ga0066686_10304368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1083 | Open in IMG/M |
| 3300005447|Ga0066689_10315366 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 971 | Open in IMG/M |
| 3300005451|Ga0066681_10026835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3006 | Open in IMG/M |
| 3300005518|Ga0070699_100598879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Selenomonadaceae → Selenomonas → unclassified Selenomonas → Selenomonas sp. AE3005 | 1005 | Open in IMG/M |
| 3300005518|Ga0070699_102159634 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005546|Ga0070696_101962221 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Spirosoma → Spirosoma luteum | 508 | Open in IMG/M |
| 3300005553|Ga0066695_10909628 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Archaeoglobi → Archaeoglobales → Archaeoglobaceae → Archaeoglobus → Archaeoglobus fulgidus | 502 | Open in IMG/M |
| 3300006755|Ga0079222_10040951 | All Organisms → cellular organisms → Bacteria | 2074 | Open in IMG/M |
| 3300006791|Ga0066653_10136186 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1175 | Open in IMG/M |
| 3300006794|Ga0066658_10405192 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 740 | Open in IMG/M |
| 3300006794|Ga0066658_10657011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300006794|Ga0066658_10861245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300006796|Ga0066665_11156144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfohalobiaceae → Desulfonatronovibrio → Desulfonatronovibrio magnus | 590 | Open in IMG/M |
| 3300006796|Ga0066665_11404050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300006797|Ga0066659_10015208 | All Organisms → cellular organisms → Bacteria | 4259 | Open in IMG/M |
| 3300006846|Ga0075430_100078204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2773 | Open in IMG/M |
| 3300006847|Ga0075431_101152337 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300006876|Ga0079217_10193696 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1031 | Open in IMG/M |
| 3300006894|Ga0079215_10222843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 975 | Open in IMG/M |
| 3300006903|Ga0075426_10849220 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300006903|Ga0075426_11177282 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300006904|Ga0075424_100697449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1084 | Open in IMG/M |
| 3300006918|Ga0079216_10279077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 974 | Open in IMG/M |
| 3300006918|Ga0079216_10795971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300006918|Ga0079216_11197304 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006918|Ga0079216_11931496 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300007004|Ga0079218_10061378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2394 | Open in IMG/M |
| 3300009012|Ga0066710_102580445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300009012|Ga0066710_103213784 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300009053|Ga0105095_10325005 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300009137|Ga0066709_103896604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300009147|Ga0114129_10617056 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300009147|Ga0114129_13320471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300009148|Ga0105243_10994485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 841 | Open in IMG/M |
| 3300009156|Ga0111538_10498825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1543 | Open in IMG/M |
| 3300009162|Ga0075423_10243206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1885 | Open in IMG/M |
| 3300009553|Ga0105249_12716855 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300009777|Ga0105164_10001499 | All Organisms → cellular organisms → Bacteria | 14937 | Open in IMG/M |
| 3300010323|Ga0134086_10169853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 803 | Open in IMG/M |
