


| Basic Information | |
|---|---|
| Family ID | F040568 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 161 |
| Average Sequence Length | 46 residues |
| Representative Sequence | RAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFAG |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 161 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.62 % |
| % of genes near scaffold ends (potentially truncated) | 96.89 % |
| % of genes from short scaffolds (< 2000 bps) | 86.96 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.758 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (33.540 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.248 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.354 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.29% β-sheet: 0.00% Coil/Unstructured: 76.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 161 Family Scaffolds |
|---|---|---|
| PF00149 | Metallophos | 18.01 |
| PF04480 | DUF559 | 15.53 |
| PF10518 | TAT_signal | 11.80 |
| PF01797 | Y1_Tnp | 10.56 |
| PF04185 | Phosphoesterase | 10.56 |
| PF10604 | Polyketide_cyc2 | 6.21 |
| PF12850 | Metallophos_2 | 2.48 |
| PF02954 | HTH_8 | 1.24 |
| PF00990 | GGDEF | 1.24 |
| PF02585 | PIG-L | 0.62 |
| PF00072 | Response_reg | 0.62 |
| PF02371 | Transposase_20 | 0.62 |
| PF02368 | Big_2 | 0.62 |
| PF13522 | GATase_6 | 0.62 |
| PF09134 | Invasin_D3 | 0.62 |
| PF00158 | Sigma54_activat | 0.62 |
| PF02518 | HATPase_c | 0.62 |
| PF04402 | SIMPL | 0.62 |
| PF01380 | SIS | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 161 Family Scaffolds |
|---|---|---|---|
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 10.56 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 10.56 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.62 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.62 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.62 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.76 % |
| Unclassified | root | N/A | 1.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10020092 | All Organisms → cellular organisms → Bacteria | 2385 | Open in IMG/M |
| 3300002561|JGI25384J37096_10033612 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
| 3300002561|JGI25384J37096_10119319 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 887 | Open in IMG/M |
| 3300002561|JGI25384J37096_10137019 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 799 | Open in IMG/M |
| 3300002562|JGI25382J37095_10230763 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300002908|JGI25382J43887_10034199 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2752 | Open in IMG/M |
| 3300002908|JGI25382J43887_10061188 | All Organisms → cellular organisms → Bacteria | 2039 | Open in IMG/M |
| 3300002908|JGI25382J43887_10350569 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 626 | Open in IMG/M |
| 3300005166|Ga0066674_10229587 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 882 | Open in IMG/M |
| 3300005166|Ga0066674_10308617 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 743 | Open in IMG/M |
| 3300005171|Ga0066677_10127785 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1373 | Open in IMG/M |
| 3300005171|Ga0066677_10497207 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 700 | Open in IMG/M |
| 3300005174|Ga0066680_10190539 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1294 | Open in IMG/M |
| 3300005174|Ga0066680_10244978 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1138 | Open in IMG/M |
| 3300005176|Ga0066679_10416819 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 879 | Open in IMG/M |
| 3300005177|Ga0066690_10674827 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 686 | Open in IMG/M |
| 3300005178|Ga0066688_10279334 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1074 | Open in IMG/M |
| 3300005179|Ga0066684_10204098 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1279 | Open in IMG/M |
| 3300005180|Ga0066685_10392154 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 964 | Open in IMG/M |
| 3300005181|Ga0066678_10179297 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300005181|Ga0066678_10212753 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1238 | Open in IMG/M |
| 3300005187|Ga0066675_10638259 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23 | 800 | Open in IMG/M |
| 3300005187|Ga0066675_10728087 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 746 | Open in IMG/M |
| 3300005406|Ga0070703_10113419 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 973 | Open in IMG/M |
