


| Basic Information | |
|---|---|
| Family ID | F040310 |
| Family Type | Metagenome |
| Number of Sequences | 162 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MRTPMHWRTERGRHFQAHPLQATFSLIASMLLAALVVLALVLSAR |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 162 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.01 % |
| % of genes near scaffold ends (potentially truncated) | 35.80 % |
| % of genes from short scaffolds (< 2000 bps) | 72.22 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.160 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (34.568 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.741 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.704 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.79% β-sheet: 0.00% Coil/Unstructured: 45.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 162 Family Scaffolds |
|---|---|---|
| PF13458 | Peripla_BP_6 | 5.56 |
| PF04073 | tRNA_edit | 5.56 |
| PF03992 | ABM | 4.94 |
| PF09723 | Zn-ribbon_8 | 4.32 |
| PF10771 | DUF2582 | 2.47 |
| PF13620 | CarboxypepD_reg | 1.85 |
| PF00582 | Usp | 1.23 |
| PF04430 | DUF498 | 1.23 |
| PF06348 | DUF1059 | 1.23 |
| PF00990 | GGDEF | 1.23 |
| PF00072 | Response_reg | 0.62 |
| PF00106 | adh_short | 0.62 |
| PF12769 | PNTB_4TM | 0.62 |
| PF00873 | ACR_tran | 0.62 |
| PF00534 | Glycos_transf_1 | 0.62 |
| PF08281 | Sigma70_r4_2 | 0.62 |
| PF05598 | DUF772 | 0.62 |
| PF01041 | DegT_DnrJ_EryC1 | 0.62 |
| PF13602 | ADH_zinc_N_2 | 0.62 |
| PF04542 | Sigma70_r2 | 0.62 |
| PF05015 | HigB-like_toxin | 0.62 |
| PF08207 | EFP_N | 0.62 |
| PF13466 | STAS_2 | 0.62 |
| PF07238 | PilZ | 0.62 |
| PF03237 | Terminase_6N | 0.62 |
| PF01740 | STAS | 0.62 |
| PF00589 | Phage_integrase | 0.62 |
| PF01883 | FeS_assembly_P | 0.62 |
| PF00239 | Resolvase | 0.62 |
| PF12587 | DUF3761 | 0.62 |
| PF02517 | Rce1-like | 0.62 |
| PF08592 | Anthrone_oxy | 0.62 |
| PF00082 | Peptidase_S8 | 0.62 |
| PF03070 | TENA_THI-4 | 0.62 |
| PF00484 | Pro_CA | 0.62 |
| PF10017 | Methyltransf_33 | 0.62 |
| PF12838 | Fer4_7 | 0.62 |
| PF07883 | Cupin_2 | 0.62 |
| PF13676 | TIR_2 | 0.62 |
| PF02353 | CMAS | 0.62 |
| PF04116 | FA_hydroxylase | 0.62 |
| PF10009 | DUF2252 | 0.62 |
| PF13442 | Cytochrome_CBB3 | 0.62 |
| PF00083 | Sugar_tr | 0.62 |
| PF01910 | Thiamine_BP | 0.62 |
| PF07366 | SnoaL | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 162 Family Scaffolds |
|---|---|---|---|
| COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 1.23 |
| COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 1.23 |
| COG0011 | Thiamin-binding stress-response protein YqgV, UPF0045 family | Coenzyme transport and metabolism [H] | 0.62 |
| COG0231 | Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) | Translation, ribosomal structure and biogenesis [J] | 0.62 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.62 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.62 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.62 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.62 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.62 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.62 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.62 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.62 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.62 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.62 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.62 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.62 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.62 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.62 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.62 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.62 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.62 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.62 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.16 % |
| Unclassified | root | N/A | 22.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_106000597 | Not Available | 567 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100085808 | All Organisms → cellular organisms → Bacteria | 2930 | Open in IMG/M |
| 3300005174|Ga0066680_10576032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300005181|Ga0066678_10140248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1503 | Open in IMG/M |
| 3300005332|Ga0066388_100260259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2376 | Open in IMG/M |
