


| Basic Information | |
|---|---|
| Family ID | F040345 |
| Family Type | Metagenome |
| Number of Sequences | 162 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYIIIESLPL |
| Number of Associated Samples | 118 |
| Number of Associated Scaffolds | 162 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.81 % |
| % of genes near scaffold ends (potentially truncated) | 23.46 % |
| % of genes from short scaffolds (< 2000 bps) | 74.07 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (47.531 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (40.741 % of family members) |
| Environment Ontology (ENVO) | Unclassified (88.272 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (95.062 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 162 Family Scaffolds |
|---|---|---|
| PF02412 | TSP_3 | 10.49 |
| PF00085 | Thioredoxin | 4.32 |
| PF00578 | AhpC-TSA | 4.32 |
| PF02562 | PhoH | 3.70 |
| PF03819 | MazG | 3.09 |
| PF16861 | Carbam_trans_C | 3.09 |
| PF02511 | Thy1 | 2.47 |
| PF00542 | Ribosomal_L12 | 2.47 |
| PF03851 | UvdE | 0.62 |
| PF00156 | Pribosyltran | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 162 Family Scaffolds |
|---|---|---|---|
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 3.70 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 3.70 |
| COG0222 | Ribosomal protein L7/L12 | Translation, ribosomal structure and biogenesis [J] | 2.47 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 2.47 |
| COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.19 % |
| Unclassified | root | N/A | 14.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2236876007|none_p0024428 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10057452 | All Organisms → Viruses → Predicted Viral | 1895 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10048407 | All Organisms → Viruses → Predicted Viral | 1704 | Open in IMG/M |
| 3300000949|BBAY94_10192205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 550 | Open in IMG/M |
| 3300001450|JGI24006J15134_10038051 | All Organisms → Viruses → Predicted Viral | 2056 | Open in IMG/M |
| 3300001450|JGI24006J15134_10085394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1169 | Open in IMG/M |
| 3300001450|JGI24006J15134_10209794 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300001450|JGI24006J15134_10239863 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300001450|JGI24006J15134_10242201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 523 | Open in IMG/M |
| 3300001589|JGI24005J15628_10032738 | All Organisms → Viruses → Predicted Viral | 2146 | Open in IMG/M |
| 3300001589|JGI24005J15628_10128806 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300001589|JGI24005J15628_10228559 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300001974|GOS2246_10107287 | All Organisms → Viruses → Predicted Viral | 1422 | Open in IMG/M |
| 3300002483|JGI25132J35274_1005441 | All Organisms → Viruses → Predicted Viral | 3214 | Open in IMG/M |
| 3300004460|Ga0066222_1478276 | Not Available | 693 | Open in IMG/M |
| 3300005404|Ga0066856_10142081 | Not Available | 1048 | Open in IMG/M |
| 3300005521|Ga0066862_10208994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 644 | Open in IMG/M |
| 3300005593|Ga0066837_10140998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 876 | Open in IMG/M |
| 3300005605|Ga0066850_10281548 | Not Available | 589 | Open in IMG/M |
| 3300006164|Ga0075441_10014496 | All Organisms → Viruses → Predicted Viral | 3310 | Open in IMG/M |
| 3300006165|Ga0075443_10095406 | All Organisms → Viruses → Predicted Viral | 1023 | Open in IMG/M |
| 3300006166|Ga0066836_10993421 | Not Available | 506 | Open in IMG/M |
| 3300006190|Ga0075446_10071803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1042 | Open in IMG/M |
| 3300006484|Ga0070744_10096837 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300006735|Ga0098038_1008173 | All Organisms → Viruses → Predicted Viral | 4175 | Open in IMG/M |
| 3300006735|Ga0098038_1059783 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300006735|Ga0098038_1223618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 602 | Open in IMG/M |
| 3300006737|Ga0098037_1179101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 701 | Open in IMG/M |
