


| Basic Information | |
|---|---|
| Family ID | F040330 |
| Family Type | Metagenome |
| Number of Sequences | 162 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSKAEKAFELQEKIGKLIDKLDELGFEFMYFNFTSSIRRKRK |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 162 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 83.95 % |
| % of genes near scaffold ends (potentially truncated) | 16.05 % |
| % of genes from short scaffolds (< 2000 bps) | 54.94 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.086 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (45.679 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.222 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.827 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.00% β-sheet: 17.14% Coil/Unstructured: 52.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 162 Family Scaffolds |
|---|---|---|
| PF13481 | AAA_25 | 5.56 |
| PF02086 | MethyltransfD12 | 5.56 |
| PF03237 | Terminase_6N | 4.94 |
| PF00166 | Cpn10 | 4.94 |
| PF03796 | DnaB_C | 4.32 |
| PF06378 | DUF1071 | 2.47 |
| PF04404 | ERF | 1.85 |
| PF14090 | HTH_39 | 1.23 |
| PF12705 | PDDEXK_1 | 1.23 |
| PF00899 | ThiF | 1.23 |
| PF11351 | GTA_holin_3TM | 1.23 |
| PF13884 | Peptidase_S74 | 1.23 |
| PF00149 | Metallophos | 0.62 |
| PF14464 | Prok-JAB | 0.62 |
| PF00772 | DnaB | 0.62 |
| PF11171 | DUF2958 | 0.62 |
| PF00145 | DNA_methylase | 0.62 |
| PF16754 | Pesticin | 0.62 |
| PF06067 | DUF932 | 0.62 |
| PF13539 | Peptidase_M15_4 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 162 Family Scaffolds |
|---|---|---|---|
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 5.56 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 5.56 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 4.94 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 4.94 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 4.32 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.09 % |
| All Organisms | root | All Organisms | 46.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000153|SI39nov09_135mDRAFT_c1041758 | Not Available | 689 | Open in IMG/M |
| 3300000947|BBAY92_10000089 | Not Available | 19258 | Open in IMG/M |
| 3300001355|JGI20158J14315_10003797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9921 | Open in IMG/M |
| 3300001450|JGI24006J15134_10000197 | All Organisms → cellular organisms → Bacteria | 43779 | Open in IMG/M |
| 3300001450|JGI24006J15134_10000475 | All Organisms → cellular organisms → Bacteria | 24873 | Open in IMG/M |
| 3300001450|JGI24006J15134_10000508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 24174 | Open in IMG/M |
| 3300001450|JGI24006J15134_10005299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 6736 | Open in IMG/M |
| 3300001450|JGI24006J15134_10013883 | All Organisms → Viruses | 3858 | Open in IMG/M |
| 3300001450|JGI24006J15134_10019930 | All Organisms → Viruses → Predicted Viral | 3100 | Open in IMG/M |
| 3300001460|JGI24003J15210_10000077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 37199 | Open in IMG/M |
| 3300001460|JGI24003J15210_10023220 | All Organisms → Viruses → Predicted Viral | 2336 | Open in IMG/M |
| 3300002483|JGI25132J35274_1024290 | Not Available | 1410 | Open in IMG/M |
| 3300004097|Ga0055584_100030245 | Not Available | 5321 | Open in IMG/M |
| 3300004097|Ga0055584_102115379 | Not Available | 575 | Open in IMG/M |
| 3300005239|Ga0073579_1125238 | Not Available | 989 | Open in IMG/M |
| 3300005838|Ga0008649_10322611 | Not Available | 574 | Open in IMG/M |
| 3300006164|Ga0075441_10330957 | Not Available | 554 | Open in IMG/M |
| 3300006166|Ga0066836_10712752 | Not Available | 607 | Open in IMG/M |
| 3300006332|Ga0068500_1245121 | Not Available | 605 | Open in IMG/M |
| 3300006735|Ga0098038_1000057 | All Organisms → cellular organisms → Bacteria | 45706 | Open in IMG/M |
| 3300006735|Ga0098038_1008290 | All Organisms → Viruses → Predicted Viral | 4142 | Open in IMG/M |
| 3300006749|Ga0098042_1057522 | All Organisms → Viruses → Predicted Viral | 1041 | Open in IMG/M |
| 3300006751|Ga0098040_1000509 | Not Available | 17901 | Open in IMG/M |
| 3300006752|Ga0098048_1010305 | All Organisms → Viruses → Predicted Viral | 3325 | Open in IMG/M |