| 3300005332|Ga0066388_100668065 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300005332|Ga0066388_102381350 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300005334|Ga0068869_100053244 | All Organisms → cellular organisms → Bacteria | 2941 | Open in IMG/M |
| 3300005344|Ga0070661_100182226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1598 | Open in IMG/M |
| 3300005436|Ga0070713_100608654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1038 | Open in IMG/M |
| 3300005440|Ga0070705_100670730 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300005445|Ga0070708_101825392 | Not Available | 564 | Open in IMG/M |
| 3300005467|Ga0070706_100057920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3576 | Open in IMG/M |
| 3300005468|Ga0070707_100785829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
| 3300005468|Ga0070707_100980166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 811 | Open in IMG/M |
| 3300005540|Ga0066697_10084172 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300005552|Ga0066701_10111724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1608 | Open in IMG/M |
| 3300005554|Ga0066661_10007108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5370 | Open in IMG/M |
| 3300005556|Ga0066707_10100651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1774 | Open in IMG/M |
| 3300005557|Ga0066704_10055907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2505 | Open in IMG/M |
| 3300005568|Ga0066703_10037648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2648 | Open in IMG/M |
| 3300005569|Ga0066705_10056213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2227 | Open in IMG/M |
| 3300005764|Ga0066903_104884470 | Not Available | 712 | Open in IMG/M |
| 3300005764|Ga0066903_106899279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300005842|Ga0068858_100515216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1156 | Open in IMG/M |
| 3300005843|Ga0068860_100418663 | Not Available | 1328 | Open in IMG/M |
| 3300006034|Ga0066656_10111710 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300006047|Ga0075024_100200014 | Not Available | 936 | Open in IMG/M |
| 3300006050|Ga0075028_100100085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1478 | Open in IMG/M |
| 3300006050|Ga0075028_100233783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 1004 | Open in IMG/M |
| 3300006059|Ga0075017_100007015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7135 | Open in IMG/M |
| 3300006059|Ga0075017_100054866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2688 | Open in IMG/M |
| 3300006059|Ga0075017_100490902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 930 | Open in IMG/M |
| 3300006172|Ga0075018_10250572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300006173|Ga0070716_100038282 | All Organisms → cellular organisms → Bacteria | 2655 | Open in IMG/M |
| 3300006175|Ga0070712_100009910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 6007 | Open in IMG/M |
| 3300006175|Ga0070712_100032636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3517 | Open in IMG/M |
| 3300006791|Ga0066653_10501608 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006796|Ga0066665_10185919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1603 | Open in IMG/M |
| 3300006796|Ga0066665_11105219 | Not Available | 604 | Open in IMG/M |
| 3300006797|Ga0066659_10614614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300006804|Ga0079221_10558245 | Not Available | 760 | Open in IMG/M |
| 3300006852|Ga0075433_10317679 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300006852|Ga0075433_10905129 | Not Available | 769 | Open in IMG/M |
| 3300006854|Ga0075425_102871526 | Not Available | 529 | Open in IMG/M |
| 3300006871|Ga0075434_100853667 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300007076|Ga0075435_101685630 | Not Available | 556 | Open in IMG/M |
| 3300009012|Ga0066710_102685977 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300009038|Ga0099829_10032858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3717 | Open in IMG/M |
| 3300009038|Ga0099829_10051587 | All Organisms → cellular organisms → Bacteria | 3050 | Open in IMG/M |
| 3300009038|Ga0099829_10055636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2948 | Open in IMG/M |
| 3300009038|Ga0099829_10251618 | Not Available | 1441 | Open in IMG/M |
| 3300009038|Ga0099829_10382415 | Not Available | 1162 | Open in IMG/M |
| 3300009088|Ga0099830_10027213 | All Organisms → cellular organisms → Bacteria | 3816 | Open in IMG/M |