| 3300006738|Ga0098035_1220339 | Not Available | 629 | Open in IMG/M |
| 3300006751|Ga0098040_1052732 | All Organisms → Viruses → Predicted Viral | 1262 | Open in IMG/M |
| 3300006751|Ga0098040_1172977 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300006752|Ga0098048_1018812 | All Organisms → Viruses → Predicted Viral | 2334 | Open in IMG/M |
| 3300006752|Ga0098048_1079764 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
| 3300006789|Ga0098054_1074905 | All Organisms → Viruses → Predicted Viral | 1279 | Open in IMG/M |
| 3300006789|Ga0098054_1154710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 845 | Open in IMG/M |
| 3300006920|Ga0070748_1218750 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300006921|Ga0098060_1003199 | Not Available | 6069 | Open in IMG/M |
| 3300006921|Ga0098060_1010292 | All Organisms → Viruses → Predicted Viral | 3059 | Open in IMG/M |
| 3300006921|Ga0098060_1023245 | All Organisms → Viruses → Predicted Viral | 1916 | Open in IMG/M |
| 3300006925|Ga0098050_1191880 | Not Available | 508 | Open in IMG/M |
| 3300006927|Ga0098034_1217223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 531 | Open in IMG/M |
| 3300006929|Ga0098036_1132181 | Not Available | 764 | Open in IMG/M |
| 3300007229|Ga0075468_10122401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 806 | Open in IMG/M |
| 3300007231|Ga0075469_10101069 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300007555|Ga0102817_1009523 | All Organisms → Viruses → Predicted Viral | 2221 | Open in IMG/M |
| 3300007862|Ga0105737_1072513 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300008050|Ga0098052_1300665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 606 | Open in IMG/M |
| 3300009026|Ga0102829_1293943 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300009172|Ga0114995_10135028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1379 | Open in IMG/M |
| 3300009481|Ga0114932_10213737 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
| 3300009481|Ga0114932_10574557 | Not Available | 660 | Open in IMG/M |
| 3300009550|Ga0115013_10074120 | All Organisms → Viruses → Predicted Viral | 1900 | Open in IMG/M |
| 3300009593|Ga0115011_11505111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 595 | Open in IMG/M |
| 3300009705|Ga0115000_10457459 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300010148|Ga0098043_1026659 | All Organisms → Viruses → Predicted Viral | 1832 | Open in IMG/M |
| 3300010151|Ga0098061_1184243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 745 | Open in IMG/M |
| 3300010153|Ga0098059_1299273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 615 | Open in IMG/M |
| 3300011254|Ga0151675_1070691 | All Organisms → Viruses → Predicted Viral | 1281 | Open in IMG/M |
| 3300012920|Ga0160423_10249648 | All Organisms → Viruses → Predicted Viral | 1228 | Open in IMG/M |
| 3300012928|Ga0163110_10649448 | Not Available | 819 | Open in IMG/M |
| 3300012928|Ga0163110_10705519 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300012952|Ga0163180_10649898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 808 | Open in IMG/M |
| 3300012953|Ga0163179_10706755 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300017697|Ga0180120_10088248 | All Organisms → Viruses → Predicted Viral | 1359 | Open in IMG/M |
| 3300017704|Ga0181371_1009010 | All Organisms → Viruses → Predicted Viral | 1717 | Open in IMG/M |
| 3300017704|Ga0181371_1036902 | Not Available | 800 | Open in IMG/M |
| 3300017708|Ga0181369_1005907 | All Organisms → Viruses → Predicted Viral | 3235 | Open in IMG/M |
| 3300017708|Ga0181369_1009044 | All Organisms → Viruses → Predicted Viral | 2573 | Open in IMG/M |
| 3300017708|Ga0181369_1015188 | All Organisms → cellular organisms → Bacteria | 1919 | Open in IMG/M |
| 3300017708|Ga0181369_1082193 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300017709|Ga0181387_1033030 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
| 3300017710|Ga0181403_1003021 | All Organisms → Viruses → Predicted Viral | 3784 | Open in IMG/M |
| 3300017710|Ga0181403_1057140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 814 | Open in IMG/M |
| 3300017710|Ga0181403_1082778 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300017710|Ga0181403_1109450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 577 | Open in IMG/M |