| 3300010362|Ga0126377_10029227 | All Organisms → cellular organisms → Bacteria | 4642 | Open in IMG/M |
| 3300010371|Ga0134125_12390414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300010375|Ga0105239_13060617 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300010403|Ga0134123_11187124 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300011003|Ga0138514_100139688 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300011413|Ga0137333_1116798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300012081|Ga0154003_1037246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 851 | Open in IMG/M |
| 3300012198|Ga0137364_10238192 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300012198|Ga0137364_11215090 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012203|Ga0137399_10436858 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300012206|Ga0137380_10456580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1129 | Open in IMG/M |
| 3300012349|Ga0137387_10133882 | Not Available | 1755 | Open in IMG/M |
| 3300012355|Ga0137369_10069727 | All Organisms → cellular organisms → Bacteria | 2982 | Open in IMG/M |
| 3300012357|Ga0137384_10838691 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300012362|Ga0137361_11481565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300012493|Ga0157355_1006904 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300012582|Ga0137358_10389148 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 943 | Open in IMG/M |
| 3300012582|Ga0137358_10692843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300012676|Ga0137341_1037009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 809 | Open in IMG/M |
| 3300012685|Ga0137397_10155165 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
| 3300012912|Ga0157306_10235932 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012922|Ga0137394_10047260 | All Organisms → cellular organisms → Bacteria | 3543 | Open in IMG/M |
| 3300012922|Ga0137394_10109235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2334 | Open in IMG/M |
| 3300012923|Ga0137359_10179291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1891 | Open in IMG/M |
| 3300012923|Ga0137359_11773012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300012929|Ga0137404_10212231 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300012929|Ga0137404_11195578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300012930|Ga0137407_10480711 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300012961|Ga0164302_11239506 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300013308|Ga0157375_10325086 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
| 3300013308|Ga0157375_13740620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 506 | Open in IMG/M |
| 3300014154|Ga0134075_10165135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 948 | Open in IMG/M |
| 3300014263|Ga0075324_1039307 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300014265|Ga0075314_1067317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300014878|Ga0180065_1083186 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300014881|Ga0180094_1012368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1593 | Open in IMG/M |
| 3300014884|Ga0180104_1010104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2177 | Open in IMG/M |
| 3300015245|Ga0137409_10036009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4774 | Open in IMG/M |
| 3300015245|Ga0137409_10306881 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300015373|Ga0132257_101275235 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300015373|Ga0132257_104255210 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 521 | Open in IMG/M |
| 3300017997|Ga0184610_1015033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2011 | Open in IMG/M |
| 3300018031|Ga0184634_10074249 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300018061|Ga0184619_10071385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1534 | Open in IMG/M |