| 3300006754|Ga0098044_1161521 | Not Available | 894 | Open in IMG/M |
| 3300006789|Ga0098054_1000350 | Not Available | 33201 | Open in IMG/M |
| 3300006789|Ga0098054_1000566 | Not Available | 21922 | Open in IMG/M |
| 3300006789|Ga0098054_1147350 | Not Available | 870 | Open in IMG/M |
| 3300006789|Ga0098054_1371054 | Not Available | 505 | Open in IMG/M |
| 3300006790|Ga0098074_1166894 | Not Available | 559 | Open in IMG/M |
| 3300006793|Ga0098055_1012629 | All Organisms → Viruses → Predicted Viral | 3743 | Open in IMG/M |
| 3300006793|Ga0098055_1025971 | All Organisms → Viruses → Predicted Viral | 2456 | Open in IMG/M |
| 3300006793|Ga0098055_1028442 | Not Available | 2330 | Open in IMG/M |
| 3300006802|Ga0070749_10034747 | All Organisms → Viruses → Predicted Viral | 3121 | Open in IMG/M |
| 3300006802|Ga0070749_10309150 | Not Available | 885 | Open in IMG/M |
| 3300006802|Ga0070749_10445960 | Not Available | 710 | Open in IMG/M |
| 3300006802|Ga0070749_10504712 | Not Available | 659 | Open in IMG/M |
| 3300006810|Ga0070754_10302734 | Not Available | 717 | Open in IMG/M |
| 3300006810|Ga0070754_10422843 | Not Available | 581 | Open in IMG/M |
| 3300006916|Ga0070750_10178197 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300006916|Ga0070750_10211955 | Not Available | 853 | Open in IMG/M |
| 3300006920|Ga0070748_1000375 | All Organisms → cellular organisms → Bacteria | 22417 | Open in IMG/M |
| 3300006925|Ga0098050_1137235 | Not Available | 618 | Open in IMG/M |
| 3300006928|Ga0098041_1118980 | Not Available | 852 | Open in IMG/M |
| 3300007345|Ga0070752_1341049 | Not Available | 564 | Open in IMG/M |
| 3300007863|Ga0105744_1005147 | All Organisms → Viruses → Predicted Viral | 3492 | Open in IMG/M |
| 3300007956|Ga0105741_1020046 | All Organisms → Viruses → Predicted Viral | 1680 | Open in IMG/M |
| 3300008012|Ga0075480_10206140 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| 3300009104|Ga0117902_1001075 | All Organisms → cellular organisms → Bacteria | 51053 | Open in IMG/M |
| 3300009124|Ga0118687_10020510 | All Organisms → Viruses → Predicted Viral | 2163 | Open in IMG/M |
| 3300009173|Ga0114996_10015909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 7802 | Open in IMG/M |
| 3300009173|Ga0114996_10165246 | Not Available | 1812 | Open in IMG/M |
| 3300009173|Ga0114996_10470918 | Not Available | 952 | Open in IMG/M |
| 3300009420|Ga0114994_10087974 | All Organisms → Viruses → Predicted Viral | 2117 | Open in IMG/M |
| 3300009420|Ga0114994_10951983 | Not Available | 556 | Open in IMG/M |
| 3300009437|Ga0115556_1023485 | All Organisms → Viruses → Predicted Viral | 2876 | Open in IMG/M |
| 3300009505|Ga0115564_10452708 | Not Available | 622 | Open in IMG/M |
| 3300009593|Ga0115011_10003543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 10627 | Open in IMG/M |
| 3300009593|Ga0115011_10033582 | All Organisms → Viruses → Predicted Viral | 3457 | Open in IMG/M |
| 3300009593|Ga0115011_10152600 | All Organisms → Viruses → Predicted Viral | 1676 | Open in IMG/M |
| 3300009593|Ga0115011_10275644 | Not Available | 1271 | Open in IMG/M |
| 3300009593|Ga0115011_10484945 | Not Available | 978 | Open in IMG/M |
| 3300009705|Ga0115000_10481513 | Not Available | 783 | Open in IMG/M |
| 3300010148|Ga0098043_1129733 | Not Available | 722 | Open in IMG/M |
| 3300010150|Ga0098056_1021847 | All Organisms → Viruses → Predicted Viral | 2279 | Open in IMG/M |
| 3300010151|Ga0098061_1294262 | Not Available | 559 | Open in IMG/M |
| 3300010153|Ga0098059_1226179 | Not Available | 725 | Open in IMG/M |
| 3300010883|Ga0133547_10050565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 9748 | Open in IMG/M |
| 3300010883|Ga0133547_10167397 | All Organisms → Viruses → Predicted Viral | 4738 | Open in IMG/M |
| 3300010883|Ga0133547_10722051 | All Organisms → Viruses → Predicted Viral | 1970 | Open in IMG/M |
| 3300012920|Ga0160423_10235135 | All Organisms → Viruses → Predicted Viral | 1271 | Open in IMG/M |
| 3300012920|Ga0160423_10240597 | Not Available | 1254 | Open in IMG/M |
| 3300012953|Ga0163179_10013992 | Not Available | 5257 | Open in IMG/M |
| 3300013098|Ga0164320_10482673 | Not Available | 628 | Open in IMG/M |