| 3300017713|Ga0181391_1004046 | All Organisms → Viruses → Predicted Viral | 4023 | Open in IMG/M |
| 3300017713|Ga0181391_1118134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 595 | Open in IMG/M |
| 3300017713|Ga0181391_1136774 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300017714|Ga0181412_1101671 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300017717|Ga0181404_1002224 | All Organisms → cellular organisms → Bacteria | 5598 | Open in IMG/M |
| 3300017717|Ga0181404_1082387 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300017721|Ga0181373_1008891 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
| 3300017724|Ga0181388_1009906 | All Organisms → Viruses → Predicted Viral | 2467 | Open in IMG/M |
| 3300017729|Ga0181396_1128141 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300017731|Ga0181416_1003860 | All Organisms → Viruses → Predicted Viral | 3619 | Open in IMG/M |
| 3300017733|Ga0181426_1118316 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300017733|Ga0181426_1121196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 527 | Open in IMG/M |
| 3300017733|Ga0181426_1133242 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300017734|Ga0187222_1134227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 552 | Open in IMG/M |
| 3300017737|Ga0187218_1017457 | All Organisms → Viruses → Predicted Viral | 1892 | Open in IMG/M |
| 3300017738|Ga0181428_1048928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 985 | Open in IMG/M |
| 3300017739|Ga0181433_1046670 | All Organisms → Viruses → Predicted Viral | 1107 | Open in IMG/M |
| 3300017741|Ga0181421_1001762 | All Organisms → cellular organisms → Bacteria | 6500 | Open in IMG/M |
| 3300017741|Ga0181421_1142899 | Not Available | 619 | Open in IMG/M |
| 3300017743|Ga0181402_1006463 | All Organisms → Viruses → Predicted Viral | 3697 | Open in IMG/M |
| 3300017743|Ga0181402_1086766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 815 | Open in IMG/M |
| 3300017745|Ga0181427_1001478 | All Organisms → cellular organisms → Bacteria | 5895 | Open in IMG/M |
| 3300017750|Ga0181405_1145667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 587 | Open in IMG/M |
| 3300017757|Ga0181420_1160734 | Not Available | 666 | Open in IMG/M |
| 3300017759|Ga0181414_1005745 | All Organisms → Viruses → Predicted Viral | 3492 | Open in IMG/M |
| 3300017760|Ga0181408_1084942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 829 | Open in IMG/M |
| 3300017772|Ga0181430_1061870 | All Organisms → Viruses → Predicted Viral | 1147 | Open in IMG/M |
| 3300017772|Ga0181430_1228410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 527 | Open in IMG/M |
| 3300017775|Ga0181432_1055765 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300017782|Ga0181380_1102704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 991 | Open in IMG/M |
| 3300017786|Ga0181424_10016927 | All Organisms → Viruses → Predicted Viral | 3152 | Open in IMG/M |
| 3300017786|Ga0181424_10026440 | All Organisms → Viruses → Predicted Viral | 2517 | Open in IMG/M |
| 3300017786|Ga0181424_10428613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 535 | Open in IMG/M |
| 3300020165|Ga0206125_10031348 | All Organisms → Viruses → Predicted Viral | 2886 | Open in IMG/M |
| 3300020165|Ga0206125_10072909 | All Organisms → Viruses → Predicted Viral | 1547 | Open in IMG/M |
| 3300020169|Ga0206127_1177610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 795 | Open in IMG/M |
| 3300020379|Ga0211652_10086791 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300020410|Ga0211699_10068965 | All Organisms → Viruses → Predicted Viral | 1308 | Open in IMG/M |
| 3300020414|Ga0211523_10045940 | All Organisms → Viruses → Predicted Viral | 1883 | Open in IMG/M |
| 3300020416|Ga0211644_10469636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 519 | Open in IMG/M |
| 3300020419|Ga0211512_10419156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 602 | Open in IMG/M |
| 3300020421|Ga0211653_10143146 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300020428|Ga0211521_10092048 | All Organisms → Viruses → Predicted Viral | 1477 | Open in IMG/M |
| 3300020436|Ga0211708_10470093 | Not Available | 516 | Open in IMG/M |