| 3300018063|Ga0184637_10130982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1546 | Open in IMG/M |
| 3300018074|Ga0184640_10170729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 976 | Open in IMG/M |
| 3300018076|Ga0184609_10063036 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300018077|Ga0184633_10007940 | All Organisms → cellular organisms → Bacteria | 4986 | Open in IMG/M |
| 3300018084|Ga0184629_10575730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300018422|Ga0190265_10214848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1946 | Open in IMG/M |
| 3300018422|Ga0190265_11065748 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300018431|Ga0066655_10007305 | All Organisms → cellular organisms → Bacteria | 4609 | Open in IMG/M |
| 3300018432|Ga0190275_11591561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300018432|Ga0190275_11852939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 682 | Open in IMG/M |
| 3300018433|Ga0066667_10542666 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 964 | Open in IMG/M |
| 3300018476|Ga0190274_13977525 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300018482|Ga0066669_10619917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 950 | Open in IMG/M |
| 3300019789|Ga0137408_1332499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1013 | Open in IMG/M |
| 3300019889|Ga0193743_1013040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4608 | Open in IMG/M |
| 3300020003|Ga0193739_1061616 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300020060|Ga0193717_1078542 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300020060|Ga0193717_1174013 | Not Available | 609 | Open in IMG/M |
| 3300020061|Ga0193716_1018960 | All Organisms → cellular organisms → Bacteria | 3462 | Open in IMG/M |
| 3300021560|Ga0126371_10060837 | All Organisms → cellular organisms → Bacteria | 3643 | Open in IMG/M |
| 3300025173|Ga0209824_10002351 | All Organisms → cellular organisms → Bacteria | 9877 | Open in IMG/M |
| 3300025795|Ga0210114_1024274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1292 | Open in IMG/M |
| 3300025796|Ga0210113_1098068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300025904|Ga0207647_10599881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300025910|Ga0207684_11119154 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300025925|Ga0207650_11100680 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300025930|Ga0207701_10064534 | All Organisms → cellular organisms → Bacteria | 3334 | Open in IMG/M |
| 3300025933|Ga0207706_11605315 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300025961|Ga0207712_10949114 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300025972|Ga0207668_12169144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300026046|Ga0208780_1026341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300026089|Ga0207648_11109172 | Not Available | 742 | Open in IMG/M |
| 3300026285|Ga0209438_1052821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1339 | Open in IMG/M |
| 3300026315|Ga0209686_1065197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1304 | Open in IMG/M |
| 3300026323|Ga0209472_1089092 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1244 | Open in IMG/M |
| 3300027527|Ga0209684_1029227 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300028578|Ga0272482_10318412 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300028814|Ga0307302_10152499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1120 | Open in IMG/M |
| 3300030006|Ga0299907_10059306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3069 | Open in IMG/M |
| 3300030606|Ga0299906_10410038 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1047 | Open in IMG/M |
| 3300031229|Ga0299913_11530865 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031548|Ga0307408_100072574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2549 | Open in IMG/M |