| 3300009088|Ga0099830_10221429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1488 | Open in IMG/M |
| 3300009088|Ga0099830_10369375 | Not Available | 1156 | Open in IMG/M |
| 3300009089|Ga0099828_10576171 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300009089|Ga0099828_10732184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300009089|Ga0099828_11686977 | Not Available | 557 | Open in IMG/M |
| 3300009090|Ga0099827_10607729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 943 | Open in IMG/M |
| 3300009137|Ga0066709_100075111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3996 | Open in IMG/M |
| 3300009143|Ga0099792_11151202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300010048|Ga0126373_10094532 | All Organisms → cellular organisms → Bacteria | 2752 | Open in IMG/M |
| 3300010048|Ga0126373_12274440 | Not Available | 603 | Open in IMG/M |
| 3300010358|Ga0126370_10932601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300010358|Ga0126370_11764639 | Not Available | 598 | Open in IMG/M |
| 3300010373|Ga0134128_10067920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4092 | Open in IMG/M |
| 3300011269|Ga0137392_10955451 | Not Available | 705 | Open in IMG/M |
| 3300011269|Ga0137392_11454947 | Not Available | 544 | Open in IMG/M |
| 3300011270|Ga0137391_10196072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1757 | Open in IMG/M |
| 3300011271|Ga0137393_10493598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1050 | Open in IMG/M |
| 3300012096|Ga0137389_10014005 | All Organisms → cellular organisms → Bacteria | 5450 | Open in IMG/M |
| 3300012096|Ga0137389_10536784 | Not Available | 1004 | Open in IMG/M |
| 3300012096|Ga0137389_10669265 | Not Available | 892 | Open in IMG/M |
| 3300012189|Ga0137388_10470749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1166 | Open in IMG/M |
| 3300012189|Ga0137388_10549842 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300012189|Ga0137388_10569836 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300012189|Ga0137388_11644882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300012189|Ga0137388_11900701 | Not Available | 525 | Open in IMG/M |
| 3300012199|Ga0137383_10865522 | Not Available | 660 | Open in IMG/M |
| 3300012202|Ga0137363_10002659 | All Organisms → cellular organisms → Bacteria | 10695 | Open in IMG/M |
| 3300012202|Ga0137363_10266541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1397 | Open in IMG/M |
| 3300012202|Ga0137363_10590384 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300012205|Ga0137362_10067244 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
| 3300012205|Ga0137362_11453084 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012209|Ga0137379_10442605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1208 | Open in IMG/M |
| 3300012351|Ga0137386_10080894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2277 | Open in IMG/M |
| 3300012356|Ga0137371_10538699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 899 | Open in IMG/M |
| 3300012359|Ga0137385_10248652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1540 | Open in IMG/M |
| 3300012361|Ga0137360_10001235 | All Organisms → cellular organisms → Bacteria | 15018 | Open in IMG/M |
| 3300012361|Ga0137360_11788842 | Not Available | 520 | Open in IMG/M |
| 3300012362|Ga0137361_11027048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300012917|Ga0137395_10402939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
| 3300012917|Ga0137395_11216318 | Not Available | 526 | Open in IMG/M |
| 3300012929|Ga0137404_11018542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300012930|Ga0137407_10125793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2233 | Open in IMG/M |
| 3300012930|Ga0137407_10966158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
| 3300012930|Ga0137407_10998344 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300012930|Ga0137407_11309423 | Not Available | 688 | Open in IMG/M |
| 3300012930|Ga0137407_11928551 | Not Available | 563 | Open in IMG/M |
| 3300012944|Ga0137410_10578600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 926 | Open in IMG/M |
| 3300012944|Ga0137410_10713949 | Not Available | 836 | Open in IMG/M |
| 3300013296|Ga0157374_10672663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
| 3300013297|Ga0157378_10690121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1040 | Open in IMG/M |