| 3300005440|Ga0070705_100801036 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 749 | Open in IMG/M |
| 3300005445|Ga0070708_100801254 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 885 | Open in IMG/M |
| 3300005445|Ga0070708_100825065 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300005445|Ga0070708_101182592 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 715 | Open in IMG/M |
| 3300005446|Ga0066686_10080985 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2056 | Open in IMG/M |
| 3300005447|Ga0066689_10437580 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23 | 819 | Open in IMG/M |
| 3300005450|Ga0066682_10397611 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 883 | Open in IMG/M |
| 3300005468|Ga0070707_101581693 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 622 | Open in IMG/M |
| 3300005468|Ga0070707_101785588 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 582 | Open in IMG/M |
| 3300005540|Ga0066697_10624685 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 595 | Open in IMG/M |
| 3300005546|Ga0070696_100704237 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 823 | Open in IMG/M |
| 3300005546|Ga0070696_100769070 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 790 | Open in IMG/M |
| 3300005546|Ga0070696_100835660 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 760 | Open in IMG/M |
| 3300005553|Ga0066695_10352911 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 921 | Open in IMG/M |
| 3300005553|Ga0066695_10473173 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23 | 772 | Open in IMG/M |
| 3300005555|Ga0066692_11011152 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 508 | Open in IMG/M |
| 3300005556|Ga0066707_10561658 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 734 | Open in IMG/M |
| 3300005556|Ga0066707_10803119 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005557|Ga0066704_10917411 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 541 | Open in IMG/M |
| 3300005574|Ga0066694_10327922 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 727 | Open in IMG/M |
| 3300005576|Ga0066708_10276967 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1071 | Open in IMG/M |
| 3300005586|Ga0066691_10696670 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 601 | Open in IMG/M |
| 3300005586|Ga0066691_10855419 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 535 | Open in IMG/M |
| 3300006031|Ga0066651_10003628 | All Organisms → cellular organisms → Bacteria | 5697 | Open in IMG/M |
| 3300006032|Ga0066696_10378347 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 923 | Open in IMG/M |
| 3300006032|Ga0066696_11071420 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006034|Ga0066656_10588776 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 720 | Open in IMG/M |
| 3300006755|Ga0079222_12058300 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 563 | Open in IMG/M |
| 3300006796|Ga0066665_10202654 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1541 | Open in IMG/M |
| 3300006796|Ga0066665_10647331 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 842 | Open in IMG/M |
| 3300006797|Ga0066659_10283097 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300006797|Ga0066659_10830522 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 767 | Open in IMG/M |
| 3300006806|Ga0079220_11077213 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 648 | Open in IMG/M |
| 3300006903|Ga0075426_10140815 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1738 | Open in IMG/M |
| 3300006903|Ga0075426_10992927 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 634 | Open in IMG/M |
| 3300007255|Ga0099791_10213829 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 910 | Open in IMG/M |
| 3300007265|Ga0099794_10537156 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 617 | Open in IMG/M |
| 3300009012|Ga0066710_101625970 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 988 | Open in IMG/M |
| 3300009089|Ga0099828_11770855 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 543 | Open in IMG/M |
| 3300009090|Ga0099827_11126688 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 681 | Open in IMG/M |
| 3300009147|Ga0114129_11365614 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 876 | Open in IMG/M |
| 3300009162|Ga0075423_10002192 | All Organisms → cellular organisms → Bacteria | 17609 | Open in IMG/M |
| 3300009795|Ga0105059_1048456 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 560 | Open in IMG/M |