| 3300017714|Ga0181412_1000700 | Not Available | 13719 | Open in IMG/M |
| 3300017714|Ga0181412_1040239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1220 | Open in IMG/M |
| 3300017740|Ga0181418_1170767 | Not Available | 520 | Open in IMG/M |
| 3300017760|Ga0181408_1104642 | Not Available | 736 | Open in IMG/M |
| 3300017768|Ga0187220_1264747 | Not Available | 513 | Open in IMG/M |
| 3300017771|Ga0181425_1000826 | Not Available | 11877 | Open in IMG/M |
| 3300017771|Ga0181425_1002209 | Not Available | 7135 | Open in IMG/M |
| 3300017773|Ga0181386_1187584 | Not Available | 625 | Open in IMG/M |
| 3300017818|Ga0181565_10937777 | Not Available | 538 | Open in IMG/M |
| 3300017956|Ga0181580_10420701 | Not Available | 886 | Open in IMG/M |
| 3300017962|Ga0181581_10596618 | Not Available | 673 | Open in IMG/M |
| 3300017967|Ga0181590_10176284 | All Organisms → Viruses → Predicted Viral | 1620 | Open in IMG/M |
| 3300018420|Ga0181563_10228386 | All Organisms → Viruses → Predicted Viral | 1120 | Open in IMG/M |
| 3300018424|Ga0181591_10216084 | All Organisms → Viruses → Predicted Viral | 1500 | Open in IMG/M |
| 3300018424|Ga0181591_10344534 | All Organisms → Viruses → Predicted Viral | 1124 | Open in IMG/M |
| 3300019751|Ga0194029_1050772 | Not Available | 684 | Open in IMG/M |
| 3300020258|Ga0211529_1005089 | All Organisms → Viruses → Predicted Viral | 2166 | Open in IMG/M |
| 3300020258|Ga0211529_1089864 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 518 | Open in IMG/M |
| 3300020294|Ga0211520_1018447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1127 | Open in IMG/M |
| 3300020310|Ga0211515_1017861 | Not Available | 1479 | Open in IMG/M |
| 3300020411|Ga0211587_10045217 | All Organisms → Viruses → Predicted Viral | 2032 | Open in IMG/M |
| 3300020421|Ga0211653_10022718 | All Organisms → Viruses → Predicted Viral | 2953 | Open in IMG/M |
| 3300020440|Ga0211518_10258008 | Not Available | 836 | Open in IMG/M |
| 3300020455|Ga0211664_10000210 | Not Available | 54707 | Open in IMG/M |
| 3300020457|Ga0211643_10034195 | All Organisms → Viruses → Predicted Viral | 2562 | Open in IMG/M |
| 3300020459|Ga0211514_10068004 | Not Available | 1798 | Open in IMG/M |
| 3300020465|Ga0211640_10526787 | Not Available | 642 | Open in IMG/M |
| 3300020469|Ga0211577_10522995 | Not Available | 716 | Open in IMG/M |
| 3300020471|Ga0211614_10000345 | All Organisms → cellular organisms → Bacteria | 20032 | Open in IMG/M |
| 3300020471|Ga0211614_10201403 | Not Available | 862 | Open in IMG/M |
| 3300020472|Ga0211579_10000183 | Not Available | 51782 | Open in IMG/M |
| 3300020472|Ga0211579_10541509 | Not Available | 654 | Open in IMG/M |
| 3300020472|Ga0211579_10593083 | Not Available | 621 | Open in IMG/M |
| 3300021335|Ga0213867_1001104 | Not Available | 12028 | Open in IMG/M |
| 3300021368|Ga0213860_10025296 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2480 | Open in IMG/M |
| 3300021957|Ga0222717_10238255 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
| 3300021958|Ga0222718_10007220 | Not Available | 8704 | Open in IMG/M |
| 3300021959|Ga0222716_10020521 | All Organisms → Viruses → Predicted Viral | 4905 | Open in IMG/M |
| 3300022072|Ga0196889_1029111 | Not Available | 1124 | Open in IMG/M |
| 3300022200|Ga0196901_1103931 | Not Available | 988 | Open in IMG/M |
| 3300025084|Ga0208298_1000163 | Not Available | 30298 | Open in IMG/M |
| 3300025086|Ga0208157_1000714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 17030 | Open in IMG/M |
| 3300025096|Ga0208011_1000062 | Not Available | 52649 | Open in IMG/M |
| 3300025103|Ga0208013_1083264 | Not Available | 824 | Open in IMG/M |
| 3300025108|Ga0208793_1041548 | Not Available | 1462 | Open in IMG/M |
| 3300025108|Ga0208793_1070659 | Not Available | 1027 | Open in IMG/M |
| 3300025110|Ga0208158_1030187 | All Organisms → Viruses → Predicted Viral | 1386 | Open in IMG/M |
| 3300025110|Ga0208158_1149708 | Not Available | 530 | Open in IMG/M |
| 3300025120|Ga0209535_1000160 | All Organisms → cellular organisms → Bacteria | 43641 | Open in IMG/M |
| 3300025120|Ga0209535_1001135 | All Organisms → cellular organisms → Bacteria | 18266 | Open in IMG/M |