| 3300014969|Ga0157376_10366212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1384 | Open in IMG/M |
| 3300015264|Ga0137403_10832422 | Not Available | 776 | Open in IMG/M |
| 3300015373|Ga0132257_100265297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2054 | Open in IMG/M |
| 3300016270|Ga0182036_10495475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300016294|Ga0182041_11527864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300016294|Ga0182041_11840341 | Not Available | 562 | Open in IMG/M |
| 3300016387|Ga0182040_10440995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1030 | Open in IMG/M |
| 3300017659|Ga0134083_10383590 | Not Available | 610 | Open in IMG/M |
| 3300017943|Ga0187819_10363354 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300018088|Ga0187771_10028857 | All Organisms → cellular organisms → Bacteria | 4209 | Open in IMG/M |
| 3300018431|Ga0066655_10223766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1182 | Open in IMG/M |
| 3300018433|Ga0066667_10137976 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
| 3300019789|Ga0137408_1030214 | Not Available | 774 | Open in IMG/M |
| 3300021086|Ga0179596_10110213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1263 | Open in IMG/M |
| 3300021168|Ga0210406_10043336 | All Organisms → cellular organisms → Bacteria | 3978 | Open in IMG/M |
| 3300021168|Ga0210406_10057632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3378 | Open in IMG/M |
| 3300025910|Ga0207684_10759258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300025910|Ga0207684_10920129 | Not Available | 734 | Open in IMG/M |
| 3300025910|Ga0207684_11666737 | Not Available | 515 | Open in IMG/M |
| 3300025922|Ga0207646_10446590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1167 | Open in IMG/M |
| 3300025922|Ga0207646_11454451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300025939|Ga0207665_10139661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1726 | Open in IMG/M |
| 3300026095|Ga0207676_11922985 | Not Available | 590 | Open in IMG/M |
| 3300026331|Ga0209267_1019610 | All Organisms → cellular organisms → Bacteria | 3420 | Open in IMG/M |
| 3300026331|Ga0209267_1021044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3272 | Open in IMG/M |
| 3300026334|Ga0209377_1262786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300026358|Ga0257166_1013036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1046 | Open in IMG/M |
| 3300026469|Ga0257169_1071039 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300026497|Ga0257164_1036558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300026528|Ga0209378_1018802 | All Organisms → cellular organisms → Bacteria | 3902 | Open in IMG/M |
| 3300026538|Ga0209056_10096177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2434 | Open in IMG/M |
| 3300026538|Ga0209056_10257723 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300026540|Ga0209376_1209231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300027643|Ga0209076_1003382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3604 | Open in IMG/M |
| 3300027651|Ga0209217_1000991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 8771 | Open in IMG/M |
| 3300027651|Ga0209217_1004069 | All Organisms → cellular organisms → Bacteria | 4879 | Open in IMG/M |
| 3300027748|Ga0209689_1299136 | Not Available | 624 | Open in IMG/M |
| 3300027842|Ga0209580_10064323 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300027846|Ga0209180_10232614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1062 | Open in IMG/M |
| 3300027846|Ga0209180_10423769 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300027875|Ga0209283_10953166 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300027894|Ga0209068_10199434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1100 | Open in IMG/M |
| 3300027910|Ga0209583_10007343 | All Organisms → cellular organisms → Bacteria | 3171 | Open in IMG/M |
| 3300028379|Ga0268266_10000583 | All Organisms → cellular organisms → Bacteria | 50513 | Open in IMG/M |
| 3300028381|Ga0268264_11240136 | Not Available | 755 | Open in IMG/M |
| 3300028536|Ga0137415_10000151 | All Organisms → cellular organisms → Bacteria | 57375 | Open in IMG/M |
| 3300031720|Ga0307469_10035639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2955 | Open in IMG/M |
| 3300031720|Ga0307469_12452035 | Not Available | 509 | Open in IMG/M |
| 3300031910|Ga0306923_11035853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