| 3300010106|Ga0127472_1099466 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300010301|Ga0134070_10107736 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 975 | Open in IMG/M |
| 3300010301|Ga0134070_10373459 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23 | 557 | Open in IMG/M |
| 3300010320|Ga0134109_10092930 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1043 | Open in IMG/M |
| 3300010321|Ga0134067_10059780 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300010323|Ga0134086_10172402 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 798 | Open in IMG/M |
| 3300010329|Ga0134111_10160247 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300010333|Ga0134080_10657336 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 516 | Open in IMG/M |
| 3300010335|Ga0134063_10114764 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1230 | Open in IMG/M |
| 3300010337|Ga0134062_10546962 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012198|Ga0137364_11062169 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 610 | Open in IMG/M |
| 3300012198|Ga0137364_11125996 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 590 | Open in IMG/M |
| 3300012199|Ga0137383_10375162 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1042 | Open in IMG/M |
| 3300012199|Ga0137383_10395289 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300012199|Ga0137383_10405909 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 998 | Open in IMG/M |
| 3300012199|Ga0137383_10673899 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 756 | Open in IMG/M |
| 3300012203|Ga0137399_10432898 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1099 | Open in IMG/M |
| 3300012203|Ga0137399_11782692 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
| 3300012206|Ga0137380_10711452 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 871 | Open in IMG/M |
| 3300012207|Ga0137381_10422895 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1163 | Open in IMG/M |
| 3300012207|Ga0137381_10796310 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 819 | Open in IMG/M |
| 3300012207|Ga0137381_11059084 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 698 | Open in IMG/M |
| 3300012211|Ga0137377_10673645 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 970 | Open in IMG/M |
| 3300012211|Ga0137377_11203611 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 687 | Open in IMG/M |
| 3300012285|Ga0137370_10005281 | All Organisms → cellular organisms → Bacteria | 5855 | Open in IMG/M |
| 3300012349|Ga0137387_11153546 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 549 | Open in IMG/M |
| 3300012356|Ga0137371_11149925 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 581 | Open in IMG/M |
| 3300012359|Ga0137385_10962258 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 705 | Open in IMG/M |
| 3300012360|Ga0137375_10436554 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1133 | Open in IMG/M |
| 3300012582|Ga0137358_10010797 | All Organisms → cellular organisms → Bacteria | 5680 | Open in IMG/M |
| 3300012685|Ga0137397_10446246 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 964 | Open in IMG/M |
| 3300012918|Ga0137396_10718975 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 736 | Open in IMG/M |
| 3300012918|Ga0137396_10939717 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 631 | Open in IMG/M |
| 3300012922|Ga0137394_11552982 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 520 | Open in IMG/M |
| 3300012925|Ga0137419_10775355 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 783 | Open in IMG/M |
| 3300012925|Ga0137419_10805855 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 768 | Open in IMG/M |
| 3300012929|Ga0137404_10086427 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2498 | Open in IMG/M |
| 3300012929|Ga0137404_11761375 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 576 | Open in IMG/M |
| 3300012931|Ga0153915_12254901 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 637 | Open in IMG/M |
| 3300012972|Ga0134077_10034256 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300012972|Ga0134077_10046662 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
| 3300012975|Ga0134110_10185432 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 869 | Open in IMG/M |
| 3300012977|Ga0134087_10078663 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300015054|Ga0137420_1310643 | All Organisms → cellular organisms → Bacteria | 2998 | Open in IMG/M |