| 3300025132|Ga0209232_1006354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 5159 | Open in IMG/M |
| 3300025138|Ga0209634_1041968 | All Organisms → Viruses → Predicted Viral | 2323 | Open in IMG/M |
| 3300025151|Ga0209645_1002610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 8484 | Open in IMG/M |
| 3300025151|Ga0209645_1056724 | All Organisms → Viruses → Predicted Viral | 1358 | Open in IMG/M |
| 3300025168|Ga0209337_1000174 | Not Available | 51989 | Open in IMG/M |
| 3300025168|Ga0209337_1000509 | All Organisms → cellular organisms → Bacteria | 31399 | Open in IMG/M |
| 3300025168|Ga0209337_1000654 | All Organisms → cellular organisms → Bacteria | 27928 | Open in IMG/M |
| 3300025168|Ga0209337_1000993 | Not Available | 22077 | Open in IMG/M |
| 3300025168|Ga0209337_1098291 | All Organisms → Viruses → Predicted Viral | 1371 | Open in IMG/M |
| 3300025270|Ga0208813_1010582 | All Organisms → Viruses → Predicted Viral | 2664 | Open in IMG/M |
| 3300025280|Ga0208449_1012281 | All Organisms → Viruses → Predicted Viral | 2946 | Open in IMG/M |
| 3300025577|Ga0209304_1038488 | All Organisms → Viruses → Predicted Viral | 1337 | Open in IMG/M |
| 3300025626|Ga0209716_1001070 | Not Available | 21878 | Open in IMG/M |
| 3300025667|Ga0209043_1161723 | Not Available | 546 | Open in IMG/M |
| 3300025769|Ga0208767_1099787 | All Organisms → Viruses → Predicted Viral | 1166 | Open in IMG/M |
| 3300025822|Ga0209714_1038091 | All Organisms → Viruses → Predicted Viral | 1663 | Open in IMG/M |
| 3300025892|Ga0209630_10423220 | Not Available | 569 | Open in IMG/M |
| 3300027779|Ga0209709_10284439 | Not Available | 713 | Open in IMG/M |
| 3300027827|Ga0209035_10017159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 3343 | Open in IMG/M |
| 3300027838|Ga0209089_10020462 | All Organisms → Viruses → Predicted Viral | 4660 | Open in IMG/M |
| 3300027844|Ga0209501_10547374 | Not Available | 654 | Open in IMG/M |
| 3300027906|Ga0209404_10000598 | Not Available | 27900 | Open in IMG/M |
| 3300027906|Ga0209404_10001522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 15445 | Open in IMG/M |
| 3300027906|Ga0209404_10006294 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 6689 | Open in IMG/M |
| 3300027906|Ga0209404_10018844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 3794 | Open in IMG/M |
| 3300027906|Ga0209404_10153459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1403 | Open in IMG/M |
| 3300027906|Ga0209404_10162203 | Not Available | 1367 | Open in IMG/M |
| 3300027906|Ga0209404_10401033 | Not Available | 893 | Open in IMG/M |
| 3300029448|Ga0183755_1000103 | All Organisms → cellular organisms → Bacteria | 44311 | Open in IMG/M |
| 3300029448|Ga0183755_1004604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 6575 | Open in IMG/M |
| 3300029448|Ga0183755_1013769 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 2992 | Open in IMG/M |
| 3300029448|Ga0183755_1021336 | All Organisms → Viruses → Predicted Viral | 2130 | Open in IMG/M |
| 3300029448|Ga0183755_1027778 | Not Available | 1723 | Open in IMG/M |
| 3300031519|Ga0307488_10324706 | Not Available | 981 | Open in IMG/M |
| 3300032011|Ga0315316_10413075 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
| 3300032011|Ga0315316_11210744 | Not Available | 606 | Open in IMG/M |
| 3300032032|Ga0315327_10766587 | Not Available | 587 | Open in IMG/M |
| 3300032130|Ga0315333_10523477 | Not Available | 556 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 45.68% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 14.20% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.64% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.94% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.32% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.09% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.47% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.47% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.85% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.85% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.23% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.23% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.23% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.23% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.62% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.62% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.62% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.62% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.62% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.62% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.62% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.62% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000153 