| 3300031962|Ga0307479_10015069 | All Organisms → cellular organisms → Bacteria | 7253 | Open in IMG/M |
| 3300031962|Ga0307479_10256844 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
| 3300032180|Ga0307471_100023524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4580 | Open in IMG/M |
| 3300032180|Ga0307471_100114356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2493 | Open in IMG/M |
| 3300032205|Ga0307472_100191971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1543 | Open in IMG/M |
| 3300032205|Ga0307472_100341392 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300032205|Ga0307472_100636101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
| 3300032205|Ga0307472_101045392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300032261|Ga0306920_100074735 | All Organisms → cellular organisms → Bacteria | 4971 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 34.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.26% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.17% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.09% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.47% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.62% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.62% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1060005972 | 3300000559 | Soil | MRTPMHWRTERGRHFQAHPLQATFSLIASMLLAALVVLALVLSAK* |
| JGIcombinedJ26739_1000858083 | 3300002245 | Forest Soil | MRTPMPWRTERGRYFHAHPQQAMFSLIASLLLAGLVVLALALSAR* |
| Ga0066680_105760323 | 3300005174 | Soil | AAMHTPMHWRTERGRYFQGHPLHATFSLIASMLLAGLVVL* |
| Ga0066678_101402482 | 3300005181 | Soil | MHTPMHWRTERGRYFQTHPLHATFSLVASMLLAGLVVLVLVLSAR* |
| Ga0066388_1002602595 | 3300005332 | Tropical Forest Soil | MRTPMHWRTERGRHLQAHPLHTTFSLIASMLLAGLLVLAFVLSAR* |
| Ga0066388_1006680654 | 3300005332 | Tropical Forest Soil | MRNPMLWRREQGRYFHAHPQQAMFSLIASMLLAGLVVLALALSAR* |
| Ga0066388_1023813501 | 3300005332 | Tropical Forest Soil | MWTPMHWRTERGRHLQTHSLHTTFSLVASMMLAGLLVLAFVLSA |
| Ga0068869_1000532442 | 3300005334 | Miscanthus Rhizosphere | MRTLTERGRHFHAHPLQATFSPIASMLLAALVVLALVLSAR* |
| Ga0070661_1001822261 | 3300005344 | Corn Rhizosphere | MWTLMHWRTERGRYVQTHPLQATFSLIASMLLAALVVLALVLSAK* |
| Ga0070713_1006086541 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTPMHWRTEGGRHFQTHPLHATFSLVASMLLAGLVVLALALSAR* |
| Ga0070705_1006707301 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTPMHWRTERGRYFHAHPQQAMFSLIASIVLAGLVVLALALSAR* |
| Ga0070708_1018253921 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TLTERGRYFHAHPLQVAFSLIASTLLAGLVVLALVLSVR* |
| Ga0070706_1000579204 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTPMHWRTERGRYFHAHPLHAAFSLIASMLLAGLIVLVLVLSAK* |
| Ga0070707_1007858293 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTPMHWRTERGRYFQAHPLHAAFSLVASMLLAGLIVLVLVLSAK* |
| Ga0070707_1009801661 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTPMHWRTERDRHFQAHPLQATFSLIASLLLAALVVLALVFSAR* |
| Ga0066697_100841724 | 3300005540 | Soil | MHTPMHWRTERGRYFQGHPLHATFSLIASMLLAGLVVLALVLSAK* |
| Ga0066701_101117243 | 3300005552 | Soil | MHTPIHWRTERGRYLQAHPLHATFSLIASMLLAGLVVLVLVLSAR* |
| Ga0066661_100071084 | 3300005554 | Soil | MRTPMHWRTERGRHFQAHPLHATYSLVASMLLAGLVVLALVLSAR* |
| Ga0066707_101006512 | 3300005556 | Soil | MHTPMHWRTERGRYFQTHPLHATFSLVASMLLAGLVVLVLVMSAR* |
| Ga0066704_100559073 | 3300005557 | Soil | MHTPIHWRTERGRYFQAYPLHATFSLIASMLLAGLVVLVLVLSAR* |
| Ga0066703_100376486 | 3300005568 | Soil | MHTPIHWRTERGRYFQAYPLHATFSLIASMLLAGLAVLVLVLSAR* |
| Ga0066705_100562132 | 3300005569 | Soil | MHTPIHWRTERGRYFQAYPLHATFSLIASMLLAGLVVLVLVLSSR* |
| Ga0066903_1048844701 | 3300005764 | Tropical Forest Soil | MRNPMLWRREQGRYFHAHPQQAMFSLIASMLLAGLVMLALALSAR* |
| Ga0066903_1068992792 | 3300005764 | Tropical Forest Soil | MWTPMHWRTERGRHLQTHSLHTTFSLVASMMLAGLLVLAFVLSAR* |
| Ga0068858_1005152161 | 3300005842 | Switchgrass Rhizosphere | MWTPMHWRTERGRYVQTHPLQATFSLIASMLLAALVVLALVLSAK* |
| Ga0068860_1004186631 | 3300005843 | Switchgrass Rhizosphere | MHWRTERGRYVQTHPLQATFSLIASMLLAALVVLALVLSAK* |
| Ga0066656_101117101 | 3300006034 | Soil | MHTPMHWRTERGRYFQGHPLHATFSLIASMLLAGLVV |
| Ga0075024_1002000143 | 3300006047 | Watersheds | MRTLTERGHYFHAHPLQATFSLIASMLLAGLAVLALVLSAQ* |
| Ga0075028_1001000853 | 3300006050 | Watersheds | MQTLTERGRHFQAHPLQATFSLIASMLLAALVVLALVLSAR* |
| Ga0075028_1002337831 | 3300006050 | Watersheds | MRTLTERGRHFQTHPLQTTFSLVASILLAALVVLVLVLSAR* |
| Ga0075017_1000070153 | 3300006059 | Watersheds | MRTLMPWRTERGRYFHAHPQQAMFSLIASMLLAALVVLALALSAR* |