| 3300015241|Ga0137418_10016040 | All Organisms → cellular organisms → Bacteria | 6921 | Open in IMG/M |
| 3300015264|Ga0137403_10745218 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 838 | Open in IMG/M |
| 3300015359|Ga0134085_10316880 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 688 | Open in IMG/M |
| 3300017654|Ga0134069_1381037 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300017659|Ga0134083_10030903 | All Organisms → cellular organisms → Bacteria | 1952 | Open in IMG/M |
| 3300018431|Ga0066655_10046013 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2222 | Open in IMG/M |
| 3300018431|Ga0066655_10634177 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 722 | Open in IMG/M |
| 3300018433|Ga0066667_10407547 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1100 | Open in IMG/M |
| 3300018433|Ga0066667_11739818 | Not Available | 561 | Open in IMG/M |
| 3300018433|Ga0066667_11852844 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300018468|Ga0066662_11371062 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 730 | Open in IMG/M |
| 3300018482|Ga0066669_10745641 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 864 | Open in IMG/M |
| 3300018482|Ga0066669_10999729 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 754 | Open in IMG/M |
| 3300020004|Ga0193755_1000131 | All Organisms → cellular organisms → Bacteria | 20683 | Open in IMG/M |
| 3300025898|Ga0207692_10787445 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 621 | Open in IMG/M |
| 3300025922|Ga0207646_11501833 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 583 | Open in IMG/M |
| 3300025922|Ga0207646_11539592 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 575 | Open in IMG/M |
| 3300026296|Ga0209235_1195977 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 714 | Open in IMG/M |
| 3300026297|Ga0209237_1109419 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1192 | Open in IMG/M |
| 3300026298|Ga0209236_1008620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6065 | Open in IMG/M |
| 3300026300|Ga0209027_1225998 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300026301|Ga0209238_1226826 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 551 | Open in IMG/M |
| 3300026301|Ga0209238_1270162 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 510 | Open in IMG/M |
| 3300026307|Ga0209469_1018407 | All Organisms → cellular organisms → Bacteria | 2486 | Open in IMG/M |
| 3300026310|Ga0209239_1292902 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300026313|Ga0209761_1235100 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 748 | Open in IMG/M |
| 3300026318|Ga0209471_1144382 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 990 | Open in IMG/M |
| 3300026324|Ga0209470_1011697 | All Organisms → cellular organisms → Bacteria | 5171 | Open in IMG/M |
| 3300026325|Ga0209152_10483968 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23 | 507 | Open in IMG/M |
| 3300026326|Ga0209801_1146467 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 998 | Open in IMG/M |
| 3300026329|Ga0209375_1065872 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1736 | Open in IMG/M |
| 3300026332|Ga0209803_1105972 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1143 | Open in IMG/M |
| 3300026333|Ga0209158_1148414 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 859 | Open in IMG/M |
| 3300026334|Ga0209377_1175398 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 762 | Open in IMG/M |
| 3300026334|Ga0209377_1199474 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300026342|Ga0209057_1058595 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
| 3300026343|Ga0209159_1023056 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3460 | Open in IMG/M |
| 3300026529|Ga0209806_1003386 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 9502 | Open in IMG/M |
| 3300026529|Ga0209806_1074238 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1521 | Open in IMG/M |
| 3300026537|Ga0209157_1286830 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 610 | Open in IMG/M |
| 3300026538|Ga0209056_10341236 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 993 | Open in IMG/M |
| 3300026547|Ga0209156_10019443 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4114 | Open in IMG/M |
| 3300026547|Ga0209156_10453419 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300027725|Ga0209178_1212430 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 688 | Open in IMG/M |