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 135m | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007863 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2um | Environmental | Open in IMG/M |
| 3300007956 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2um | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020258 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556061-ERR598949) | Environmental | Open in IMG/M |
| 3300020294 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556124-ERR599153) | Environmental | Open in IMG/M |
| 3300020310 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX556067-ERR598950) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020455 | Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025667 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027827 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032130 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SI39nov09_135mDRAFT_10417582 | 3300000153 | Marine | MSKAEKAFELQERIGRLIDKLDALGFEFMYFNFTSSIRRKRK* |
| BBAY92_1000008911 | 3300000947 | Macroalgal Surface | MSDAEKAFDLQEKIAKLIDKLNELGFEYMYYNNISSIRRKRK* |
| JGI20158J14315_1000379715 | 3300001355 | Pelagic Marine | MSKSEKAFELQERIGRLIVKLDKLGFEFMYYNHQSSIRRKRDKSESK* |
| JGI24006J15134_1000019716 | 3300001450 | Marine | MAKKKNEGNAEKAFELQERIGSLIDKLDALGFDFMYFNYQSSIRRKRR* |
| JGI24006J15134_1000047521 | 3300001450 | Marine | VSKAEKAFKIQEQISKLITKLEKLGFEFMFYNSQSSIRRKR* |
| JGI24006J15134_100005085 | 3300001450 | Marine | MSKAEKAFELQEKIGKIIDKLNELGFEFMYFNNISSIRRKRNGK* |
| JGI24006J15134_100052992 | 3300001450 | Marine | MSKSDKAFELQEKIGKLIDKLNALGFEYMYFNSKSSIRRLRK* |
| JGI24006J15134_100138832 | 3300001450 | Marine | MSKSDQALDIQEQIGRKIDKLNKLGYEFLYYNNITSIRRKSKERK* |
| JGI24006J15134_100199301 | 3300001450 | Marine | MSKSEKAFELQEEIGRKIIELEELGFEFMWYNRISSIRRL |
| JGI24003J15210_1000007729 | 3300001460 | Marine | MSKAEKAFELQEKIGKLIDKLSNLGFEFMYFNNISSIRRKRDEKRR* |
| JGI24003J15210_100232202 | 3300001460 | Marine | MKPNKSDKALQLQEKIQKQIDKLEKLGFEFMYHNRISSIRRLRNDKR* |
| JGI25132J35274_10242904 | 3300002483 | Marine | MTEIGYNKAEKAFELQEKIAKLIDRLDNLGFEYMYFNNISSIRRKRNDKKK* |
| Ga0055584_1000302456 | 3300004097 | Pelagic Marine | MERKSNGEQALDIQEKIDKHISKLNKLGFEFMFYNNISSIRRKR* |
| Ga0055584_1021153792 | 3300004097 | Pelagic Marine | MSKSDEAFLIQEKISKLIDKLDKLGFEFMYFNMQSSIRRKRK* |
| Ga0073579_11252382 | 3300005239 | Marine | MSKAEKAFELQEKIGRLIDKLDALGFEFMYFNFTSSIRRKRK* |
| Ga0008649_103226112 | 3300005838 | Marine | MSKAEKAFELQERIGRLIDKLDALGFEFMYFNFTSSIRRKRK*NA* |
| Ga0075441_103309571 | 3300006164 | Marine | MSKSEKAFELQEKIGKLIDRLDALGFEFLYFNFVSSIRRKRK* |
| Ga0066836_107127521 | 3300006166 | Marine | MNEEAKKYEEAFKLQERIGKLIDKLDKLGFEFMFYNQQSSIRRKREK* |
| Ga0068500_12451211 | 3300006332 | Marine | MSDAEKAFDLQEKIAKLIDKLNELGFEYMYYNSISSIRRKRNYGKRKTDR* |
| Ga0098038_100005712 | 3300006735 | Marine | MSASEKALNIQEKIQKQIDKLSDLGFEFMYYNGISSIRRKREKNNR* |
| Ga0098038_10082904 | 3300006735 | Marine | MNASDKALEIQEKIQKQIDKLEKLGFEFMYHNRISSIRRLRNDR* |
| Ga0098042_10575223 | 3300006749 | Marine | MSDAEKAFDLQEKIAKLIDKLDELGFEYMYYNNISSIRRKRKN* |
| Ga0098040_10005094 | 3300006751 | Marine | MNKEAKKYEEAFRLQERIGKLIDKLDKLGFEFMFYNQQSSIRRRREK* |
| Ga0098048_10103053 | 3300006752 | Marine | MNEEAKKYEEAFRLQERIGKLIDKLDKLGFEFMFYNQQSSIRRKREK* |
| Ga0098044_11615214 | 3300006754 | Marine | MSTSEKAFEIQEKIGKLIDKLDKLGFEFMFYNHQSSIRRK |
| Ga0098054_100035018 | 3300006789 | Marine | MSKSEKAFEIQERIGKLIDKLDKLGFEFMFYNRQSSIRRKRDKSEYK* |
| Ga0098054_10005662 | 3300006789 | Marine | MSDAEKAFKLQEKIANLIDKLDELGFEYMYFNNISSIRRKRDYGKRKTNR* |
| Ga0098054_11473504 | 3300006789 | Marine | MSKAEKAFKLQEKIGELIGELEKLGFEFMFFNNQSSIRR |