| 3300031548|Ga0307408_100439324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1129 | Open in IMG/M |
| 3300031548|Ga0307408_100492793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Paucibacter → Paucibacter toxinivorans | 1071 | Open in IMG/M |
| 3300031720|Ga0307469_10814571 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300031731|Ga0307405_10848738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 769 | Open in IMG/M |
| 3300031852|Ga0307410_10429128 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300031901|Ga0307406_10976610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300031903|Ga0307407_10356651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1037 | Open in IMG/M |
| 3300031954|Ga0306926_11713050 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300032144|Ga0315910_10786251 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300032180|Ga0307471_102740371 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300033004|Ga0335084_10230146 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.59% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.35% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.11% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.86% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.86% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 1.24% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.24% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.24% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.24% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.62% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.62% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.62% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.62% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.62% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300012081 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012676 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT433_2 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025173 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes) | Environmental | Open in IMG/M |
| 3300025795 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026046 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028578 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_06949521 | 2228664021 | Soil | YLARTMIHNDSMEIQNIPCTVCHECDYEQIGEQVQKKIDKLLERAARGKLKSRLVVM |
| JGI11643J12802_103762412 | 3300000890 | Soil | EPAEVPNIPCTVCHECDYEQIGEQVQKKIDKLLERAARGKLKSRLVVM* |
| JGI10216J12902_1006637983 | 3300000956 | Soil | ICQECDHEQIGYQAQSRIDKLVERAAKGKLRDRVVTM* |
| JGI10216J12902_1021631753 | 3300000956 | Soil | ICQECDHEQIGYQAQGKIDKLLERAAKGKLKDRVVTL* |
| Ga0055468_102017571 | 3300003993 | Natural And Restored Wetlands | MQTDLIEIQNIPCTVCQECGQEQIGQRVQKSIDKLVERAGKGKLK |
| Ga0055467_100093941 | 3300003996 | Natural And Restored Wetlands | MQTDLIEIQNIPCTVCQECGQEQIGQRVQKSIDKLVERAGKGKLKTRVVVM* |
| Ga0055469_101307751 | 3300003999 | Natural And Restored Wetlands | VARTTRQTDPIEIENIPCTACLECGHEQISARIQKKIDKLVERAVGGKLKTHRVVM* |
| Ga0062589_1010903782 | 3300004156 | Soil | MEIQNIPCTVCHECDYEQIGEQVQKKIDKLLERAARGKLKSRLVVM* |
| Ga0062590_1006980551 | 3300004157 | Soil | MIHNDSMEIQNIPCTVCHECDYEQIGEQVQKKIDKLLERAARGKLKSRLVVM* |
| Ga0063356_1061927141 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MEIQNIPCTICHECGYELIGQQAQKKVDKLLERAAKGKLKSRFVVM* |
| Ga0062595_1014275292 | 3300004479 | Soil | LARTTIRNDLLEIQNILCTVCQECGQEQIAQTVQKKIDKILDRAAKGKLKTHVVVM* |
| Ga0066674_100138953 | 3300005166 | Soil | MQTDLIEMQNIPCTVCQECGHEQIGQQVQKKIDKLLERAAKGKLKARVVVM* |
| Ga0066672_104405271 | 3300005167 | Soil | IQTDLLEIRNVPCTICQECGHEQIGYQAQSRIDKLVERAAKGKLKDRVVTM* |
| Ga0066683_102462642 | 3300005172 | Soil | MQTELIEIQNIPCTVCQECGLEQIGQQVQKTIDKLLERVAKGKLKARVVVM* |
| Ga0066680_103505491 | 3300005174 | Soil | ELIEIQNIPCTVCQECGLEQIGQQVQKKIDKLLERVAKGKLKARVVVM* |