| 3300027748|Ga0209689_1026327 | All Organisms → cellular organisms → Bacteria | 3515 | Open in IMG/M |
| 3300027846|Ga0209180_10418430 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 758 | Open in IMG/M |
| 3300027903|Ga0209488_10794638 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 671 | Open in IMG/M |
| 3300031590|Ga0307483_1023623 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 615 | Open in IMG/M |
| 3300032180|Ga0307471_100620973 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1241 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 33.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 16.15% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.07% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.86% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.24% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.24% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300010106 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_100200921 | 3300002558 | Grasslands Soil | ATPGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG* |
| JGI25384J37096_100336123 | 3300002561 | Grasslands Soil | LRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG* |
| JGI25384J37096_101193192 | 3300002561 | Grasslands Soil | PPLRAGYDAVGNTRYTPIEPKNLLARATSALRLAKGEAAANWIRAFDA* |
| JGI25384J37096_101370191 | 3300002561 | Grasslands Soil | TPGLRAGYDAVGNARYTPIEPKNLLSRATTALRTAKGQGGPNWIQGFNS* |
| JGI25382J37095_102307632 | 3300002562 | Grasslands Soil | VKTLTGATPGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG* |
| JGI25382J43887_100341991 | 3300002908 | Grasslands Soil | TPGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGXAG* |
| JGI25382J43887_100611881 | 3300002908 | Grasslands Soil | VPGLRVGYDAVSNARYTPIEPKNLLARATTALRAAKAQGGPNWIQGFAG* |
| JGI25382J43887_100905103 | 3300002908 | Grasslands Soil | LARGVKTLTGATPGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG |
| JGI25382J43887_103505692 | 3300002908 | Grasslands Soil | PADGAPPLRVGYDAVGNTRYTPVEPKNLLSRATSALRIAKTEAAANWIRGYEQA* |
| Ga0066674_102295872 | 3300005166 | Soil | GLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG* |
| Ga0066674_103086171 | 3300005166 | Soil | GLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFNS* |
| Ga0066677_101277852 | 3300005171 | Soil | GLRAGYDAVGNARYTPIEPKNLLARATTALRTAKGQGGPGWIQGFT* |
| Ga0066677_104972072 | 3300005171 | Soil | GLRAGYDAVGNARYTPIEPKNLLARATTALRTAKGQGGPGWIQGFRG* |
| Ga0066680_101905391 | 3300005174 | Soil | KTLTGATPGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG* |
| Ga0066680_102449783 | 3300005174 | Soil | RPSLRAGYDAVANARYAAVEPRNLLTRATSALRAAKGMGAPNWIQAFRG* |
| Ga0066679_104168191 | 3300005176 | Soil | RAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG* |
| Ga0066690_106748271 | 3300005177 | Soil | AVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFNS* |
| Ga0066688_102793342 | 3300005178 | Soil | VGNTRYTPVEPKNLLSRATSALRIAKTEAAANWIRGYEQA* |
| Ga0066684_102040981 | 3300005179 | Soil | AGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFNS* |
| Ga0066685_103921541 | 3300005180 | Soil | GATPGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQSGPNWIQGFGG* |
| Ga0066678_101792973 | 3300005181 | Soil | GLRAGYDAVTNARYTPIEPKNLLGRATSALRVAKTDGGGAGWIRAFQ* |
| Ga0066678_102127533 | 3300005181 | Soil | VGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG* |
| Ga0066675_106382592 | 3300005187 | Soil | GNTRYTPVEPKNLLARATSALRLAKGDAAANWIRAFDAA* |
| Ga0066675_107280871 | 3300005187 | Soil | RAGYDAVGNARYTPIEPKNLLARATTALRTAKGQGGPGWIQGFRG* |
| Ga0070703_101134193 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | GIATAAGDERPSLRAGYDAVANARYAAIEPRNLLTRATSALRAAKGMGAPNWIQAFRG* |
| Ga0070705_1008010361 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | SESGTPGPGLRAGYDAVGNARYTPIEPKNLLARATTALRAAKGRGGPDWIQGFTLTP* |
| Ga0070708_1008012542 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GYDAVGNARYTPIEPKNLLARATTALRAAKGQGGPNWIQGFTG* |
| Ga0070708_1008250651 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GNARYTPIEPKNLLARATTALRAAKGRGGPDWIQGFTLTP* |
| Ga0070708_1011825922 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GVKTLAGATPGLRAGYDAVGNARYTPIEPKNLLARATTALRAAKGQGGLNWIQGFGG* |
| Ga0066686_100809851 | 3300005446 | Soil | YDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYTLTP* |
| Ga0066689_104375802 | 3300005447 | Soil | RAGYDAVGNTRYTPVEPKNLLARATSALRLAKGEAGANWIRAFDAA* |
| Ga0066682_103976112 | 3300005450 | Soil | VGNARYTPIEPKHLLARATSALRTAKGQGGPEWIQGFQG* |
| Ga0070707_1015816931 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AGATPGLRAGYDAVGNVRYTPIEPKNLLARATTALRAAKGQGGLNWIQGFGG* |