| Ga0098054_13710542 | 3300006789 | Marine | MKSKSEQALDLQEVIQKKIDKLSKLGFEFMYYNNITSIRRKR* |
| Ga0098074_11668943 | 3300006790 | Marine | MSKSDEAFLIQEKISKLIEKLDKLGFEFMFFNMQ* |
| Ga0098055_101262910 | 3300006793 | Marine | MSKSEKAFEIQERIGKLIDKLDKLGFEFMFYNHQSSIRRKR* |
| Ga0098055_10259715 | 3300006793 | Marine | MSKSEKAFEIQEKIGRLIEKLDKLGFEFMFYNNKSSIRRKR* |
| Ga0098055_10284425 | 3300006793 | Marine | MKSKSERALDLQEKIQKKINKLKDLGFEFMYYNGISSIRRDRK* |
| Ga0070749_100347478 | 3300006802 | Aqueous | MSKSDEAFLLQEKISKLIDKLDKLGFEFMYFNMQSSIRRKRK* |
| Ga0070749_103091503 | 3300006802 | Aqueous | MSKSDEAFLIQEKISKLIEKLDKLGFEFMFFNMQSSIRRKRK*KKKKI* |
| Ga0070749_104459602 | 3300006802 | Aqueous | MSKSDEAFLIQEKISKLIDKLDKLGFEFMFFNMQSSIRRKRRNNE* |
| Ga0070749_105047123 | 3300006802 | Aqueous | MSKSDEAFLIQEKISKLIEKLDKLGFEFMFFNMQSSIRRKRK* |
| Ga0070754_103027342 | 3300006810 | Aqueous | MTEIGYNKAEKAFELQEKIAKLIDRLDDLGFEYMYFNNISSIRRKRNDKKK* |
| Ga0070754_104228433 | 3300006810 | Aqueous | SKSDEAFLLQEKISKLIDKLDKLGFEFMYFNMQSSIRRKRK*KKYKTI* |
| Ga0070750_101781974 | 3300006916 | Aqueous | MTKIGYNKAEKAFELQEKIAKLIDRLDDLGFEYMYFNNISSIRRKRNDKKK* |
| Ga0070750_102119551 | 3300006916 | Aqueous | EKAFELQEKIAKLIDKLDELGFEYMYFNSISSIRRKREPKS* |
| Ga0070748_100037517 | 3300006920 | Aqueous | MSKSDEAFLIQEKISKLIDKLDNLGFEFMYFNMQSSIRRKRK* |
| Ga0098050_11372351 | 3300006925 | Marine | MSKAEKAFEIQEEIGKKIDELEKLGFEFMFYNSISSIR |
| Ga0098041_11189802 | 3300006928 | Marine | MSKSEKAFEIQEKIGKLIDKLDKLGFEFMFYNHQSSIRRKR* |
| Ga0070752_13410493 | 3300007345 | Aqueous | MSKSDEAFLIQEKISKLIEKLDKLGFEFMFFNMQSSIRRKR |
| Ga0105744_10051477 | 3300007863 | Estuary Water | MSKAEKAFEIQEKIGKLIDKLDALGFEFMYFNFTSSIRRKRK* |
| Ga0105741_10200462 | 3300007956 | Estuary Water | MSKAEKAFELQEKIGKLIDKLDALGFEFMYFNFTSSIRRKRK* |
| Ga0075480_102061404 | 3300008012 | Aqueous | MSKSDEAFLIQEKISKLIEKLDKLGFEFMYFNMQSSIRRKRK*KKKI* |
| Ga0117902_100107537 | 3300009104 | Marine | MSKSEKAFEIQEKIGKLIEKLDKLGFEFMFYNHQSSIRRKR* |
| Ga0118687_100205104 | 3300009124 | Sediment | MSKSDEAFKLQEKISKLIDKLDNLGFEFMYFNMQSSIRRKRK* |
| Ga0114996_100159096 | 3300009173 | Marine | MSKSDKAFALQEKIGKLIDKLDELGFEFMYFNFTSSIRRKRK* |
| Ga0114996_101652464 | 3300009173 | Marine | MSKSDKAFELQERIGRLIDKLDALGFEFMYFNFTSSIRRKRK* |
| Ga0114996_104709184 | 3300009173 | Marine | MSKSDKAFELQEKIGKLIDKLDALGFEFMYFNFTSSIRRKRK* |
| Ga0114994_100879744 | 3300009420 | Marine | MSKSDKAFELQEKIGKLIDKLNALGFEYMYFNSKSSIRRIRK* |
| Ga0114994_109519832 | 3300009420 | Marine | VSKAEKAFELQERIGRLIDKLDALGFEFMYFNFTSSIRRKRK* |
| Ga0115556_10234853 | 3300009437 | Pelagic Marine | MSKSDEAFLLQEKISKLIDKLDKLGFEFMFFNMQSSIRRKRK* |
| Ga0115564_104527083 | 3300009505 | Pelagic Marine | MSKSEKAFELQEEIGRKIIELEELGFEFMWYNRIS |
| Ga0115011_100035439 | 3300009593 | Marine | MKSKSEKALDLQEAIQKKIDKLSKLGFEFMYYNNITSIRRKR* |
| Ga0115011_100335826 | 3300009593 | Marine | MSDAEKAFDLQEKIAKLIDKLNELGFEYMYYNQISSIRRKRDYGKRKTNR* |
| Ga0115011_101526003 | 3300009593 | Marine | MTKKNKSRAEQAFDIQERIGRQIDKLHELGFEYMYHNYISSIRRLRKKNGKT* |
| Ga0115011_102756441 | 3300009593 | Marine | MSDAEKAFDLQEKIAKLIDKLDELGFEYIYYNNISSIRRKRKK* |
| Ga0115011_104849451 | 3300009593 | Marine | RKRMSKAEKAFKLQEKIGELIGELEKLGFEFMFFNNQSSIRRKR* |
| Ga0115000_104815133 | 3300009705 | Marine | MSKSDKAFEIQEEIGRKIEELEDLGFEFMWHNRI* |
| Ga0098043_11297331 | 3300010148 | Marine | MSNAEKAFDLQEKIAKLIDKLDELGFEYMYYNNISSIRRKRKN* |
| Ga0098056_10218473 | 3300010150 | Marine | MSKAEKAFKLQEKIGELIGELEKLGFEFMFFNNQSSIRRKR* |
| Ga0098061_12942621 | 3300010151 | Marine | AFDIQERIGRQIDKLHGLGFEYMYHNYISSIRRLRKKNGKT* |
| Ga0098059_12261792 | 3300010153 | Marine | MTKKNKSRAEQAFDIQERIGRQIDKLHGLGFEYMYHNYISSIRRLRKKNGKT* |
| Ga0133547_1005056514 | 3300010883 | Marine | MSKSDKAFALQEKIGKLIDKLDALGFEFMYFNFTSSIRRKRK* |
| Ga0133547_1016739712 | 3300010883 | Marine | MSKSDKAFEIQEEIGRKIEELEDLGFEFMWHNRIS |
| Ga0133547_107220511 | 3300010883 | Marine | MSKSDKAFELQERIGRLIDKLDALGYEFMYFNSKSSIRRIRK* |
| Ga0160423_102351353 | 3300012920 | Surface Seawater | MSDAEKAFDLQEKIAKLIDKLNELGFEYMYYNNISSIRRKRKN* |
| Ga0160423_102405973 | 3300012920 | Surface Seawater | ISKGEQALDIQEKIDKLIDKLEKLGFEFMWYNRISGIRRKRDNV* |
| Ga0163179_1001399210 | 3300012953 | Seawater | MSKAEKAFELQEKIGKLIDKLDELGFEFMYFNFTSSIRRKRK* |