| 3300020438|Ga0211576_10143247 | All Organisms → Viruses → Predicted Viral | 1297 | Open in IMG/M |
| 3300020469|Ga0211577_10297576 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
| 3300020470|Ga0211543_10299114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 782 | Open in IMG/M |
| 3300020472|Ga0211579_10379367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 802 | Open in IMG/M |
| 3300020474|Ga0211547_10082058 | All Organisms → Viruses → Predicted Viral | 1701 | Open in IMG/M |
| 3300020474|Ga0211547_10376745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 716 | Open in IMG/M |
| 3300020478|Ga0211503_10429133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 705 | Open in IMG/M |
| 3300021957|Ga0222717_10246359 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
| 3300025071|Ga0207896_1064424 | Not Available | 580 | Open in IMG/M |
| 3300025086|Ga0208157_1009398 | All Organisms → Viruses → Predicted Viral | 3295 | Open in IMG/M |
| 3300025096|Ga0208011_1010925 | All Organisms → Viruses → Predicted Viral | 2517 | Open in IMG/M |
| 3300025099|Ga0208669_1001627 | Not Available | 8104 | Open in IMG/M |
| 3300025099|Ga0208669_1009391 | All Organisms → Viruses → Predicted Viral | 2785 | Open in IMG/M |
| 3300025102|Ga0208666_1074885 | Not Available | 883 | Open in IMG/M |
| 3300025132|Ga0209232_1018550 | All Organisms → Viruses → Predicted Viral | 2760 | Open in IMG/M |
| 3300025132|Ga0209232_1025619 | All Organisms → Viruses → Predicted Viral | 2289 | Open in IMG/M |
| 3300025132|Ga0209232_1079669 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
| 3300025138|Ga0209634_1033641 | All Organisms → Viruses → Predicted Viral | 2681 | Open in IMG/M |
| 3300025138|Ga0209634_1163607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 892 | Open in IMG/M |
| 3300025138|Ga0209634_1280219 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300025151|Ga0209645_1007949 | All Organisms → Viruses → Predicted Viral | 4406 | Open in IMG/M |
| 3300025151|Ga0209645_1013898 | All Organisms → Viruses → Predicted Viral | 3172 | Open in IMG/M |
| 3300025168|Ga0209337_1245887 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300025632|Ga0209194_1096759 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300025652|Ga0208134_1048673 | All Organisms → Viruses → Predicted Viral | 1360 | Open in IMG/M |
| 3300025886|Ga0209632_10472614 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300027791|Ga0209830_10382860 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300027801|Ga0209091_10032484 | All Organisms → Viruses → Predicted Viral | 3178 | Open in IMG/M |
| 3300029319|Ga0183748_1015227 | All Organisms → Viruses → Predicted Viral | 2947 | Open in IMG/M |
| 3300029319|Ga0183748_1064588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 968 | Open in IMG/M |
| 3300029448|Ga0183755_1021165 | All Organisms → Viruses → Predicted Viral | 2144 | Open in IMG/M |
| 3300029448|Ga0183755_1109612 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300031774|Ga0315331_10438935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 951 | Open in IMG/M |
| 3300032006|Ga0310344_10602830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 940 | Open in IMG/M |
| 3300032011|Ga0315316_10233269 | All Organisms → Viruses → Predicted Viral | 1539 | Open in IMG/M |
| 3300032073|Ga0315315_10280893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 1552 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 40.74% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 22.84% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 14.20% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.47% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.47% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.85% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.85% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.23% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.23% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.23% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.23% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.62% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.62% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.62% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.62% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.62% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.62% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.62% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.62% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine | 0.62% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.62% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.62% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.62% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.62% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876007 | Marine microbial communities from Columbia River, CM, sample from Cape Meares, GS311-0p1-Deep1200 | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300005593 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86 | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017704 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| none_00244281 | 2236876007 | Marine Estuarine | MTEQEDIITYILIGIGIGVGIGFVLKVFVDTYVIIKGLPL |
| DelMOSum2010_100574527 | 3300000101 | Marine | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTIIESLPL* |
| DelMOSum2011_100484075 | 3300000115 | Marine | MMKNTEHEDIITYILIGIGIGVGIGFVLKAFLDTYAIIERLPI* |
| BBAY94_101922051 | 3300000949 | Macroalgal Surface | MIKNSQHEDIITYILIGIGIGVGIGFVLKVFLDTYAIIERLPI* |
| JGI24006J15134_100380512 | 3300001450 | Marine | MSSNDDKITMICIGIAIGIGIGFVLKVFVDTYIIIQGLPV* |
| JGI24006J15134_100853942 | 3300001450 | Marine | MKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTIIESLPL* |
| JGI24006J15134_102097942 | 3300001450 | Marine | MKNTEHEDIITYILIGIGIGVGIGFVLKIFLDTYIIIESLPL* |
| JGI24006J15134_102398631 | 3300001450 | Marine | MSKMTEQEDIITYILIGIGIGVGIGFVLKVFVDTYVIIK |
| JGI24006J15134_102422011 | 3300001450 | Marine | MSKMTEQEDIITYILIGIGVGVGIGFVLKVFVDTYIIIKGLPL* |
| JGI24005J15628_100327385 | 3300001589 | Marine | MKNTEHEDIITYILIGIGIGVGIGFVLKIFLDTYIII |
| JGI24005J15628_101288063 | 3300001589 | Marine | MTEQEDTITYILIGIGIGVGIGFVLKVFVDTYVIIKGLPL* |
| JGI24005J15628_102285591 | 3300001589 | Marine | MKNTEHEDIITYILIGIGIGVGIGFVLKVFMDTYALIERLPL*KP* |
| GOS2246_101072875 | 3300001974 | Marine | MIKNTEHDDIVTYILIGVGIGVGIGFVLKVFLDTYAIIERLPL* |
| JGI25132J35274_10054411 | 3300002483 | Marine | MLKNNQHEDAITCILIGIGLGVPIGFVLKTFLDTWAILESLPL* |
| Ga0066222_14782763 | 3300004460 | Marine | MKNLSHEEQITLILIGIAIGVGIGFVLKVFVDSYIIIEGLPL* |
| Ga0066856_101420813 | 3300005404 | Marine | MIKNTQHEDVITYIAIGMGLGVPIGFVLKSFLDTYMLIQTLPI* |
| Ga0066862_102089942 | 3300005521 | Marine | MIKNTEHEDIITYILIGVGIGVGIGFVLKVFLDTYAIIERLPL* |
| Ga0066837_101409981 | 3300005593 | Marine | MKNIEHDDIITYILIGVGIGMGIGFVLKVFMDTYILIGRLPI* |
| Ga0066850_102815482 | 3300005605 | Marine | MKNIEHDDIITYILIGVGIGVGISFVLKVFMDTYILIGRLPI* |
| Ga0075441_100144967 | 3300006164 | Marine | MRQMNNNDDLITMISIGVAIGIGIGFLLKVFVDTYFIIGSLPQ* |
| Ga0075443_100954063 | 3300006165 | Marine | MSNMNQHEDIITYVLIGVGIGVGIGFVLKVFIDTYIIIESLPI* |
| Ga0066836_109934212 | 3300006166 | Marine | MIKNTEHEDIITYILIGVGIGVGIGFVLKVFIDTYAIIERLPL* |
| Ga0075446_100718033 | 3300006190 | Marine | MNKITEHDDIVTYILIGIGIGVGIGFVLKVFVDTYIIIESLPI* |
| Ga0070744_100968373 | 3300006484 | Estuarine | MKNTEHEDIITYILIGIGIGVGIGFVLKIFLDTYIIIESLPL*NT* |
| Ga0098038_10081736 | 3300006735 | Marine | MIKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYAIIESLPL* |
| Ga0098038_10597831 | 3300006735 | Marine | EDIITYILIGIGIGVGIGFVLKVFLDTYAIIESLPL* |
| Ga0098038_12236183 | 3300006735 | Marine | TEHEDIITYILIGIGIGVGIGFVLKVFLDTYAIVERLPI* |
| Ga0098037_11791013 | 3300006737 | Marine | EHEDIITYILIGIGIGVGIGLVLKVFLDTYAIVERLPI* |
| Ga0098035_12203392 | 3300006738 | Marine | MKNIEHDDIITYILIGVGIGVGIGFVLKVFMDTYILIGRLPI* |
| Ga0098040_10527323 | 3300006751 | Marine | MIKNTEHEDIITYILIGVGIGVGIGFVLKVFVDTYILIERLPL* |
| Ga0098040_11729772 | 3300006751 | Marine | MKNIEHDDIITYILIGVGIGIGIGFVLKVFMDTYILIGRLPI* |
| Ga0098048_10188125 | 3300006752 | Marine | MIKNTEHEDIITYILIGIGLGVGIGFVLKVFIDTYVLIERLPL* |
| Ga0098048_10797642 | 3300006752 | Marine | MIKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTLIESLPL* |
| Ga0098054_10749053 | 3300006789 | Marine | MIKNTEHEDIVTYILIGVGIGVGIGFVLKVFLDTYAIIERLPL* |
| Ga0098054_11547102 | 3300006789 | Marine | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFMDTYVIVERLPI* |
