


| Basic Information | |
|---|---|
| Family ID | F040309 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 162 |
| Average Sequence Length | 47 residues |
| Representative Sequence | TSYEGALMSDGSVPEAARAFIRFLANPEARAKWVAARLEPLAER |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 162 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.32 % |
| % of genes near scaffold ends (potentially truncated) | 92.59 % |
| % of genes from short scaffolds (< 2000 bps) | 91.98 % |
| Associated GOLD sequencing projects | 135 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.802 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.074 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.160 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.210 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 162 Family Scaffolds |
|---|---|---|
| PF00583 | Acetyltransf_1 | 14.20 |
| PF01970 | TctA | 11.73 |
| PF00528 | BPD_transp_1 | 8.64 |
| PF03797 | Autotransporter | 6.79 |
| PF13531 | SBP_bac_11 | 2.47 |
| PF00582 | Usp | 1.85 |
| PF13533 | Biotin_lipoyl_2 | 1.85 |
| PF12698 | ABC2_membrane_3 | 1.85 |
| PF00005 | ABC_tran | 1.23 |
| PF11742 | DUF3302 | 1.23 |
| PF00364 | Biotin_lipoyl | 0.62 |
| PF00293 | NUDIX | 0.62 |
| PF03551 | PadR | 0.62 |
| PF02743 | dCache_1 | 0.62 |
| PF11453 | DUF2950 | 0.62 |
| PF01061 | ABC2_membrane | 0.62 |
| PF01594 | AI-2E_transport | 0.62 |
| PF02417 | Chromate_transp | 0.62 |
| PF02786 | CPSase_L_D2 | 0.62 |
| PF13505 | OMP_b-brl | 0.62 |
| PF01070 | FMN_dh | 0.62 |
| PF04613 | LpxD | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 162 Family Scaffolds |
|---|---|---|---|
| COG1784 | TctA family transporter | General function prediction only [R] | 11.73 |
| COG3333 | TctA family transporter | General function prediction only [R] | 11.73 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.62 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.62 |
| COG1044 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.62 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.62 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.62 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.62 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.62 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 0.62 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.42 % |
| Unclassified | root | N/A | 13.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_188680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 843 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0746995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1003 | Open in IMG/M |
| 3300001991|JGI24743J22301_10004697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2240 | Open in IMG/M |
| 3300003911|JGI25405J52794_10161142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 513 | Open in IMG/M |
| 3300004152|Ga0062386_101102124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 659 | Open in IMG/M |
| 3300005180|Ga0066685_10676065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300005332|Ga0066388_101342206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1237 | Open in IMG/M |
| 3300005332|Ga0066388_103780594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 772 | Open in IMG/M |
| 3300005332|Ga0066388_104610788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 701 | Open in IMG/M |
| 3300005353|Ga0070669_100781502 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 810 | Open in IMG/M |
| 3300005364|Ga0070673_101815850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300005366|Ga0070659_100264171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1428 | Open in IMG/M |
| 3300005439|Ga0070711_101921101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
| 3300005440|Ga0070705_100637673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 829 | Open in IMG/M |
| 3300005555|Ga0066692_11021234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300005564|Ga0070664_101932864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 560 | Open in IMG/M |
| 3300005713|Ga0066905_102041261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300005764|Ga0066903_100191668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3038 | Open in IMG/M |
| 3300005764|Ga0066903_103580490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300005764|Ga0066903_104467611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300005764|Ga0066903_105924902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 641 | Open in IMG/M |
| 3300005764|Ga0066903_107849688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 548 | Open in IMG/M |
| 3300006172|Ga0075018_10267233 | Not Available | 833 | Open in IMG/M |
| 3300006580|Ga0074049_10086106 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300006581|Ga0074048_10120637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 660 | Open in IMG/M |
| 3300006935|Ga0081246_1369534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 640 | Open in IMG/M |
| 3300007265|Ga0099794_10730610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 528 | Open in IMG/M |
| 3300009038|Ga0099829_11004105 | Not Available | 692 | Open in IMG/M |
| 3300009088|Ga0099830_10240190 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300009094|Ga0111539_11806955 | Not Available | 709 | Open in IMG/M |
| 3300009100|Ga0075418_12719843 | Not Available | 540 | Open in IMG/M |
| 3300009156|Ga0111538_10735890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1249 | Open in IMG/M |
| 3300009553|Ga0105249_11385824 | Not Available | 775 | Open in IMG/M |
| 3300009792|Ga0126374_11300230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300010036|Ga0126305_10586114 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300010043|Ga0126380_10437766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 984 | Open in IMG/M |
| 3300010046|Ga0126384_11101564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300010046|Ga0126384_11479178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300010047|Ga0126382_10746506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 827 | Open in IMG/M |