| Ga0164320_104826731 | 3300013098 | Marine Sediment | ALQEKIGKLIDKLDALGFEFMYFNFTSSIRRKRK* |
| Ga0181412_10007005 | 3300017714 | Seawater | MSKSEKAFEIQEKIGKLIDRLDKLGFEFMFFNQQSSIRRKRK |
| Ga0181412_10402391 | 3300017714 | Seawater | MNASDKALEIQEKIQKQIDKLERLGFEFMYHNRISSIRRLRNDR |
| Ga0181418_11707672 | 3300017740 | Seawater | MSKAEKAFELQEKIGKLIDKLDALGFEFMYFNFTSSIRRKRK |
| Ga0181408_11046422 | 3300017760 | Seawater | MAKKKTSNADKAFDIQEKIGKQIDKLHDLGFEYMYHNYISSIRRLRKKNGKT |
| Ga0187220_12647471 | 3300017768 | Seawater | EKAFELQERIGRLIVKLDKLGFEFMYYNHQSSIRRKRDNSESK |
| Ga0181425_100082623 | 3300017771 | Seawater | MSKSEKAFEIQEKIGKLIDRLDKLGFEFMFFNQQSSIRRKR |
| Ga0181425_100220921 | 3300017771 | Seawater | SKSEKAFEIQEKIGKLIDRLDKLGFEFMFFNQQSSIRRKRK |
| Ga0181386_11875842 | 3300017773 | Seawater | MSKSEKAFELQEKIGRLIDKLDKLGFEFMYYNHQSSIRRKRDKSESK |
| Ga0181565_109377773 | 3300017818 | Salt Marsh | MSKSDEAFLIQEKISKLIDKLDKLGFEFMYFNMQTSIRRKRK |
| Ga0181580_104207014 | 3300017956 | Salt Marsh | MSKSDEAFLIQEKISKLIEKLDKLGFEFMFFNMQSSIRRKRKXK |
| Ga0181581_105966181 | 3300017962 | Salt Marsh | MSKSDESFLIQEKISKFIDKLDKLGFEFMYFNMQSSIRRKRK |
| Ga0181590_101762843 | 3300017967 | Salt Marsh | MSKSDEAFLIQEKISKLIDKLDKLGFEFMYFNMQSSIRRKRK |
| Ga0181563_102283864 | 3300018420 | Salt Marsh | MSKSDEAFLIQEKISKLIEKLDKLGFEFMFFNMQSSIRRKRK |
| Ga0181591_102160842 | 3300018424 | Salt Marsh | MSKSDEAFLIQEKISKLIDKLDKLGFEFMYFNMQSSIRRKRKXKKKI |
| Ga0181591_103445344 | 3300018424 | Salt Marsh | MSKSDEAFLIQEKISKLIDKLDKLGFEFMFFNMQPSIRRKRK |
| Ga0194029_10507723 | 3300019751 | Freshwater | MSKSDEAFLLQEKISKLIDKLDKLGFEFMYFNMQSSIRRKRK |
| Ga0211529_10050893 | 3300020258 | Marine | MSDAEKAFDLQEKIAKLIDKLNELGFEYMYYNNISSIRRKRK |
| Ga0211529_10898641 | 3300020258 | Marine | MSKIDTDKANKAFELQEKISKLIDKLDDLGFEFMFYNQISSVRRKRNVRRSNKVNT |
| Ga0211520_10184472 | 3300020294 | Marine | MSDAEKAFDLQEKIAKLIDKLNELGFEYMYYNQISSIRRKRKK |
| Ga0211515_10178615 | 3300020310 | Marine | MSNAEKAFDLQEKIAKLIDKLNELGFDYMYYNQISSIRRKRNHGKRKTNR |
| Ga0211587_100452175 | 3300020411 | Marine | MSDAEKAFDLQEKISKLIDKLNELGFEYMYYNNISSIRRKRDYEKRKTNR |
| Ga0211653_100227185 | 3300020421 | Marine | MNASDKALEIQEKIQKQIDKLEKLGFEFMYHNRISSIRRLRNDR |
| Ga0211518_102580083 | 3300020440 | Marine | MSKEAFLIKEKISKLIDKLDKLGFEFMYFNMQSSIRRKRK |
| Ga0211664_1000021026 | 3300020455 | Marine | MSDAEKAFDLQEKIAKLIDKLDELGFEYMYYNNISSIRRKRDYGKRKTDR |
| Ga0211643_100341956 | 3300020457 | Marine | MSDAEKAFDLQERIAKLIDKLNELGFEYMYYNNISSIRRKRKK |
| Ga0211514_100680043 | 3300020459 | Marine | MAKKNISNADKAFDIQERIGKLIDKLDALGFEYMYYNAKSSIRRKRDNRG |
| Ga0211640_105267873 | 3300020465 | Marine | KAFDLQEKIAKLIDKLDELGFEYMYYNNISSIRRKRDYGKRKTDR |
| Ga0211577_105229951 | 3300020469 | Marine | MSKSEKAFELQEKIGRLIDKLDKLGFEFMYYNHQSSIRRKRDNSESK |
| Ga0211614_1000034514 | 3300020471 | Marine | MTKIGYNKAEKAFELQEKIAKLIDRLDDLGFEYMYFNNISSIRRKRNG |
| Ga0211614_102014032 | 3300020471 | Marine | MSDAEKAFDLQEKISKLIDKLNELGFEYMYYNNISSIRRKRNYGKRKTNR |
| Ga0211579_1000018325 | 3300020472 | Marine | MSDAEKAFDLQEKIAKLIDKLNELGFDYMYYNQISSIRRKREK |
| Ga0211579_105415092 | 3300020472 | Marine | MKTKSEQALDLQEVIQKKIDKLNKLGFEFMYYNNISSIRRKR |
| Ga0211579_105930832 | 3300020472 | Marine | MSDAEKAFDLQERIAKLIDKLDELGFEYMYYNNISSIRRKRKK |
| Ga0213867_100110413 | 3300021335 | Seawater | MSKSDEAFLIQEKISKLIDKLDNLGFEFMYFNMQSSIRRKRK |
| Ga0213860_100252963 | 3300021368 | Seawater | MTKIGYNKAEKAFELQEKIAKLIDKLDELGFEYMYFNSISSIRRKREPKS |
| Ga0222717_102382552 | 3300021957 | Estuarine Water | MSKSEKAFEIQEKIGKLIDRLDKLGFEFMFFNQQSSIRRKRNEK |
| Ga0222718_100072209 | 3300021958 | Estuarine Water | MSKSDEAFKLQEKISKLIDKLDNLGFEFMYFNMQSSIRRKRK |
| Ga0222716_1002052110 | 3300021959 | Estuarine Water | MSKSDEAFKLQEKISKLIDKLDNLGFEFMYFNMQSSIRRKRKXKKYKTI |
| Ga0196889_10291111 | 3300022072 | Aqueous | EAFLIQEKISKLIDKLDNLGFEFMYFNMQSSIRRKRK |
| Ga0196901_11039312 | 3300022200 | Aqueous | MSKSDEAFLIQEKISKLIDKLDKLGFEFMFFNMQSSIRRKRRNNE |
| Ga0208298_100016326 | 3300025084 | Marine | MSDAEKAFKLQEKIANLIDKLDELGFEYMYFNNISSIRRKRDYGKRKTNR |
| Ga0208157_100071417 | 3300025086 | Marine | MSASEKALNIQEKIQKQIDKLSDLGFEFMYYNGISSIRRKREKNNR |
| Ga0208011_100006223 | 3300025096 | Marine | MNKEAKKYEEAFRLQERIGKLIDKLDKLGFEFMFYNQQSSIRRRREK |