| Ga0070748_12187502 | 3300006920 | Aqueous | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYIIIEGLPI*KP* |
| Ga0098060_10031998 | 3300006921 | Marine | MIKNSQHEDIITYILIGIGIGVGIGFVLKVFLDTYTLIESLPL* |
| Ga0098060_10102924 | 3300006921 | Marine | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTIIGSLPL* |
| Ga0098060_10232451 | 3300006921 | Marine | KNTEHEDIITYILIGIGIGVGIGFVLKVFMDTYVIVERLPI* |
| Ga0098050_11918801 | 3300006925 | Marine | MIKNTEHEDIVTYILIGVGIGVGIGFVLKVFLDTYTLIESLPL*KPYLKNS* |
| Ga0098034_12172232 | 3300006927 | Marine | MIKNTEHEDIITYILIGVGIGVGIGFVLKVFMDTYILIGRLPI* |
| Ga0098036_11321813 | 3300006929 | Marine | MKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTIIGSLPL* |
| Ga0075468_101224011 | 3300007229 | Aqueous | ISMMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTIIESLPL* |
| Ga0075469_101010692 | 3300007231 | Aqueous | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYIIIESLPL* |
| Ga0102817_10095234 | 3300007555 | Estuarine | MKNTEHEDIITYILIGIGIGVGIGFVMKIFLDTYIIIESLPL* |
| Ga0105737_10725132 | 3300007862 | Estuary Water | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFMDTYALIERLPL* |
| Ga0098052_13006652 | 3300008050 | Marine | MKNIEHDDIITYILIGVGIGIGIGFVLKVFMDTYILIGRLPI*KPYLKNS* |
| Ga0102829_12939432 | 3300009026 | Estuarine | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYALIERLPL* |
| Ga0114995_101350282 | 3300009172 | Marine | MSKMTEQEDIITYILIGIGIGVGIGFVLKVFVDTYIIIKGLPL* |
| Ga0114915_11533013 | 3300009428 | Deep Ocean | MNNNDDLITMISIGIAIGIGIGFLLKVFVDAYFTIGSLPQ* |
| Ga0114932_102137374 | 3300009481 | Deep Subsurface | MIKNTEHEDIITYILIGIGIGVGIGFVLKVFMDTYTIIESLPL* |
| Ga0114932_105745571 | 3300009481 | Deep Subsurface | MIKNTEHDDIITYILIGVGIGVGIGFVLKVFLDTYILIRS |
| Ga0115013_100741201 | 3300009550 | Marine | IISMMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYAIVERLPI* |
| Ga0115011_115051111 | 3300009593 | Marine | MIKNSQHEDIITYILIGIGLGVPIGFVLKVFMDTYILIESLPL* |
| Ga0115000_104574593 | 3300009705 | Marine | MSKMTEQEDIITYILIGIGIGVGIGFVLKVFVDTYVIIKGLPL* |
| Ga0114999_108981561 | 3300009786 | Marine | SNDDKITMICIGIAIGIGIGFALKVFVDTYIIIQGLPV* |
| Ga0098043_10266591 | 3300010148 | Marine | IFISMIKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYAIIESLPL* |
| Ga0098061_11842431 | 3300010151 | Marine | MIKNTEHEDIITYILIGVGIGVGIGFVLKVFLDTYILIGRLPI* |
| Ga0098059_12992732 | 3300010153 | Marine | MIKNTEHEDIITYILIGVGIGVGIGFVLKVFLDTYILIGRLPI*KPYLKNS* |
| Ga0151675_10706911 | 3300011254 | Marine | MCSNDDKITMICIGIAIGIGIGFALKVFVDTYIIIQGLPV* |
| Ga0160423_102496483 | 3300012920 | Surface Seawater | MIKNTQHEDAITYILIGIGLGVPIGFVLKVFLDTYTLIESLPL* |
| Ga0163110_106494483 | 3300012928 | Surface Seawater | MIKNTQHEDAITYILIGVGLGVPIGFVLKVFFDTWTLLESLPL* |
| Ga0163110_107055192 | 3300012928 | Surface Seawater | MIKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYAIIES* |
| Ga0163180_106498981 | 3300012952 | Seawater | MIKNSQQEDIITYILIGIGLGVPIGFVLKVFLDTYAIIESLPL* |
| Ga0163179_107067552 | 3300012953 | Seawater | MIKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYAIVERLPI* |
| Ga0180120_100882485 | 3300017697 | Freshwater To Marine Saline Gradient | MMKNTEHEDIITYILIGIGIGVGIGFVLKAFLDTYAII |
| Ga0181371_10090105 | 3300017704 | Marine | MKNIEHDDIITYILIGVGIGIGIGFVLKVFMDTYILIGRLPI |
| Ga0181371_10369022 | 3300017704 | Marine | MIKNTEHEDIITYILIGIGLGVGIGFVLKVFIDTYVLIERLPL |
| Ga0181369_10059073 | 3300017708 | Marine | MIKNSQHEDIITYILIGIGIGVGIGFVLKVFLDTYTLIESLPL |
| Ga0181369_10090441 | 3300017708 | Marine | IFISMIKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYAIIESLPL |
| Ga0181369_10151883 | 3300017708 | Marine | IFISMIKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYAIVESLPL |
| Ga0181369_10821933 | 3300017708 | Marine | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYAIVERLPI |
| Ga0181387_10330303 | 3300017709 | Seawater | MKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTIIESLPL |
| Ga0181403_10030211 | 3300017710 | Seawater | QIIISMMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYIIIESLPL |
| Ga0181403_10571402 | 3300017710 | Seawater | MLKNTEHDDIITYILIGVGIGVGIGFVLKVFLDTYTMIERLPL |
| Ga0181403_10827783 | 3300017710 | Seawater | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFMDTYALIGRLPL |
| Ga0181403_11094501 | 3300017710 | Seawater | QIIISMMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTIIESLPL |
| Ga0181391_10040464 | 3300017713 | Seawater | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYIIIESLPL |
| Ga0181391_11181341 | 3300017713 | Seawater | MIKNTEHEDIITYILIGIGIGVGIGFVLKVFMDTYVIVERLPI |
| Ga0181391_11367742 | 3300017713 | Seawater | MKNTEHEDIITYILIGIGIGVGIGFVLKIFLDTYIIIESLPLXNT |
| Ga0181412_11016713 | 3300017714 | Seawater | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTLIESLPL |
| Ga0181404_10022247 | 3300017717 | Seawater | MKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYIIIESLPL |
| Ga0181404_10823872 | 3300017717 | Seawater | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTIIESLPLXKP |
| Ga0181373_10088913 | 3300017721 | Marine | NTEHEDIITYILIGIGIGVGIGFVLKVFLDTYAIVESLPL |
| Ga0181388_10099062 | 3300017724 | Seawater | MKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYALIGRLPL |
| Ga0181396_11281412 | 3300017729 | Seawater | MMKNTEHEDIITYILIGIGIGVGIGFVLKAFLDTYALIERLPL |
| Ga0181416_10038606 | 3300017731 | Seawater | MKNTEHEDIITYILIGVGIGVGIGFVLKVFLDTYTLIESLPL |
| Ga0181426_11183163 | 3300017733 | Seawater | MMKNTEDEDIIIYILIGIGIGVGIGFVLKVFLDTYALIGGLPL |
| Ga0181426_11211962 | 3300017733 | Seawater | ISMMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYALIERLPL |
| Ga0181426_11332421 | 3300017733 | Seawater | MKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYALI |
| Ga0187222_11342271 | 3300017734 | Seawater | MKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTIIESLPLXKP |
| Ga0187218_10174571 | 3300017737 | Seawater | DIITYILIGIGIGVGIGFVLKVFMDTYVIVERLPI |
| Ga0181428_10489282 | 3300017738 | Seawater | MIKNSQHEDIITYILIGVGIGVGIGFVLKVFLDTYTLIESLPLXKPYLKNS |
| Ga0181433_10466704 | 3300017739 | Seawater | MIKNSQHEDIITYILIGVGIGVGIGFVLKVFLDTYAIIERLPL |
| Ga0181421_10017629 | 3300017741 | Seawater | MKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYIVIESLPL |
| Ga0181421_11428992 | 3300017741 | Seawater | MIKNSQHEDIITYILIGIGLGVPIGFVLKVFLDTYTLIESLPLXKPYLKNS |
| Ga0181402_100646310 | 3300017743 | Seawater | SSIIFISMIKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTLIESLPL |
| Ga0181402_10867662 | 3300017743 | Seawater | MLKNTEHDDIITYILIGVGIGVGIGFVLKVFLDTYTMIERLPLX |
| Ga0181427_10014786 | 3300017745 | Seawater | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYIVIESLPL |
| Ga0181405_11456672 | 3300017750 | Seawater | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFMDTYVIVERLPIXKPYLKNS |
| Ga0181420_11607341 | 3300017757 | Seawater | MKNIEHDDIITYILIGVGIGMGIGFVLKVFMDTYILIGRLPI |
| Ga0181414_10057456 | 3300017759 | Seawater | MIKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTLIENLPL |
| Ga0181408_10849421 | 3300017760 | Seawater | EDIITYILIGVGIGVGIGFVLKVFVDTYILIERLPL |
| Ga0181430_10618701 | 3300017772 | Seawater | IYKYMKNIEHDDIITYILIGVGIGMGIGFVLKVFMDTYILIGRLPIXQP |
| Ga0181430_12284101 | 3300017772 | Seawater | IISMMKNTEHEDIITYILIGIGIGVGIGFVLKVFMDTYVIVERLPI |
| Ga0181432_10557652 | 3300017775 | Seawater | MKNIEHDDIITYILIGVGIGIGIGFVLKVFIDTYILIERLPI |
| Ga0181380_11027041 | 3300017782 | Seawater | MIKNSQHEDIITYILIGVGIGVGIGFVLKVFVDTYILIERLPL |
| Ga0181424_100169271 | 3300017786 | Seawater | HIFISMMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYIVIESLPL |
| Ga0181424_100264401 | 3300017786 | Seawater | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTY |
| Ga0181424_104286131 | 3300017786 | Seawater | HIFISMMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTIIESLPL |
| Ga0206125_100313487 | 3300020165 | Seawater | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTIIESLPL |
| Ga0206125_100729092 | 3300020165 | Seawater | MMKNTEHEDIITYILIGIGIGVGIGFVLKAFLDTYAIIERLPI |
| Ga0206125_102823171 | 3300020165 | Seawater | MGRINNTDDYITLIGIGIAIGIGVGFVLKVFLDTYTMIEGLPL |
| Ga0206127_11776101 | 3300020169 | Seawater | MKNTEHEDIITYILIGIGIGVGIGFVLKAFLDTYAIIER |
| Ga0211652_100867914 | 3300020379 | Marine | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTIIGSLPL |
| Ga0211699_100689651 | 3300020410 | Marine | MIKNSQQEDIITYILIGIGLGVPIGFVLKVFLDTYALIERLPL |
| Ga0211523_100459401 | 3300020414 | Marine | MIKNTQHEDAITYILIGIGLGVPIGFVLKVFLDTYAIIERLPI |
| Ga0211644_104696362 | 3300020416 | Marine | MIKNTQHEDIITYILIGIGLGVPIGFVLKVFLDTYAIIESLPL |