| Ga0070707_1017855882 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | YDAVANARYAAVEPRNLLTRATSALRAAKGMGAPNWIQAFRG* |
| Ga0066697_106246852 | 3300005540 | Soil | VGNARYTPIEPKNLLARATTALRTAKGQGGPGWIQGCT* |
| Ga0070696_1007042372 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | DAVGNARYTPIEPKNLLARATTALRAAKGRGGPDWIQGFTG* |
| Ga0070696_1007690703 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | DAVGNARYTPIEPKNLLARATTALRAAKGRGGPDWIQGFTLTP* |
| Ga0070696_1008356601 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | AAGDERPSLRAGYDAVANARYAAVEPRNLLTRATSALRAAKGMGAPNWIQAFRG* |
| Ga0066695_103529112 | 3300005553 | Soil | DAVGNTRYTPVEPKNLLSRATSALRIAKTEAAANWIRGYEQA* |
| Ga0066695_104731732 | 3300005553 | Soil | EPPALRAGYDAVGNTRYTPVEPKNLLARATSALRLAKGDAAANWIRAFDAA* |
| Ga0066692_110111521 | 3300005555 | Soil | VGNTRYTPVEPKNLLSRATSALRIAKTEAAANWIRAYEQA* |
| Ga0066707_105616582 | 3300005556 | Soil | RAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFNS* |
| Ga0066707_108031191 | 3300005556 | Soil | KTLTGATPGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFNS* |
| Ga0066704_109174111 | 3300005557 | Soil | TGATPGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG* |
| Ga0066694_103279222 | 3300005574 | Soil | GYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG* |
| Ga0066708_102769671 | 3300005576 | Soil | DAVGNARYTPIEPKNLLARATTALRAAKGLGGPDWIQGFTG* |
| Ga0066691_106966701 | 3300005586 | Soil | RAGYDAVANARYAAVEPRNLLTRATSALRAAKGMGAPNWIQAFRG* |
| Ga0066691_108554192 | 3300005586 | Soil | GNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG* |
| Ga0066651_100036288 | 3300006031 | Soil | RYTPIEPKNLLARATTALRTAKGQGGPGWIQGFT* |
| Ga0066696_103783471 | 3300006032 | Soil | RYTPIEPKNLLARATTALRTAKGQGGPGWIQGFRG* |
| Ga0066696_110714201 | 3300006032 | Soil | NARYTPIEPKNLLGRATSALRVAKTDGGGAGWIRAFQ* |
| Ga0066656_105887761 | 3300006034 | Soil | YDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFNS* |
| Ga0079222_120583001 | 3300006755 | Agricultural Soil | ARYAAVEPKNLLARATSALRAAKGMGTPNWIQPFRE* |
| Ga0066665_102026543 | 3300006796 | Soil | GNARYTPIEPKNLLARATTALRAAKGQGGPNWIEGFRG* |
| Ga0066665_106473312 | 3300006796 | Soil | TLAGATPGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFNS* |
| Ga0066659_102830971 | 3300006797 | Soil | DAVGNVRYTPIEPKNLLARATTGLRAAKGKGGPNWIQGFTLTP* |
| Ga0066659_108305221 | 3300006797 | Soil | TNARYTPIEPKNLLGRATSALRVAKTDAGLGWIRAFQ* |
| Ga0079220_110772131 | 3300006806 | Agricultural Soil | SAAPGARPSLRAGYDAVANARYTPVEPKKMLARATSALRNAKGLGGPNWIQAFRG* |
| Ga0075426_101408151 | 3300006903 | Populus Rhizosphere | RLARGIATAAGDERPSLRAGYDAVSNARYAAVEPRNLLTRATSALRAAKGMGAPNWIQAFRG* |
| Ga0075426_109929271 | 3300006903 | Populus Rhizosphere | RAGYDAVGNARYTPIEPKNLLARATTALRAAKGQGGLNWIQGFGG* |
| Ga0099791_102138292 | 3300007255 | Vadose Zone Soil | PGLRAGYDAVGNARYTPIEPKNLLARATTALRAAKGQGGPNWIQGFTG* |
| Ga0099794_105371562 | 3300007265 | Vadose Zone Soil | NARYTPIEPKNLLARATTALRAAKAQGGPNWIQGFAG* |
| Ga0066710_1016259702 | 3300009012 | Grasslands Soil | GYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG |
| Ga0099828_117708551 | 3300009089 | Vadose Zone Soil | YDAVGNARYTPIEPKNLLARATTALRAAKGQGGLNWIQGFAG* |
| Ga0099827_111266882 | 3300009090 | Vadose Zone Soil | DAVGNARYTPIEPKNLLARATTALRAAKGQGGPNWIQGFGG* |
| Ga0114129_113656141 | 3300009147 | Populus Rhizosphere | DAVGNARYTPIEPKNLLARATTALRAAKGQGGLNWIQGFGG* |
| Ga0075423_100021921 | 3300009162 | Populus Rhizosphere | PGLRVGYDAVGNARYTPIEPKNLLARATTALRAAKGQGAPNWIQGFTG* |
| Ga0105059_10484562 | 3300009795 | Groundwater Sand | GGAPARSLRAGYDAVGNARYTPIEPKNLLARATTALRAAKGQGAPNWIQGFGG* |
| Ga0127472_10994663 | 3300010106 | Grasslands Soil | LRAGYDAVANARYTPIEPKNLLGRATSALRVAKTDGGGAGWIRAFQ* |
| Ga0134070_101077361 | 3300010301 | Grasslands Soil | NARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYALTP* |
| Ga0134070_103734592 | 3300010301 | Grasslands Soil | ALRAGYDAVGNTRYTPVEPKNLLARATSALRIAKGEAGANWIRAFDAA* |
| Ga0134109_100929301 | 3300010320 | Grasslands Soil | EAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFNS* |
| Ga0134067_100597803 | 3300010321 | Grasslands Soil | YDAVTNARYTPIEPKNLLGRATSALRVAKTDGGGPGWIREFR* |
| Ga0134086_101724022 | 3300010323 | Grasslands Soil | LAGATPGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYALTP* |
| Ga0134111_101602472 | 3300010329 | Grasslands Soil | YDAVGKTRYTPVEPKNLLARAASALRLAKSEAATNWIRAFDA* |
| Ga0134080_106573361 | 3300010333 | Grasslands Soil | YDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFAG* |