| Ga0208013_10832644 | 3300025103 | Marine | MSKAEKAFEIQEEIGKKIDELEKLGFEFMFYNRISSIR |
| Ga0208793_10415485 | 3300025108 | Marine | MKSKSERALDLQEKIQKKINKLKDLGFEFMYYNGISSIRRDRK |
| Ga0208793_10706595 | 3300025108 | Marine | MSKSEKAFEIQERIGKLIDKLDKLGFEFMFYNHQSSIRRKR |
| Ga0208158_10301874 | 3300025110 | Marine | MSKAEKAFKLQEKIGELIGELEKLGFEFMFFNNQSSIRRKR |
| Ga0208158_11497082 | 3300025110 | Marine | MSKSEKAFEIQEKIGKLIDKLDKLGFEFMFYNHQSSIRRKR |
| Ga0209535_100016029 | 3300025120 | Marine | MSKAEKAFELQERIGKLIDKLSNLGFEFMYFNNISSIRRKRDEKRR |
| Ga0209535_10011352 | 3300025120 | Marine | MKPNKSDKALQLQEKIQKQIDKLEKLGFEFMYHNRISSIRRLRNDKR |
| Ga0209232_10063544 | 3300025132 | Marine | MSDAEKAFDLQEKIAKLIDKLDELGFEYMYYNNISSIRRKRDYGKRKTNR |
| Ga0209634_10419682 | 3300025138 | Marine | MSKSEKAFELQEKIGKLIDRLDALGFEFLYFNFVSSIRRKRK |
| Ga0209645_100261015 | 3300025151 | Marine | MTEIGYNKAEKAFELQEKIAKLIDRLDNLGFEYMYFNNISSIRRKRNDKKK |
| Ga0209645_10567242 | 3300025151 | Marine | MSDAEKAFDLQERIAKLIDKLNELGFEYMYYNNISSIRRKRDYGKRKTNR |
| Ga0209337_100017455 | 3300025168 | Marine | MSKAEKAFELQERIGRLIDKLDALGFEFMYFNFTSSIRRKRK |
| Ga0209337_100050931 | 3300025168 | Marine | MSKSDKAFELQEKIGKLIDKLNALGFEYMYFNSKSSIRRLRK |
| Ga0209337_100065422 | 3300025168 | Marine | VSKAEKAFKIQEQISKLITKLEKLGFEFMFYNSQSSIRRKR |
| Ga0209337_100099330 | 3300025168 | Marine | MSKSDQALDIQEQIGRKIDKLNKLGYEFLYYNNITSIRRKSKERK |
| Ga0209337_10982913 | 3300025168 | Marine | MSKSEKAFELQEKIGKLIDKLDALGFEFLYFNFVSSIRRKRK |
| Ga0208813_10105826 | 3300025270 | Deep Ocean | MSKSEKAFELQERIGKLIDKLDKLGFEFMYFNHQSSIRRKRDKSESK |
| Ga0208449_10122819 | 3300025280 | Deep Ocean | MSKSEKAFELQERIGKLIDKLDKLGFEFMYFNHQSSIRRKRDKSE |
| Ga0209304_10384882 | 3300025577 | Pelagic Marine | MERKSNGEQALDIQEKIDKHISKLNKLGFEFMFYNNISSIRRKR |
| Ga0209716_10010704 | 3300025626 | Pelagic Marine | MSKSEKAFELQERIGRLIVKLDKLGFEFMYYNHQSSIRRKRDKSESK |
| Ga0209043_11617231 | 3300025667 | Marine | MSKAEKAFELQERIGRLIDKLDALGFEFMYFNFTSSI |
| Ga0208767_10997874 | 3300025769 | Aqueous | MSKSDEAFLIQEKISKLIEKLDKLGFEFMFFNMQSSIRRKRKXKKKKI |
| Ga0209714_10380912 | 3300025822 | Pelagic Marine | MSKSDEAFLLQEKISKLIDKLDKLGFEFMFFNMQSSIRRKRK |
| Ga0209630_104232202 | 3300025892 | Pelagic Marine | MSKSDEAFLLQEKISKLIEKLDKLGFEFMFFNMQSSIRRKRK |
| Ga0209709_102844393 | 3300027779 | Marine | MSKSDKAFELQEKIGKLIDKLNALGFEYMYFNSKSSIRRIRK |
| Ga0209035_100171592 | 3300027827 | Marine | MSKAEKAFELQEKIGRLIDKLDALGFEFMYFNFTSSIRRKRK |
| Ga0209089_1002046211 | 3300027838 | Marine | MSKSDKAFALQEKIGKLIDKLDELGFEFMYFNFTSSIRRKRK |
| Ga0209501_105473742 | 3300027844 | Marine | MSKSDKAFELQEKIGKLIDKLDALGFEFMYFNFTSSIRRKRK |
| Ga0209404_1000059828 | 3300027906 | Marine | MNEEAKKYEEAFRLQERIGKLIDKLDKLGFEFMFYNQQSSIRRKREK |
| Ga0209404_1000152217 | 3300027906 | Marine | MSKSEKAFEIQEKIGKLIEKLDKLGFEFMFYNHQSSIRRKR |
| Ga0209404_100062949 | 3300027906 | Marine | MKSKSEKALDLQEAIQKKIDKLSKLGFEFMYYNNITSIRRKR |
| Ga0209404_100188446 | 3300027906 | Marine | MTKIGYNKAEKAFELQEKIANLIDKLDKLGFEYMYFNSISSIRRKRNG |
| Ga0209404_101534592 | 3300027906 | Marine | MSDAEKAFDLQEKIAKLIDKLNELGFEYMYYNQISSIRRKRDYGKRKTNR |
| Ga0209404_101622034 | 3300027906 | Marine | MSKAEKAFEIQEEIGKKIDELEKLGFEFMFYNRISSIRRI |
| Ga0209404_104010332 | 3300027906 | Marine | MTKKNKSRAEQAFDIQERIGRQIDKLHELGFEYMYHNYISSIRRLRKKNGKT |
| Ga0183755_100010328 | 3300029448 | Marine | MSKAEKAFELQEKIGKLIDKLDELGFEFMYFNFTSSIRRKRK |
| Ga0183755_10046046 | 3300029448 | Marine | MKSKSEQALDLQEAIQKKIDKLSKIGFEFMYYNNITSIRRKR |
| Ga0183755_10137695 | 3300029448 | Marine | MSKSDQALDIQEQISKKIDKLNKLGYDFLYYNNITSIRRKSKERK |
| Ga0183755_10213368 | 3300029448 | Marine | MSASDKALAIQEKIQKQIDKLEKLGFEFMYHNRISSIRRLRNDR |
| Ga0183755_10277782 | 3300029448 | Marine | MSASDKALTIQEKIQKQIDKLEKLGFEFMYHNKEIEK |
| Ga0307488_103247063 | 3300031519 | Sackhole Brine | MSKSEKAFELQEKIGKLIDKLDALGFEFLYFNFVSSIRRKRKXVR |
| Ga0315316_104130751 | 3300032011 | Seawater | SEKAFEIQEKIGKLIEKLDKLGFEFMFYNHQSSIRRKR |
| Ga0315316_112107442 | 3300032011 | Seawater | MKSKSERALDLQEKIQKKINKLKDLGFEFMYYNGISSIRRDRKXGII |
| Ga0315327_107665873 | 3300032032 | Seawater | AKKYEEAFRLQERIGKLIDKLDKLGFEFMFYNQQSSIRRKREK |
| Ga0315333_105234772 | 3300032130 | Seawater | MSKSDKAFELQEKIGKLIDKLDALGFEFMYFNFTSSIRRKRKXEVDIY |
| ⦗Top⦘ |