| Ga0075017_1000548663 | 3300006059 | Watersheds | VRMMCWRTEPRHHFQAPPAQVTFSLIASMLLAGLVVLALALSAQ* |
| Ga0075017_1004909022 | 3300006059 | Watersheds | MRTLTERGRHFQAHPLQATFSLIASMLLAALVVLALVLSAR* |
| Ga0075018_102505721 | 3300006172 | Watersheds | PVLLGRRLAMRTLTERGRHFQTHPLQTTFSLVASILLAALVVLVLVLSAR* |
| Ga0070716_1000382821 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLMHFRTHRDRYFHAHPLHGTFSLIASRALAGLVVLMLVLSAR* |
| Ga0070712_1000099101 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ERGRHFQAHPLQATFSLFASMLLAGLVVLALVLSAR* |
| Ga0070712_1000326361 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTLTERGRHFQAHPLQATFSLFASMLLAGLVVLALVLS |
| Ga0066653_105016082 | 3300006791 | Soil | MRTPMHWRTERGRHFQAHPLQATFSLIASMLLAALVVLALVLSAR* |
| Ga0066665_101859191 | 3300006796 | Soil | MRTPMHWRTERGRHFQAHPLHGTFSLIASMLLAGLLVLAFVLSAR* |
| Ga0066665_111052192 | 3300006796 | Soil | MRTPMHWRTERGRHFQAHPLQAMFSLIASMLLAALVVLALVLSAK* |
| Ga0066659_106146141 | 3300006797 | Soil | TERGRYFQAYPLHATFSLIASMLLAGLVVLVLVLSAR* |
| Ga0079221_105582452 | 3300006804 | Agricultural Soil | MHTPMHWRTERGRYFQAHPLHTTFSLIASMLLAGLVVLVLVLSAR* |
| Ga0075433_103176791 | 3300006852 | Populus Rhizosphere | ERGRHFQAHPLQATFSLVATMLLAALVVLALVLSAR* |
| Ga0075433_109051292 | 3300006852 | Populus Rhizosphere | MPTPMHWRTERGRHFHTHPLHATFSLIASVLLAGLIVLVLVLSAR* |
| Ga0075425_1028715262 | 3300006854 | Populus Rhizosphere | EEAAMRTPMHWRTERGRYFHAHPQQAMFSLIASIVLAGLVVLALALSAR* |
| Ga0075434_1008536673 | 3300006871 | Populus Rhizosphere | MRTPMHWRTERGRYFHAHPQQAMFSLIASIVLAGLVVLALALSA |
| Ga0075435_1016856302 | 3300007076 | Populus Rhizosphere | MRTLMHWRMERERHFQSHPLHTTYSLIASMLLTGLL |
| Ga0066710_1026859771 | 3300009012 | Grasslands Soil | MHTPMHWRTERGRYFQGHPLHATFSLIASMLLAGLVVL |
| Ga0099829_100328588 | 3300009038 | Vadose Zone Soil | MRTLTERGRHFQAHPLQATFSLVASMLLAGLVVLALVLSAR* |
| Ga0099829_100515873 | 3300009038 | Vadose Zone Soil | MRTLTERGRHFQAHPLQATFSLIASMLLAALVVLALVLAAR* |
| Ga0099829_100556365 | 3300009038 | Vadose Zone Soil | MRTAMHWRTERGRHFQTHPLQATFSLVVSMLLAGLVVLALVLSAR* |
| Ga0099829_102516182 | 3300009038 | Vadose Zone Soil | MHTAMHWRTERGRYFQTHPLHATFSLIASMLLAGLVVLVLVLSAR* |
| Ga0099829_103824151 | 3300009038 | Vadose Zone Soil | MHWRTERGRYFQAHPLQATFSLIASMLLAALVVLALVLSAK* |
| Ga0099830_100272138 | 3300009088 | Vadose Zone Soil | MRTLTERGRHFQAHPLQATFSLFASMLLAGLVVPALVLSAR* |
| Ga0099830_102214293 | 3300009088 | Vadose Zone Soil | MRTMMPWRTERGRYFHAHPQQAMFSLIASMLLAAL |
| Ga0099830_103693751 | 3300009088 | Vadose Zone Soil | EAAMRTSMHWRTERGRHFQSHPLHAAFSVIASMLLAGLVVLVLVLSVR* |
| Ga0099828_105761711 | 3300009089 | Vadose Zone Soil | MHWRAERGRHFQAHPLQATFSLIASMLLAALVVLALVLS |
| Ga0099828_107321842 | 3300009089 | Vadose Zone Soil | MRTPMHWRTERGRYFHAHPQQAMFSLIASMLLAALVVLALALSAR* |
| Ga0099828_116869772 | 3300009089 | Vadose Zone Soil | MPWRTERGRYFHAHPQQAMFSLIASMLLAALVVLALALSAR* |
| Ga0099827_106077292 | 3300009090 | Vadose Zone Soil | MHTPMHWRTERGRYFQAHPLHATFSLIASMLLAGLVVLVLVLSAR* |
| Ga0066709_1000751115 | 3300009137 | Grasslands Soil | MRTPMHWRTERGRHFQAHPLHATFSLIASMLLAGLLVLAFVLSAR* |
| Ga0099792_111512021 | 3300009143 | Vadose Zone Soil | MRTLTERGRHFQAHPLQATFSLTAGMLLAALIVLALVLSAR |
| Ga0126373_100945323 | 3300010048 | Tropical Forest Soil | MRALTHSSTERGRHFQGHPLHATFSLIASMLLAGLLVLAFVLSAR* |
| Ga0126373_122744401 | 3300010048 | Tropical Forest Soil | MRALTHSSTERSHFQGHPLHATFSLIASMLLAGLLVLAFVLSAR* |
| Ga0126370_109326011 | 3300010358 | Tropical Forest Soil | GGRLPMWTPMHWRTERGRHLQAHPLHTSFSLIASMLLAGLLVLAFVLSAR* |
| Ga0126370_117646391 | 3300010358 | Tropical Forest Soil | MHTPMHWRTERGRYFQAHPLHAAFSLVASMLLAGLVVLVLVLSAK* |
| Ga0134128_100679206 | 3300010373 | Terrestrial Soil | MRTLTKRGRHFHAHPLQATFSPIASMLLAALVVLALVLSAR* |
| Ga0137392_109554511 | 3300011269 | Vadose Zone Soil | MRTPMPWRTERGRYFHAHPQQAMFSLIASVLLAALVVLALALSAR* |
| Ga0137392_114549471 | 3300011269 | Vadose Zone Soil | MRTLMPWRTERGRYFHAHPQQAMFSLIASMLLAGLVVLALALSAR* |
| Ga0137391_101960721 | 3300011270 | Vadose Zone Soil | MRTMMPWRTERGRYFHAHPQQAMFSLIASMLLAALVVLALALSAR* |
| Ga0137393_104935981 | 3300011271 | Vadose Zone Soil | MRHLMPWRTERGRYFHAHPQQAMFSLIASMLLAALVVLALALSAR* |
| Ga0137389_100140051 | 3300012096 | Vadose Zone Soil | WRTERGRYFQAHPLQATFSLIASILLAGLVVVALVLTAR* |
| Ga0137389_105367841 | 3300012096 | Vadose Zone Soil | MRTSMHWRTERGRHFQSHPLHAAFSVIASMLLAGLVVLVLVLSVR* |
| Ga0137389_106692653 | 3300012096 | Vadose Zone Soil | MRTLMPWRTERGRYFHVHPQQAMFSLLASMLLAGMVVLALALS |