| Ga0134063_101147642 | 3300010335 | Grasslands Soil | ARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFNS* |
| Ga0134062_105469621 | 3300010337 | Grasslands Soil | DAVGNARYTPIEPKNLLARATTALRAAKGLGGPNWIQGFSA* |
| Ga0137364_110621691 | 3300012198 | Vadose Zone Soil | DAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFDS* |
| Ga0137364_111259961 | 3300012198 | Vadose Zone Soil | RQDGDTPAPGLRAGYDEVGNARYTQIEPKNLLARATTALRTAKGQGGPGWIQGFTG* |
| Ga0137383_103751622 | 3300012199 | Vadose Zone Soil | YDAVGNARYTPIEPKNLLARATTALRAAKGLGGPNWIQGFSA* |
| Ga0137383_103952892 | 3300012199 | Vadose Zone Soil | AVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFAG* |
| Ga0137383_104059094 | 3300012199 | Vadose Zone Soil | YDAVGNARYTPIEPKNLLARATTALRAAKGLGGPNWIQGFTA* |
| Ga0137383_106738992 | 3300012199 | Vadose Zone Soil | RYTPIEPKNLLARATTALRAAKGKGGPNWIQGFTLTP* |
| Ga0137399_104328983 | 3300012203 | Vadose Zone Soil | SNARYTPIEPKNLLARATTALRAAKGQGGPNWIQGFTG* |
| Ga0137399_117826921 | 3300012203 | Vadose Zone Soil | AGESAPGLRAGYDAVGNARYTPIEPKNLLARATTALRAAKGQGGPNWIQGFGG* |
| Ga0137380_107114521 | 3300012206 | Vadose Zone Soil | VGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFALTP* |
| Ga0137381_104228951 | 3300012207 | Vadose Zone Soil | GNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFAG* |
| Ga0137381_107963101 | 3300012207 | Vadose Zone Soil | PGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFALTP* |
| Ga0137381_110590841 | 3300012207 | Vadose Zone Soil | VKTLAGATPGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG* |
| Ga0137377_106736453 | 3300012211 | Vadose Zone Soil | VGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYALTP* |
| Ga0137377_112036111 | 3300012211 | Vadose Zone Soil | ATPGLRAGYDAVGNARYTPIEPKNLLSRATTALRTAKGQGGPNWIQGFNS* |
| Ga0137370_100052817 | 3300012285 | Vadose Zone Soil | VPDLRAGYDAVGNARYTPIEPKNLLARAATALRAAKGLGGPDWIQGFTG* |
| Ga0137387_111535461 | 3300012349 | Vadose Zone Soil | TPGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFAG* |
| Ga0137371_111499252 | 3300012356 | Vadose Zone Soil | AVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG* |
| Ga0137385_109622581 | 3300012359 | Vadose Zone Soil | TPGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG* |
| Ga0137375_104365541 | 3300012360 | Vadose Zone Soil | GYDAVGNARYTPIEPKNLLARATTALRAAKGQGAPNWIQGFTG* |
| Ga0137358_100107976 | 3300012582 | Vadose Zone Soil | LRAGYDAVGNVRYTPIEPKNLLARATTALRAAKVQGGPNWIQGFTLTP* |
| Ga0137397_104462461 | 3300012685 | Vadose Zone Soil | NARYMPIEPKNLLARATTALRAAKGQGAPNWIQGFEG* |
| Ga0137396_107189751 | 3300012918 | Vadose Zone Soil | RYTPIEPKNLLARATTALRAAKGQGAPNWIQGFGG* |
| Ga0137396_109397172 | 3300012918 | Vadose Zone Soil | YTPIEPKNLLARATTALRAAKGLGGPNWIQGFTG* |
| Ga0137394_115529822 | 3300012922 | Vadose Zone Soil | VGNARYTPIEPKNLLARAATALRAAKGQGAPNWIQGFAG* |
| Ga0137419_107753552 | 3300012925 | Vadose Zone Soil | DAVGNVRYTPIEPKNLLARATTALRAAKGQGGPNWIQGFTLTP* |
| Ga0137419_108058551 | 3300012925 | Vadose Zone Soil | RAVARASGDAAPAPGLRAGYDAVGNARYTPIEPKNLLARATTALRAAKGQGAPNWIQGFGG* |
| Ga0137404_100864271 | 3300012929 | Vadose Zone Soil | SGESAPGLRAGYDAVGNVRYTPIEPKNLLARATTALRAAKGQGGPNWIQGFTLTP* |
| Ga0137404_117613751 | 3300012929 | Vadose Zone Soil | PIEPKNLLARATTALRAAKGQGGPNWIQGFTLTP* |
| Ga0153915_122549011 | 3300012931 | Freshwater Wetlands | RPSLRAGYDAVANARYTPVEPKKMLARATTALRTAKGMGGPNWIQAFRG* |
| Ga0134077_100342563 | 3300012972 | Grasslands Soil | YDAVGNTRYTPVEPKHLLARATSALRLAKGDATANWIRAFDA* |
| Ga0134077_100466621 | 3300012972 | Grasslands Soil | VPGLRVGYDAVSNARYTPIEPKNLLARATTALRAAKAQGEPNWIQGFAG* |
| Ga0134110_101854322 | 3300012975 | Grasslands Soil | RAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQSGPNWIQGFGG* |
| Ga0134087_100786631 | 3300012977 | Grasslands Soil | PLRAGYDAVGNTRYTPVEPKHLLARATSALRLAKGDAAANWIRAFDG* |
| Ga0137420_13106431 | 3300015054 | Vadose Zone Soil | VPGLRAGYDAVSNARYTPIEPKNLLARATTALRAAKGQGGPNWIPGFAG* |
| Ga0137418_100160405 | 3300015241 | Vadose Zone Soil | LRAGYDAVGNTRYTPVEPKNLLARATSALRLAKGEAAANWIRAFDAA* |
| Ga0137403_107452181 | 3300015264 | Vadose Zone Soil | DGHARVPGLRVGYDAVSNARYTPIEPKNLLARATTALRAAKAQGGPNWIQGFAG* |
| Ga0134085_103168802 | 3300015359 | Grasslands Soil | RAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFAG* |
| Ga0134069_13810372 | 3300017654 | Grasslands Soil | GYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFNS |
| Ga0134083_100309033 | 3300017659 | Grasslands Soil | APPLRAGYDAVGNTRYTPVEPKHLLARATSALRLAKGDAAANWIRAFDG |