| Ga0211512_104191561 | 3300020419 | Marine | HEDIITYILIGIGIGVGIGFVLKVFLDTYAIIERLPI |
| Ga0211653_101431464 | 3300020421 | Marine | MKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTIIGSLPL |
| Ga0211521_100920482 | 3300020428 | Marine | MMKNTEHEDIITYILIGIGIGVGIGFVLKAFLDTYAIIERLPL |
| Ga0211708_104700931 | 3300020436 | Marine | TEHEDIITYILIGLGLGVPIGFVLKVFLDTWTLLESLPL |
| Ga0211576_101432474 | 3300020438 | Marine | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYALIERLPL |
| Ga0211577_102975762 | 3300020469 | Marine | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYALIGRLPL |
| Ga0211543_102991141 | 3300020470 | Marine | MIKNTQHEDAITYILIGIGLGVPIGFVLKVFLDTYAIIERLPL |
| Ga0211579_103793673 | 3300020472 | Marine | MIKNTEHEDIITYILIGIGLGVPIGFVLKVFLDTYTLIESLPL |
| Ga0211547_100820584 | 3300020474 | Marine | MKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYAIVERLPI |
| Ga0211547_103767453 | 3300020474 | Marine | MIKNTEHEDIITYILIGIGLGVPIGFVLKVFLDTYTLIE |
| Ga0211503_104291331 | 3300020478 | Marine | MIKNSQQEDIITYILIGVGIGVGIGFVLKVFLDTYAIVERLPL |
| Ga0222717_102463592 | 3300021957 | Estuarine Water | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYALIERLPLXKP |
| Ga0207896_10644241 | 3300025071 | Marine | MSSNDDKITMICIGIAIGIGIGFVLKVFVDTYIIIQGLP |
| Ga0208157_10093986 | 3300025086 | Marine | MIKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYAIIESLPL |
| Ga0208011_10109257 | 3300025096 | Marine | MKNIEHDDIITYILIGVGIGVGIGFVLKVFMDTYILIGRLPI |
| Ga0208669_100162716 | 3300025099 | Marine | MIKNSQHEDIITYILIGVGIGVGIGFVLKVFLDTYTLIESLPL |
| Ga0208669_10093912 | 3300025099 | Marine | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFMDTYVIVERLPI |
| Ga0208666_10748853 | 3300025102 | Marine | HEDIITYILIGIGIGVGIGFVLKVFLDTYAIVESLPL |
| Ga0209535_11965692 | 3300025120 | Marine | MGKINNTDDYITLIGIGIAIGIGIGFVLKVFVDTYIIIEGLPL |
| Ga0209232_10185505 | 3300025132 | Marine | MIKNTQHEDAITYILIGVGLGVPIGFVLKVFLDTWTLLESLPL |
| Ga0209232_10256197 | 3300025132 | Marine | ISMMKNTEHEDIVTYILIGIGIGVGIGFVLKVFMDTYVIVERLPI |
| Ga0209232_10796693 | 3300025132 | Marine | MIKNSQHEDIITYILIGIGLGVPIGFVLKVFMDTYILIESLPL |
| Ga0209634_10336413 | 3300025138 | Marine | MKNTEHEDIITYILIGIGIGVGIGFVLKIFLDTYIIIESLPL |
| Ga0209634_10547166 | 3300025138 | Marine | MSSNDDKITMICIGIAIGIGIGFVLKVFVDTYIIIQGLPV |
| Ga0209634_11636072 | 3300025138 | Marine | MSKMTEQEDTITYILIGIGIGVGIGFVLKVFVDTYVIIKGLPLXKP |
| Ga0209634_12802193 | 3300025138 | Marine | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFMDTYALIERLPL |
| Ga0209645_10079493 | 3300025151 | Marine | MIKNTQHEDVITYIAIGMGLGVPIGFVLKSFLDTYMLIQTLPI |
| Ga0209645_101389810 | 3300025151 | Marine | QHEDAITCILIGIGLGVPIGFVLKTFLDTWAILESLPL |
| Ga0209337_12458872 | 3300025168 | Marine | MSKMTEQEDIITYILIGIGVGVGIGFVLKVFVDTYIIIKGLPLXTTS |
| Ga0209194_10967592 | 3300025632 | Pelagic Marine | MMKNTEHEDIITYILIGIGIGVGIGFVLKAFLDTYAIIERLPIXKP |
| Ga0208134_10486734 | 3300025652 | Aqueous | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYIIIESLPI |
| Ga0209632_104726143 | 3300025886 | Pelagic Marine | MMKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYTIIE |
| Ga0209815_11599712 | 3300027714 | Marine | MNNNDDLITMISIGVAIGIGIGFLLKVFVDTYFIIGSLPQ |
| Ga0209830_103828603 | 3300027791 | Marine | MSKMTEQEDIITYILIGIGVGVGIGFVLKVFVDTYVIIKGLPL |
| Ga0209091_100324845 | 3300027801 | Marine | MSKMTEQEDIITYILIGIGVGVGIGFVLKVFVDTYIIIKGLPL |
| Ga0183748_10152278 | 3300029319 | Marine | MLKNNQHEDAITCILIGIGLGVPIGFVLKTFLDTWTLLESLPL |
| Ga0183748_10645883 | 3300029319 | Marine | MLKNTQHEDIITYILIGIGLGVPIGFVLKVFLDTYAIIERLPL |
| Ga0183755_10211655 | 3300029448 | Marine | MKNTEHEDIITYILIGIGIGVGIGFVLKAFLDTYAIIERLPL |
| Ga0183755_11096121 | 3300029448 | Marine | MIKNTEHEDIITYILIGIGIGVGIGFVLKVFMDTYTIIESLPL |
| Ga0307488_100624297 | 3300031519 | Sackhole Brine | MSSNDDKITMICIGIAIGIGIGFVLKVFVDTYIIIQGLPVXKIY |
| Ga0315331_104389351 | 3300031774 | Seawater | EHEDIITYILIGIGIGVGIGFVLKVFMDTYVIVERLPI |
| Ga0310344_106028303 | 3300032006 | Seawater | MIKNTEHDDIITYILIGVGIGVGIGFVLKVFIDTYAIVERLPL |
| Ga0315316_102332693 | 3300032011 | Seawater | MKNTEHEDIITYILIGIGIGVGIGFVLKVFMDTYVIVERLPI |
| Ga0315315_102808934 | 3300032073 | Seawater | MKNTEHEDIITYILIGIGIGVGIGFVLKVFLDTYALIERLPL |
| ⦗Top⦘ |