| Ga0137388_104707491 | 3300012189 | Vadose Zone Soil | ERGRHFQSHPLHAAFSVIASMLLAGLVVLVLVLSVR* |
| Ga0137388_105498422 | 3300012189 | Vadose Zone Soil | MRTLTERGRYFHAHPLQVAFSLIASTLLAGLVVVALVLSVR* |
| Ga0137388_105698362 | 3300012189 | Vadose Zone Soil | MRTLTERGRHFQAHPLQATFSLIASMLLAGLVVVALVLSAR* |
| Ga0137388_116448821 | 3300012189 | Vadose Zone Soil | MRTLMPWRTERGRYFHAHPQQAMFSLIASVLLAALVVLALALSAR* |
| Ga0137388_119007011 | 3300012189 | Vadose Zone Soil | VCSEAATMRHLMPWRTERGRYFHAHPQQAMFSLIASMLLAALVVLALALSAR* |
| Ga0137383_108655222 | 3300012199 | Vadose Zone Soil | MRIPMHWRTERGRHFQAHSLHATFSLIASMLLAGLLVLAFVLSAR* |
| Ga0137363_100026597 | 3300012202 | Vadose Zone Soil | MRTPMHWRTERGRHFQAHPLHATFSLVASMLLAGLVILALVLSAR* |
| Ga0137363_102665412 | 3300012202 | Vadose Zone Soil | MRTMMPWRTERGRYFHAHPQQAMFSLIASVLLAALVVSALALSAR* |
| Ga0137363_105903841 | 3300012202 | Vadose Zone Soil | MRTLTERGRHFQAHPSQATFSLFASMLLAGLVVPALVLSAR* |
| Ga0137362_100672444 | 3300012205 | Vadose Zone Soil | MRTLTERGRHFQTHPLQATFSLIASILLAGLVVVALVLTAR* |
| Ga0137362_114530842 | 3300012205 | Vadose Zone Soil | MPWRTERGRYFHAHPQQAMFSLIASMLLAALVVLALALS |
| Ga0137379_104426051 | 3300012209 | Vadose Zone Soil | MRTLTERGRHFQAHPLQATFSLFASMLLAGLVVLALVLSAR* |
| Ga0137386_100808944 | 3300012351 | Vadose Zone Soil | MRTPMHWRTERGRHFQARPLHATFSLIASMLLAGLLVLAFVLSAR* |
| Ga0137371_105386992 | 3300012356 | Vadose Zone Soil | MYTPMHWRTERGRYFQAHPLHATFSLITSMLLAGLVVLVLVLSAK* |
| Ga0137385_102486524 | 3300012359 | Vadose Zone Soil | MHTPIHWRTERGRYLQAHPLHATFSLIASMLLAGLVVLVLILSAR* |
| Ga0137360_100012353 | 3300012361 | Vadose Zone Soil | MRTPMHWRTERGRHFQAHPLHATFSLVSSMLLAGLVILALVLSAR* |
| Ga0137360_117888422 | 3300012361 | Vadose Zone Soil | GRYFQAHPLQATFSLIASMLLAALVVLALVLSAK* |
| Ga0137361_110270481 | 3300012362 | Vadose Zone Soil | MRSLTERGRHFQAHSLQATFSLFASMLLAGLVVLALVLSAR* |
| Ga0137395_104029392 | 3300012917 | Vadose Zone Soil | MRTPMPWRTERGRYFHAHPQQAMFSLIASMLLAALVVLALALSAR* |
| Ga0137395_112163182 | 3300012917 | Vadose Zone Soil | MHTAMHWRTERGLYFQTHPPHATFSLIASMLLGGLVVLVLVLSER* |
| Ga0137404_110185421 | 3300012929 | Vadose Zone Soil | QEEAAMRTPMHWRTERGRHFQAHPLQATWSLIASMLLAALVVLALVSSVR* |
| Ga0137407_101257933 | 3300012930 | Vadose Zone Soil | MHTPMHWRTERGRYFQAHPLHATFSLVASMLLAGLVVLVLVLSAR* |
| Ga0137407_109661582 | 3300012930 | Vadose Zone Soil | MHTPIHWRTERGRYFQAHPLHATFSLITSMLLAGLVVLVLVLSAK* |
| Ga0137407_109983441 | 3300012930 | Vadose Zone Soil | MRTPMHWRTERGRHFQAHPLQATWSLIASMLLAALVVLALVSSVR* |
| Ga0137407_113094231 | 3300012930 | Vadose Zone Soil | MRTLMPWRTERGRYFHAHPQQAMFSLIASMLLAALVVLALALSA |
| Ga0137407_119285511 | 3300012930 | Vadose Zone Soil | AAMHTPMHWRTERGGYFQGHPLHATFSLIASMLLAGLVVLALVLSAR* |
| Ga0137410_105786002 | 3300012944 | Vadose Zone Soil | MRTLTERGRHFQAHPLQATFSLFASMLLAGLVVLA |
| Ga0137410_107139491 | 3300012944 | Vadose Zone Soil | MRTLIHLRAERGRHFQAHPLQATFSLMASMLLAALVVLALVLSAK* |
| Ga0157374_106726632 | 3300013296 | Miscanthus Rhizosphere | AAMRTLTERGRHFHAHPLQATFSPIASMLLAALVVLALVLSAR* |
| Ga0157378_106901212 | 3300013297 | Miscanthus Rhizosphere | MRTLTERGRHFHAHPLQATFSLFASMLLAGLVVPALVLSAR* |
| Ga0157376_103662122 | 3300014969 | Miscanthus Rhizosphere | MWTLMHWRTERGRYVQTHPLQATFSLIASMLLAALVVLALVLS |
| Ga0137403_108324221 | 3300015264 | Vadose Zone Soil | REEAAMHTPMHWMTERGRYFQGHPLHATFSLIASMLLAGLVVLALVLSAK* |
| Ga0132257_1002652973 | 3300015373 | Arabidopsis Rhizosphere | MRHLMPWRTERGRYFHAHPQQAMFSLIASIVLAGLVVLALALSAR* |
| Ga0182036_104954751 | 3300016270 | Soil | MRTPMHWRAERGRHFHAHPLHATFSLIASMLLAGLLVLAFV |
| Ga0182041_115278642 | 3300016294 | Soil | MRTPMHWRAERGRHFHAHPLHATFSLIASMLLAGLLVLAFVLS |
| Ga0182041_118403412 | 3300016294 | Soil | MWSLTERGRYFHAHPLHATFSLMASMLLAGLVVLA |
| Ga0182040_104409952 | 3300016387 | Soil | PMHWRAERGRHFHAHPLHATFSLIASMLLAGLLVLAFVLSAR |
| Ga0134083_103835901 | 3300017659 | Grasslands Soil | MPTPMHWRIERGRHFQGHPLHATFSLIASMLLVGLLVLVLVLSAR |
| Ga0187819_103633541 | 3300017943 | Freshwater Sediment | RTHEERRFHLHPLHGTFSLVTSFFLAGLVVLALVL |
| Ga0187771_100288572 | 3300018088 | Tropical Peatland | MRTLKYFRTHHDPYFHAHPLHATFALIASFLLAAVVVLVLVSSAR |
| Ga0066655_102237662 | 3300018431 | Grasslands Soil | MHTPIHWRTERGRYLQAHPLHATFSLIASMLLAGLVVLVLVLSAR |
| Ga0066667_101379762 | 3300018433 | Grasslands Soil | MHTPMHWRTERGRYFQGHPLHATFSLIASMLLAGLVVLALVLSAK |
| Ga0137408_10302142 | 3300019789 | Vadose Zone Soil | MHTAMHWRTERGRYFQTHPLHATFSLIASMLLAGLVVLVLVLSAR |
| Ga0179596_101102133 | 3300021086 | Vadose Zone Soil | MRTLTERGRHFQAHPLQATFSLIASMLLAALVVLALVLSAR |