| Ga0066676_100143605 | 3300005186 | Soil | MQTELIEIQNIPCTVCQECGLEQIGQQVQKKIDKLLERVAKGKLKARVVVM* |
| Ga0065704_100295111 | 3300005289 | Switchgrass Rhizosphere | HTDLLEIRNVPCTICQECDHEQIGYQAQSRIDKLVERAAKGKLKDRVVTM* |
| Ga0065705_109360822 | 3300005294 | Switchgrass Rhizosphere | LARTTIRNDLLEIQNILCTVCQECGQEQIAQTVQKKIDKILGRAAKGKL |
| Ga0065707_103820701 | 3300005295 | Switchgrass Rhizosphere | LEIRNVPCTICQECDHEQIGYQAQGRIDKLVERAAKGKLKDRVVTM* |
| Ga0068868_1002777773 | 3300005338 | Miscanthus Rhizosphere | TTIQTDLLEIRNVPCTICQECDQEQIGYQAQSRIDKLLERAAKGKLKDRVVTM* |
| Ga0070689_1005030293 | 3300005340 | Switchgrass Rhizosphere | MYLARTTIQTDLIEIQNIPCTVCQECGQEQIGQQAQKKIDKLLERAVKGKLKSRVVVM* |
| Ga0070692_114171772 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | DLIEIQNIPCTVCQECGQEQIGQQAQKKIDKLLERAVKGKLKSRVVVM* |
| Ga0070710_112945341 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | IRNVPCTICQECDHEQIGYQAQSRIDKLLERAAKGKLKDRVVTM* |
| Ga0070711_1014142801 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | EIRNVPCTICQECEHEQIGYQAQSKIDKLLERAAKGKLKDRVVTM* |
| Ga0066686_103043682 | 3300005446 | Soil | MQTDLIEIQNIPCTVCQECGEEQIGQRVQKNIDKLLERAGKGKLKTRVVVM* |
| Ga0066689_103153661 | 3300005447 | Soil | LGRTTMRTELIEIQNIPCTVCQECGLEQIGQQVQKKIDKLLERVAKGKLKARVVVM* |
| Ga0066681_100268352 | 3300005451 | Soil | MQTDLIEMQNIPCTVCQECGHEQIGQQVQKKIDKLLERAVKGKLKARVVVM* |
| Ga0070699_1005988791 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | TTVHTDLLEIRNVPCTICQECDHEQIGYQAQTRIDKLVERAAKGKLKDRVVTM* |
| Ga0070699_1021596342 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LARTTIRTDLLEIQNILCTVCQECGQEQIAQTVQKKIDKILDRAAKGKLKT |
| Ga0070696_1019622211 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | DLLEIRNVPCTVCHECGHEQIGYQAQSRINKLLERAAKGKLRDRVVTM* |
| Ga0066695_109096281 | 3300005553 | Soil | TMQTELIEIQNIPCTVCQECGLEQIGQQVQKKIDKLLERVAKGKLKARVVVM* |
| Ga0079222_100409511 | 3300006755 | Agricultural Soil | RNVPCIICQECDHEQIGYQAQGRIDKLLERAVKGKLKDRVVTM* |
| Ga0066653_101361861 | 3300006791 | Soil | TTMQTDLIEMQNIPCTVCQECGHEQIGQQVQKKIDKLLERAAKGKLKARVVVM* |
| Ga0066658_104051922 | 3300006794 | Soil | MQTELIEIQNIPCTVCQECGLEQIGQQVQKKIDKLLERAAKGKLKARVVVM* |
| Ga0066658_106570112 | 3300006794 | Soil | MQTDLIEIQNIPCTVCQECGQEQIGQRVQKSIDKLLERAAKGKLKPRIVVM* |
| Ga0066658_108612451 | 3300006794 | Soil | MQTDLIEMQNIPCTVCQECGHEQIGQQVQKKIDRLLERAAKGKLKARVVVM* |
| Ga0066665_111561441 | 3300006796 | Soil | TIQTDLVEIQNIPCTVCQECGQEQIGQLAQRKIDKLLERAAKGNLKTRTVVM* |
| Ga0066665_114040501 | 3300006796 | Soil | MQTDLIEMQNIPCTVCRECGHEQIGQQVQKKIDKLLERAAKGKLKARVVVM* |
| Ga0066659_100152085 | 3300006797 | Soil | LGRTTMQTDLIEMQNIPCTVCQECGHEQIGQQVQKKIDKLLERAAKGKLKARVVVM* |
| Ga0075430_1000782043 | 3300006846 | Populus Rhizosphere | QNIPCTICHECGYELIGQQAQKKIDKLLERAAKGKLKSRFVVM* |
| Ga0075431_1011523371 | 3300006847 | Populus Rhizosphere | MIHNDSVEIQNIPCTVCHECDYEQIGEQAQKKIDKLLERAAKGKLKSRLIVM* |
| Ga0079217_101936962 | 3300006876 | Agricultural Soil | MHKDSTEIQNIPCTICHECGYEQIGQQAQKKIDKLLERAAKGKLKSRFVVM* |
| Ga0079215_102228432 | 3300006894 | Agricultural Soil | MHKDSTEIQNIPCTICHECGYEQIGQQAQKKIDKLLQRAAKEKLKSRLVVM* |
| Ga0075426_108492204 | 3300006903 | Populus Rhizosphere | LLEIRNVPCTICQECDQEQIGYQAQSRIDKLLERAAKGKLKDRVVTM* |
| Ga0075426_111772821 | 3300006903 | Populus Rhizosphere | IQNIPCTVCQECGQEQIGQLAQRKTDKLLERAAKGNLKTRTVVM* |
| Ga0075424_1006974492 | 3300006904 | Populus Rhizosphere | IQTDLVEIQNIPCTVCQECGQEQIGQLAQRKIDKLLERAAKGNLKTRTVVM* |
| Ga0079216_102790772 | 3300006918 | Agricultural Soil | CHECGYEQIGQQAQKKINKLLERAAKEKLKSRLVVM* |
| Ga0079216_107959711 | 3300006918 | Agricultural Soil | MIHKDSIEIQNIPCAICHECGYELIGQQAQKKIDKLLERAAKGKLKSRFVVM* |
| Ga0079216_111973041 | 3300006918 | Agricultural Soil | MQTDLIEIQNIPCTVCQECGQEQIGQQVQKKIDNLVERAAKGKLKSRLIVM* |
| Ga0079216_119314961 | 3300006918 | Agricultural Soil | TTQTDLMEIQNIPCTVCQECGQEQIGQQVQKKIDNLVERAAKGKLKSRLIVM* |
| Ga0079218_100613784 | 3300007004 | Agricultural Soil | MHKDSTEIQNIPCTICHECGYEQIGQQAQKKIDKLLERAAKEKLKSRLVVM* |