| Ga0066655_100460135 | 3300018431 | Grasslands Soil | RAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYTLTP |
| Ga0066655_106341772 | 3300018431 | Grasslands Soil | GGTPAPGLRAGYDAVGNARYTPIEPKNLLARASTALRAAKGQGGPNWIEGVRV |
| Ga0066667_104075471 | 3300018433 | Grasslands Soil | GYDAVGNARYTPIEPKNLLSRATTALRAAKGQSVPNWIQGFGG |
| Ga0066667_117398181 | 3300018433 | Grasslands Soil | NTRYTPVEPKHLLARATSALRLAKGDAAANWIRAFDG |
| Ga0066667_118528441 | 3300018433 | Grasslands Soil | AVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFNS |
| Ga0066662_113710623 | 3300018468 | Grasslands Soil | ATPGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG |
| Ga0066669_107456411 | 3300018482 | Grasslands Soil | PVPGLRAGYDAVGNARYTPIEPKNLLARATTALRTAKGQGGPGWIQGCT |
| Ga0066669_109997292 | 3300018482 | Grasslands Soil | RYTPIEPKNLLARATTALRAAKGLGGPNWIQGFSG |
| Ga0193755_10001311 | 3300020004 | Soil | RYTPIEPKNLLARATTALRAAKGQGGPNWIQGFTLTP |
| Ga0207692_107874452 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | PICAERLARGIATAAGDERPSLRAGYDAVANARYAAVEPRNLLTRATSALRAAKGMGAPNWIQAFRG |
| Ga0207646_115018332 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | YDAVANARYAAVEPRNLLTRATSALRAAKGMGAPNWIQAFRG |
| Ga0207646_115395921 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GVKTLAGATPGLRAGYDAVGNARYTPIEPKNLLARATTALRAAKGQGGVNWIQGFGG |
| Ga0209235_11959772 | 3300026296 | Grasslands Soil | SARVPGLRVGYDAVSNARYTPIEPKNLLARATTALRAAKAQGGPNWIQGFAG |
| Ga0209237_11094191 | 3300026297 | Grasslands Soil | YDAVSNARYTPIEPKNLLARATTALRAAKAQGGPNWIQGFAG |
| Ga0209236_10086201 | 3300026298 | Grasslands Soil | RGVKTLTGATPGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG |
| Ga0209027_12259981 | 3300026300 | Grasslands Soil | TAAPAEGLPGLRAGYDAVSNARYTPIEPKNLLGRATSALRVAKTAAGSGWIRAFQ |
| Ga0209238_12268262 | 3300026301 | Grasslands Soil | VGNTRYTPVEPKNLLSRATSALRIAKTEAAANWIRGYEQA |
| Ga0209238_12701622 | 3300026301 | Grasslands Soil | EGAPPLRAGYDAVGNTRYTPVEPKNLLSRATSALRIAKSEAAANWIRAYEQA |
| Ga0209469_10184071 | 3300026307 | Soil | YDAVGNTRYTPVEPKHLLARATSALRLAKGDAAANWIRAFDG |
| Ga0209239_12929021 | 3300026310 | Grasslands Soil | GGLPGLRAGYDAVANARYTPIEPKNLLGRATSALRVAKTNGGGPGWIRAFQ |
| Ga0209761_12351002 | 3300026313 | Grasslands Soil | SVPGLRAGYDAVGNARYTPIEPKHLLARATTALRAAKGQEGPNWIQGFKG |
| Ga0209471_11443821 | 3300026318 | Soil | DAVGNARYTPIEPKNLLARAATALRAAKGLGGPEWIQGFKG |
| Ga0209470_10116971 | 3300026324 | Soil | GYDAVGNTRYTPVEPKHLLARATSALRLAKGDAAANWIRAFDA |
| Ga0209152_104839682 | 3300026325 | Soil | YDAVGNTRYTPVEPKNLLARATSALRLAKGDAAANWIRAFDAA |
| Ga0209801_11464671 | 3300026326 | Soil | GLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG |
| Ga0209375_10658721 | 3300026329 | Soil | ARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFNS |
| Ga0209803_11059722 | 3300026332 | Soil | VKMLTGATPGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG |
| Ga0209158_11484143 | 3300026333 | Soil | VGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG |
| Ga0209377_11753982 | 3300026334 | Soil | GHTEGAPPLRAGYDAVGNTRYTPVEPKNLLSRATSALRIAKTEAAANWIRAYEQA |
| Ga0209377_11994742 | 3300026334 | Soil | GYDAVTNARYTPIEPKHLLGRATSALRVAKTDAGPGWIRAFQ |
| Ga0209057_10585952 | 3300026342 | Soil | GYDAVGNTRYTPVEPKHLLARATSALRLAKGDAAANWIRAFDG |
| Ga0209159_10230561 | 3300026343 | Soil | PGLRAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFNS |
| Ga0209806_10033868 | 3300026529 | Soil | VGNARYTPIEPKNLLARAATALRAAKGLGGPEWIQGFKG |
| Ga0209806_10742383 | 3300026529 | Soil | AVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGYAG |
| Ga0209157_12868301 | 3300026537 | Soil | TPIEPKNLLSRATTALRAAKGQGGPNWIQGYALTP |
| Ga0209056_103412362 | 3300026538 | Soil | PGLRAGYDAVGNARYTPIEPKNLLARATTALRAAKGQGGPNWIEGFRG |
| Ga0209156_100194435 | 3300026547 | Soil | ATPGLCAGYDAVGNARYTPIEPKNLLSRATTALRAAKGQGGPNWIQGFNS |
| Ga0209156_104534192 | 3300026547 | Soil | DAVTNARYTPIEPKNLLGRATSALRVAKTDGGGAGWIRAFQ |
| Ga0209178_12124302 | 3300027725 | Agricultural Soil | TAAGDERPSLRAGYDAVANARYAAVEPRNLLTRATSALRAAKGMGAPNWIQAFRG |
| Ga0209689_10263271 | 3300027748 | Soil | LRAGYDAVGNTRYTPVEPKNLLARATSALRLAKGDAAANWIRAFDAA |
| Ga0209180_104184303 | 3300027846 | Vadose Zone Soil | AVANARYTSVEPKNMLGRATSALRTAKAAADREWIQAFATS |
| Ga0209488_107946381 | 3300027903 | Vadose Zone Soil | LAGATPGLRAGYDAVGNARYTPIEPKNLLARATTALRAAKGQGGPNWIQGFNS |
| Ga0307483_10236232 | 3300031590 | Hardwood Forest Soil | ATAAGDERPSLRAGYDAVANARYAAVEPRNLLTRATSALRAAKGMGAPNWIQAFRG |
| Ga0307471_1006209733 | 3300032180 | Hardwood Forest Soil | AAGDARPSLRAGYDAVPNARYAAVEPKNLLARATSALRAAKGMGTPNWIQPFRE |
| ⦗Top⦘ |