| Ga0210406_100433367 | 3300021168 | Soil | MWSLTERGRYFHAHPLHATFSLMASMLLAGLVVLAFVLSAR |
| Ga0210406_100576322 | 3300021168 | Soil | MWSLTERGRHFHAHPLHATFSLMASMLLAGLVVLAFVLSAR |
| Ga0207684_107592581 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LIHWRLERERHFQAHPLHTTYSLIASMLLTGLLVLAFVLSAK |
| Ga0207684_109201292 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTPMHWRTERGRYFHAHPLHAAFSLIASMLLAGLIVLVLVLSAK |
| Ga0207684_116667371 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSMMHWRMERGRYFHAHPQHAAYSLIASAMLAGLLVLVFVLSAR |
| Ga0207646_104465902 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTAMHWRTERGRHFQTHPLQATFSLVVSMLLAGLVVLALVLSAR |
| Ga0207646_114544512 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTPMHWRTERGRYFQAHPLHAAFSLVASMLLAGLIVLVLVLSA |
| Ga0207665_101396611 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTPMHWRTERGRYFQAHPLHTTFSLIASMLLAGLVVLVLVLSAR |
| Ga0207676_119229851 | 3300026095 | Switchgrass Rhizosphere | RGRYVQTHPLQATFSLIASMLLAALVVLALVLSAK |
| Ga0209267_10196103 | 3300026331 | Soil | MRTPMHWRTERGRHFQAHPLHATYSLVASMLLAGLVVLALVLSAR |
| Ga0209267_10210444 | 3300026331 | Soil | MHTPIHWRTERGRYFQAYPLHATFSLIASMLLAGLVVLVLVLSAR |
| Ga0209377_12627861 | 3300026334 | Soil | MHTPIHWRTERGRYLQAHPLHATFSLIASMLLAGLVVLVL |
| Ga0257166_10130362 | 3300026358 | Soil | MRTLTERGRHFQAHPLQATFSLVASMLLAGLVVLALVLSAR |
| Ga0257169_10710392 | 3300026469 | Soil | MRTLMPWRTERGRYFHAHPQQAMFSLIASMLLAGLV |
| Ga0257164_10365581 | 3300026497 | Soil | TERGRYFHAHPQQAMFSLIASMLLAALVVLALALSAR |
| Ga0209378_10188022 | 3300026528 | Soil | MHTPMHWRTERGRYFQTHPLHATFSLVASMLLAGLVVLVLVMSAR |
| Ga0209056_100961772 | 3300026538 | Soil | MHTPIHWRTERGRYFQAYPLHATFSLIASMLLAGLVVLVLVLSSR |
| Ga0209056_102577231 | 3300026538 | Soil | MRHLMPWRTERGRYFHAHPQQAMFSLIASMLLAALVVLALALSAR |
| Ga0209376_12092312 | 3300026540 | Soil | DWIGREEAAMHTPMHWRTERGRYFQGHPLHATFSLIASMLLVGLLVLVLVLSAR |
| Ga0209076_10033827 | 3300027643 | Vadose Zone Soil | MRTPMHWRTERGRHFQAHPLHATFSLVASMLLAGLVVLALVLSAR |
| Ga0209217_10009919 | 3300027651 | Forest Soil | MRTPMPWRTERGRYFHAHPQQAMFSLIASLLLAGLVVLALALSAR |
| Ga0209217_10040696 | 3300027651 | Forest Soil | MRMHWRTERGRYFHAHPSHATFSLIARMLLAGLVVLALVLSPR |
| Ga0209689_12991361 | 3300027748 | Soil | MHTAMHWRTERGRYFQTHPLHATFSLIASMLLAGLVVLALVLSAR |
| Ga0209580_100643232 | 3300027842 | Surface Soil | MRTLMHFRTHRDRYFHAHPLHGTFSLIASLALAGLVVLMLVLSAR |
| Ga0209180_102326141 | 3300027846 | Vadose Zone Soil | LMPWRTERGRYFHAHPQQAMFSLIASVLLAGLVVLALALSAR |
| Ga0209180_104237691 | 3300027846 | Vadose Zone Soil | MRTLMPWRTERGRYFHAHPQQAMFSLIASMLLAGLVVLAL |
| Ga0209283_109531661 | 3300027875 | Vadose Zone Soil | MRTPMHWRAERGRHFQAHPLQATFSLIASMLLAALVVLALVLS |
| Ga0209068_101994342 | 3300027894 | Watersheds | LTERGRYFHAHPQQAMFSLIASMLLAALVVLALALSAR |
| Ga0209583_100073431 | 3300027910 | Watersheds | GRLAMRILADRGRYFYAHPLHATVSLIANTLLAGLIVLVLVLSAR |
| Ga0268266_100005837 | 3300028379 | Switchgrass Rhizosphere | MWTLMHWRTERGRYVQTHPLQATFSLIASMLLAALVVLALVLSAK |
| Ga0268264_112401361 | 3300028381 | Switchgrass Rhizosphere | EEAAMWTLMHWRTERGRYVQTHPLQATFSLIASMLLAALVVLALVLSAK |
| Ga0137415_100001518 | 3300028536 | Vadose Zone Soil | MRTPMHWRTERGRHFQAQPLHAMFSLVASMLLAGLVILALVLSAR |
| Ga0307469_100356393 | 3300031720 | Hardwood Forest Soil | MRTLTERGRHFQARPLQATFSLIASMLLAGLVVVALVLSAR |
| Ga0307469_124520351 | 3300031720 | Hardwood Forest Soil | YDWVVREEAAMRTPMHWRTERGRYFHAHPQQAMFSLIASIVLAGLVVLALALSAR |
| Ga0306923_110358532 | 3300031910 | Soil | MRTPMHWRAERGRHFHAHPLHATFSLIASMLLAGLLVLAFVLSAR |
| Ga0307479_100150699 | 3300031962 | Hardwood Forest Soil | MRTLTERGRHFHAHPLHATFSLIASMLLAALVVLALVLSAR |
| Ga0307479_102568442 | 3300031962 | Hardwood Forest Soil | VRTLTPWRTERGRYFHAHPQQAMFSLIASMLLAALVVLALALSAR |
| Ga0307471_1000235244 | 3300032180 | Hardwood Forest Soil | MRTLMPWRTERGRYFHAHPQQAMFSLIASMLLAGLVVLALALSAR |
| Ga0307471_1001143563 | 3300032180 | Hardwood Forest Soil | MRTLTERGRHFHAHPLQATFSLIASMLLAALLVLALVLSAR |
| Ga0307472_1001919711 | 3300032205 | Hardwood Forest Soil | DWVGQEEAAMRTPMHWRTERGRHFQVYPLHATYSLVASMLLAGLVVLALVLSAR |
| Ga0307472_1003413922 | 3300032205 | Hardwood Forest Soil | MHTPMHWRTERGRYFHAHPLHATFSLIASMLLAGLVVLVLVLSAR |
| Ga0307472_1006361012 | 3300032205 | Hardwood Forest Soil | MHTAIHWRTERGRYFQAHPLHAAFSLVASMLLAGLIVLVLVLSAK |
| Ga0307472_1010453921 | 3300032205 | Hardwood Forest Soil | MRTLTERGRYFQAHPLQVAFSLIASTLLAGLVVLALVLSAR |
| Ga0306920_1000747353 | 3300032261 | Soil | MRALTHSSTERGRHFQGHPLHATFSLIASMLLAGLLVLAFVLSAR |
| ⦗Top⦘ |