| Ga0066710_1025804451 | 3300009012 | Grasslands Soil | MQTDLIEIQNIPCTVCQECGEEQISQRVQKSIDKLLERAGKGKLKTRVVVM |
| Ga0066710_1032137842 | 3300009012 | Grasslands Soil | LQTDLIEIQNIPCTVCQECGQEQIGQRVQKSMDKLLERAGKGKLKTRVVVM |
| Ga0105095_103250051 | 3300009053 | Freshwater Sediment | MQNGLIQIQNIPCTVCQECGQEQIGYQVQKKIDKLVERAAKGKLKSRLVVM* |
| Ga0066709_1038966041 | 3300009137 | Grasslands Soil | VEIQNIPCTVCQECGQEQIAQRVQKKIDKLLERAAKGQLKTRVVVM* |
| Ga0114129_106170562 | 3300009147 | Populus Rhizosphere | MQTELIEIQNIPCTACQECGQEQIGHQVQKKIDKLLERAAKGKLKAHVVVL* |
| Ga0114129_133204711 | 3300009147 | Populus Rhizosphere | HECGYELIGQQAQKKVDKLLERAAKGKLKSRFVVM* |
| Ga0105243_109944852 | 3300009148 | Miscanthus Rhizosphere | MIHKDSMEIQNIPCTICHECGYEQIGQQAQRKIDKLLERAAKGKLKSRLVVM* |
| Ga0111538_104988252 | 3300009156 | Populus Rhizosphere | MIHKDSMEIQNIPCTICHECGYEQIGQQAQKKIDKLLERAAKGKLKSRLVVM* |
| Ga0075423_102432061 | 3300009162 | Populus Rhizosphere | QECGQEQIGQLAQRKIDKLLERAAKGNLKTRTVVM* |
| Ga0105249_127168552 | 3300009553 | Switchgrass Rhizosphere | MIHKDSMEIQNIPCTICHECGYEQIGQQAQKKIDKLLGRAAKGKLKSRLVVM* |
| Ga0105164_100014998 | 3300009777 | Wastewater | MQTDLIEIQNIPCTVCQECGQEQIGQQVQKNIDKLLERAGKGKLKTRVVVM* |
| Ga0134086_101698531 | 3300010323 | Grasslands Soil | NIPCTVCQECGHEQIGQQVQKKIDKLLERAAKGKLKARVVVM* |
| Ga0126377_100292274 | 3300010362 | Tropical Forest Soil | MKTDLLEIRNVPCTICQECEHEQIGYQAQSRIDKLLERAAKGKLRDRVVTM* |
| Ga0134125_123904141 | 3300010371 | Terrestrial Soil | QTDIIEIQNIPCTVCEECGQEEIGQRVQKSIDKVLERAGKGKLKTRIVVM* |
| Ga0105239_130606171 | 3300010375 | Corn Rhizosphere | MRNDLLEIQNILCTVCQECGQEQIAQTVQKKIDKILDRAAKGKLKTYVVVM* |
| Ga0134123_111871241 | 3300010403 | Terrestrial Soil | PCTVCQECGQEQIAQLFQRKIDKLLERAAKGKLNTRVVVM* |
| Ga0138514_1001396882 | 3300011003 | Soil | MYLARTTIQSDLIEIQNVPCTVCQECGQEQIGQQVQKKIDKLLERAAKGKLKSRVVVM* |
| Ga0137333_11167982 | 3300011413 | Soil | MQTDLIEIKNIPCAVCQECGQEQIGQQVQKKIDKLLERAAKGKLNTRVVVM* |
| Ga0154003_10372462 | 3300012081 | Attine Ant Fungus Gardens | MQTDLIEIQNIPCTVCQECGQEQIAQRVQKSIDKLLERASKGKLKTRVVVM* |
| Ga0137364_102381922 | 3300012198 | Vadose Zone Soil | MQTDLIEIQNIPCTVCQECGQEQIGQRVQTSIDKLLERAAKGKLKTRVVVM* |
| Ga0137364_112150901 | 3300012198 | Vadose Zone Soil | TRIQTDLLEIQNIPCTVCQECGDEQIGQLVQKKIDKILDRAAKGKLKTGMVVL* |
| Ga0137399_104368582 | 3300012203 | Vadose Zone Soil | LARTTIRTDLLEIQNIPCTVCQECGQEQIAQTVQKKIDKILDRAAKGKLKTYVVVM* |
| Ga0137380_104565802 | 3300012206 | Vadose Zone Soil | MQTDLIEIQNIPCTVCQECGEEQIGQRVQKSIDKLLERAGKGKLKTRVIVM* |
| Ga0137387_101338821 | 3300012349 | Vadose Zone Soil | RTYSGRTTMQTDLIEMQNIPCTVCQECGHEQIGQQVQKKIDKLLERAAKGKLKARVVVM* |
| Ga0137369_100697273 | 3300012355 | Vadose Zone Soil | VKTNLIEIQNIPCTVCQECGQENVGQQVQKKIDTILERAAKGKLKARVVVM* |
| Ga0137384_108386913 | 3300012357 | Vadose Zone Soil | LGRTTIQTDLLEIRNIPCTICQECEHEQIGYQAQSGIDKLVERAAKGKLRDRVVTI* |
| Ga0137361_114815652 | 3300012362 | Vadose Zone Soil | YSGRTTMQTDLIEMQNIPCTVCQECGHEQIGQQVQKKIDKLLERAAKGKLKAHVVVM* |
| Ga0157321_10165972 | 3300012487 | Arabidopsis Rhizosphere | LARTTIWTDLLEIQNILCTVCQECGQEQIAQTVQKKIDKILD |
| Ga0157355_10069041 | 3300012493 | Unplanted Soil | LARTTIRNDLLEIQNILCTVCQECGQEQIAQTVQKKIDKILDRAAKGKLKTYVVVM* |
| Ga0137358_103891481 | 3300012582 | Vadose Zone Soil | MQTDLIEIQNIPCTVCQECGQEQIGQRVQTSIDKLLERAARGKLKTRVVVM* |
| Ga0137358_106928432 | 3300012582 | Vadose Zone Soil | MQTDLIEIQNIPCTACQECGQEQIGQLVQKKIDKILDRAAKGKLKTRMVVM* |
| Ga0137341_10370091 | 3300012676 | Soil | MQTDLIEIKNIPCAVCQECGQEEIGQQVQRKIDKLLERAAKGKLNTRVVVM* |
| Ga0137397_101551653 | 3300012685 | Vadose Zone Soil | LARTTIRTDLLEIQNILCTVCQECGQEQIAQTVQKKIDKILDRAAKGKLKTYVVVM* |
| Ga0157306_102359321 | 3300012912 | Soil | ELLEIRNVPCTICQECDHEQIGYQAQGRIDKLLERAAKGKLKDRVVTL* |
| Ga0137394_100472601 | 3300012922 | Vadose Zone Soil | IQTDLLEIQNIPCTVCQERGQEQTGQLAQRKIDKLLERAAKGNLKTRTVVM* |
| Ga0137394_101092355 | 3300012922 | Vadose Zone Soil | LEIPNIPCTGCQECADEQIGQLVQKKIDKILERAAKGKLKTCVVVM* |
| Ga0137359_101792911 | 3300012923 | Vadose Zone Soil | TVKSELIEIQNIPCIACQECGEEQIGQLVQKKIDKILDRAAKGKLKTRMVVM* |
| Ga0137359_117730121 | 3300012923 | Vadose Zone Soil | MQTDLIEIQNIPCTVCQECGQEQIGQRVQKSIDKLLERAAKGKLKIRIVVM* |
| Ga0137404_102122313 | 3300012929 | Vadose Zone Soil | MQTELLEIQNIPCTACQECGQEQIGQQVQKKIDKLLERAAKGKLKAHVVVM* |
| Ga0137404_111955781 | 3300012929 | Vadose Zone Soil | LIEIQNILCIACQERGEEQIEQLVQQKIDKVLDRAAKGKLKTLMVVM* |
| Ga0137407_104807111 | 3300012930 | Vadose Zone Soil | MQTELIEVQNIPCTACQECGQEQIGQQVQKKIDKLLERAAKGKLKAHVVVL* |
| Ga0164302_112395061 | 3300012961 | Soil | EIQNILCTVCQECGQEQIAQTVQKKIDKILDRAAKGKHKTHVVVM* |
| Ga0157375_103250863 | 3300013308 | Miscanthus Rhizosphere | EIQNILCTVCQECGQEQISQTVQKKIDKILDRAAKGKLKTYVVVM* |
| Ga0157375_137406201 | 3300013308 | Miscanthus Rhizosphere | QNIPCTVCQECGDEQIGQLVQKKIDKILDRAARGKLKTHVVVM* |
| Ga0134075_101651351 | 3300014154 | Grasslands Soil | MQTDLIEIQNIPCTVCQECGEEQISQRVQKSIDKLLERAGKGKLKTRVVVM* |
| Ga0075324_10393071 | 3300014263 | Natural And Restored Wetlands | MQTDLIEIQNIPCTVCQECGQEQIGQRVQKSIDKLVERAGKRKLKNRVVVM* |
| Ga0075314_10673171 | 3300014265 | Natural And Restored Wetlands | MQTDLIEIQNIPCTVCQECGQEQIAQRVQKSIDKLFERAGKRKLKTRVVVM* |
| Ga0180065_10831862 | 3300014878 | Soil | MQTDLIEIKNIPCAVCQECGQEQIGQQVQRKIDKLLERAAEGKLNTRVVVM* |
| Ga0180094_10123683 | 3300014881 | Soil | MQTDLIEIKNIPCAVCQECGQEQIGQQVQKKIDKLLERAAKGKLK |
| Ga0180104_10101042 | 3300014884 | Soil | MQTDLIEIKNIPCAICQECGQEQIGQQVQRKIDKLLERAAKGKLNTRVVVM* |
| Ga0137409_100360095 | 3300015245 | Vadose Zone Soil | LARTTIRTDLLEIQNILGTVCQECGQEQIAQTVQKKIDKILDRAAKGKLKTRLVVM* |
| Ga0137409_103068812 | 3300015245 | Vadose Zone Soil | ECEHEQIGYQTQSRIDKLVERAAKGKLRDRVVTM* |
| Ga0132257_1012752351 | 3300015373 | Arabidopsis Rhizosphere | QNIPCIACQECGEEQIGQLVQKKIDKILDRAAKGKLKTGMVVL* |
| Ga0132257_1042552102 | 3300015373 | Arabidopsis Rhizosphere | TVCQECGQEQIAQLFQRKIDKLLERAAKGKLNTRVIVM* |
| Ga0184610_10150333 | 3300017997 | Groundwater Sediment | LARTTMETDLIEIQNIPCTVCQECGHEQIGQQVQKKIDKLLERAAKGKLKARMVVM |
| Ga0184634_100742492 | 3300018031 | Groundwater Sediment | METDLIEIQNIPCTVCQECGHEQIGQQVQKKIDKLLERAAKGKLKARMVVM |
| Ga0184619_100713852 | 3300018061 | Groundwater Sediment | LGRTTVKTDLIEIQNIRCTVCQECGQENVGQQVQKKIDTILERAAKGKLKARVVVM |
| Ga0184637_101309822 | 3300018063 | Groundwater Sediment | CQECGHEQIGYQAQGRIDKLVERAAKGKLKDRVVTM |
| Ga0184640_101707292 | 3300018074 | Groundwater Sediment | METDLIEIQNIPCTVCQECGHEQFGQQVQKKIDKLLGRAAKGKLKARMVVM |
| Ga0184609_100630362 | 3300018076 | Groundwater Sediment | VKTNFVEIQNIPCTVCQECGQETVGQQVQKKIDTILERAAKGKLKARVVVM |
| Ga0184633_100079401 | 3300018077 | Groundwater Sediment | EIRNIPCTICQECGHEQIGYQAQGRIDKLVERAAKGKLKDRVVTM |
| Ga0184629_105757301 | 3300018084 | Groundwater Sediment | VQTDLIEIQNIPCTVCQECGQEQIGQRVQKSIDKLLERAGKGKLKSRVVVM |
| Ga0190265_102148482 | 3300018422 | Soil | MIHKDSIEIQNIPCTVCQECGDEQIGQQAQKKVDKLLERAAKGKLKSRFVVM |
| Ga0190265_110657482 | 3300018422 | Soil | LARTTIHTDLIEIQNIPCTVCQECGQEQIGQLVQSKIDKLLERAAKGKLRTRVVVM |
| Ga0066655_100073053 | 3300018431 | Grasslands Soil | MQTDLIEMQNIPCTVCQECGHEQIGQQVQKKIDKLLERAAKGKLKARVVVM |
| Ga0190275_115915612 | 3300018432 | Soil | MIQKNSVEIQNIPCTICHECGHEQIGQQAQKKIDKLLDRGAKGKLKSRLVVM |
| Ga0190275_118529392 | 3300018432 | Soil | MIHNDSVEIQNIPCTVCHECDYEQIGEQAQKKIDKLLERAAKGKLKSRLIVM |
| Ga0066667_105426662 | 3300018433 | Grasslands Soil | MRTELIEIQNIPCTVCQECGLEQIGQQVQKKIDKLLERVAKGKLKARVVVM |
| Ga0190274_139775251 | 3300018476 | Soil | MYLARTTIQSDLIEIQNVPCTVCQECGQEQIGQQVQKKIDKLLERAAKGKLKSRMVVM |
| Ga0066669_106199171 | 3300018482 | Grasslands Soil | MQTDLIEIQNIPCTVCQECGQEQIGQRVQTSIDKLLERAAKGKLKTRVVVM |
| Ga0137408_13324992 | 3300019789 | Vadose Zone Soil | MQTDLIEIQNIPCTVCQECGEEQIGQRVQKNIDKLLERAGKGKLKTRVVVM |
| Ga0193743_10130402 | 3300019889 | Soil | MYLARTTIQADLIEIQNIPCTVCQECGQEQIGQQVQKKIDKLLERAAKGKLKSRLVVM |
| Ga0193739_10616161 | 3300020003 | Soil | MQTDLIEIKNIPSAVCQECGHEQIGQQVQKKIDKLLERAAKGKLNTRVVVM |
| Ga0193717_10785423 | 3300020060 | Soil | MYLARTTIQSELIEIQNVPCTVCQECGQEQIGQQVQKKIDKLLERAAKGKLKSRV |
| Ga0193717_11740132 | 3300020060 | Soil | ELIEIQNVPCTVCQECGQEQIGQQVQKKIDKLLERAAKGKLNGRVVVM |
| Ga0193716_10189603 | 3300020061 | Soil | MYLARTTIQSELIEIQNVPCTVCQECGQEQIGQQVQKKIDKLLERAAKGKLKSRVVVM |
| Ga0126371_100608371 | 3300021560 | Tropical Forest Soil | MKTDLLEIRNVPCTICQECEHEQIGYQAQSRIDKLLERAAKGKLRDRVVTM |
| Ga0209824_100023516 | 3300025173 | Wastewater | MQTDLIEIQNIPCTVCQECGQEQIGQQVQKNIDKLLERAGKGKLKTRVVVM |
| Ga0210114_10242741 | 3300025795 | Natural And Restored Wetlands | MQSDLIEIQNIPCTVCQECGQEQIGQRVQKSIDKLVERAGKGKLKTRVVVM |
| Ga0210113_10980682 | 3300025796 | Natural And Restored Wetlands | MQTDLIEIQNIPCTVCQECGQEQIGQRVQKSIDKLVERAGKGKLKTRVVVM |
| Ga0207647_105998811 | 3300025904 | Corn Rhizosphere | VDIIEIQNIPCTVCEECGQEEIGQRVQKSIDKVLERAGKGKLKTRIVVM |
| Ga0207684_111191542 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MYLARTTIQTDLIEIQNIPCTVCQECGQEQIGQQAQKKIDKLLERAVKGKLKSRVVVM |
| Ga0207650_111006801 | 3300025925 | Switchgrass Rhizosphere | RNVPCTICQECDQEQIGYQAQSRIDKLLERAAKGKLKDRVVTM |
| Ga0207701_100645342 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MEIQNIPCTICHECGYEQIGQQAQKKIDKLLERAAKGKLKSRLVVM |
| Ga0207706_116053151 | 3300025933 | Corn Rhizosphere | MIHKDSMEIQNIPCTICHECGYEQIGQQAQKKIDKLLERAAKGKLKSRLVVM |
| Ga0207712_109491141 | 3300025961 | Switchgrass Rhizosphere | LARTTIRNDLLEIQNILCTVCQECGQEQIAQTVQKKIDKILDRAAKGKLKTHVVVM |
| Ga0207668_121691441 | 3300025972 | Switchgrass Rhizosphere | THIGRTIIQTDIIEIQNIPCTVCEECGQEEIGQRVQKSIDKVLERAGKGKLKTRIVVM |
| Ga0208780_10263411 | 3300026046 | Natural And Restored Wetlands | MQTDLIEIQNIPCTVCQECGQEQIGQRVQKSIDKLVERAGKRKLKNRVVVM |
| Ga0207648_111091722 | 3300026089 | Miscanthus Rhizosphere | LARTTIRTDLLEIQNILCTVCQECGQEQIAQTVQKKIDKILDRAAKGKLKTHVVVM |
| Ga0209438_10528211 | 3300026285 | Grasslands Soil | VCQECGQEQIAQTVQKKIDKILDRAAKGKLKTYVVVM |
| Ga0209686_10651971 | 3300026315 | Soil | MQTDLIEMQNIPCTVCQECGHEQIGQQVQKKIDKLLERAVKGKLKARVVVM |
| Ga0209472_10890922 | 3300026323 | Soil | MQTELIEIQNIPCTVCQECGLEQIGQQVQKKIDKLLERVAKGKLKARVVVM |
| Ga0209684_10292271 | 3300027527 | Tropical Forest Soil | LLEIRNVPCTICQECEHEQIGYQAQSRIDKLLERAAKGKLRDRVVTM |
| Ga0272482_103184121 | 3300028578 | Soil | MHKDSLEIQNIPCTICHECGYEQIGQQAQKKLDKLFERAAKGKLKSRLVVM |
| Ga0307302_101524993 | 3300028814 | Soil | CTVCQECGQETVGQQVQKKIDTILERAAKGKLKARVVVM |
| Ga0299907_100593064 | 3300030006 | Soil | MQTDLIEIQNIACTVCQECGLEQIGQQVQKKIDKLLERAAKGKLKTRVVVM |
| Ga0299906_104100381 | 3300030606 | Soil | MTMQTDLIEIQNIPCTVCQECGQEQIGQQVQKQIDKLLERAAKGKLKARVVVM |
| Ga0299913_115308652 | 3300031229 | Soil | MQTVLLDIQNIPCTVCQECGNEQIGQQVQKKIDKLLERASKGKLKERMVVM |
| Ga0307408_1000725743 | 3300031548 | Rhizosphere | MEIQNIPCTICHECGYEQIGQQAQKKIDKLLERAAKGKLRSRLVVM |
| Ga0307408_1004393242 | 3300031548 | Rhizosphere | MHKDSMEIQNIPCTVCHECGYEQIGQQAQKKIDKLLERAAKEKLKSRLVVM |
| Ga0307408_1004927931 | 3300031548 | Rhizosphere | LEIRNVPCTLCQECDHEQIGSQAQSRIDKLVERAAKGKLKDRVVTL |
| Ga0307469_108145711 | 3300031720 | Hardwood Forest Soil | TYLARTTIRNDLLEIQNILCTVCQECGQEQIAQTVQKKIDKILDRAAKGKLKTYVVVM |
| Ga0307405_108487382 | 3300031731 | Rhizosphere | MEIQNIPCTICHECGYEQIGQQAQKKIDKLLERAAKEKLKSRLVVM |
| Ga0307410_104291282 | 3300031852 | Rhizosphere | MHKDSMEIQNISCTVCHECGYEQIGQQAQKKIDKLLERAAKEKLKSRLVVM |
| Ga0307406_109766101 | 3300031901 | Rhizosphere | TDSMEIQNIPCTICHECGYEQIGQQAQKKIDKLLERAAKGKLRSRLVVM |
| Ga0307407_103566511 | 3300031903 | Rhizosphere | MHKDSMEIQNIPCTVCHECGYEQIGQQAQKKIDKLLERAAKGKLRSRLVVM |
| Ga0306926_117130501 | 3300031954 | Soil | LLEIRNVPCTICQECDHEQIGYQAQRRIDKLVERAAKGELKDRVVTM |
| Ga0315910_107862512 | 3300032144 | Soil | MIQTDLLEIQNVPCTVCQECGQEQIAQLVQRQIDKLLERAAKGKLKSRVVVM |
| Ga0307471_1027403711 | 3300032180 | Hardwood Forest Soil | MGDPRLLPQTDLLEIRNVPCTICQECEHEQIGYQAQSKIDKLLERAARGKLRDRVVTM |
| Ga0335084_102301461 | 3300033004 | Soil | TTIQTDLLEIRNVPCTICQECGHEQIGYQAQSRIDKLVERVAKGKLKERVVTM |
| ⦗Top⦘ |