| 3300010359|Ga0126376_10639037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1013 | Open in IMG/M |
| 3300010359|Ga0126376_12832613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300010361|Ga0126378_10221565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Aquibium → Aquibium carbonis | 1975 | Open in IMG/M |
| 3300010364|Ga0134066_10427928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300010366|Ga0126379_13586956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300010371|Ga0134125_10445844 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300010373|Ga0134128_12143846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300010398|Ga0126383_12257350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300010403|Ga0134123_10603441 | Not Available | 1055 | Open in IMG/M |
| 3300010868|Ga0124844_1130252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 958 | Open in IMG/M |
| 3300011119|Ga0105246_11270565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300012096|Ga0137389_10685013 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300012201|Ga0137365_10039019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3627 | Open in IMG/M |
| 3300012201|Ga0137365_11213514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300012203|Ga0137399_10887420 | Not Available | 751 | Open in IMG/M |
| 3300012209|Ga0137379_11505728 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300012360|Ga0137375_10269940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1558 | Open in IMG/M |
| 3300012361|Ga0137360_10632263 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300012469|Ga0150984_122158824 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300012683|Ga0137398_10931878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 604 | Open in IMG/M |
| 3300012948|Ga0126375_10035537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2523 | Open in IMG/M |
| 3300012955|Ga0164298_10615104 | Not Available | 748 | Open in IMG/M |
| 3300012971|Ga0126369_10432742 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300012971|Ga0126369_11549965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 752 | Open in IMG/M |
| 3300012971|Ga0126369_12783378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
| 3300012988|Ga0164306_11119525 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300012988|Ga0164306_11237081 | Not Available | 628 | Open in IMG/M |
| 3300014325|Ga0163163_12994044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300014326|Ga0157380_12403913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300014969|Ga0157376_11206548 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300015372|Ga0132256_103722400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300016270|Ga0182036_10926342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 715 | Open in IMG/M |
| 3300016294|Ga0182041_10881506 | Not Available | 804 | Open in IMG/M |
| 3300016371|Ga0182034_11877850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 528 | Open in IMG/M |
| 3300017792|Ga0163161_10226935 | Not Available | 1448 | Open in IMG/M |
| 3300017792|Ga0163161_11085509 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300018081|Ga0184625_10666556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300018468|Ga0066662_11986282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300018482|Ga0066669_10287908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae | 1325 | Open in IMG/M |
| 3300020002|Ga0193730_1113490 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300020579|Ga0210407_10194727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas syringae group → Pseudomonas syringae group genomosp. 1 → Pseudomonas syringae | 1574 | Open in IMG/M |
| 3300021560|Ga0126371_10807722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1084 | Open in IMG/M |
| 3300021560|Ga0126371_12276460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 654 | Open in IMG/M |
| 3300021560|Ga0126371_13856919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300022694|Ga0222623_10194462 | Not Available | 787 | Open in IMG/M |
| 3300022756|Ga0222622_10479794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 886 | Open in IMG/M |
| 3300024288|Ga0179589_10212336 | Not Available | 850 | Open in IMG/M |
| 3300025900|Ga0207710_10099353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1370 | Open in IMG/M |
| 3300025932|Ga0207690_11595087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300025945|Ga0207679_11106432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 727 | Open in IMG/M |
| 3300026035|Ga0207703_10574563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1064 | Open in IMG/M |
| 3300026067|Ga0207678_10837701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 812 | Open in IMG/M |
| 3300026277|Ga0209350_1016131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2340 | Open in IMG/M |
| 3300026555|Ga0179593_1137690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2428 | Open in IMG/M |
| 3300027583|Ga0209527_1025298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1321 | Open in IMG/M |
| 3300027603|Ga0209331_1004106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4118 | Open in IMG/M |
| 3300027812|Ga0209656_10212002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 933 | Open in IMG/M |
| 3300027862|Ga0209701_10106082 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 1751 | Open in IMG/M |
| 3300027882|Ga0209590_10272478 | Not Available | 1083 | Open in IMG/M |
| 3300027903|Ga0209488_10371447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Candidatus Rhodoblastus alkanivorans | 1061 | Open in IMG/M |
| 3300028710|Ga0307322_10037364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → unclassified Methylovirgula → Methylovirgula sp. HY1 | 1162 | Open in IMG/M |
| 3300028720|Ga0307317_10271758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Candidatus Rhodoblastus alkanivorans | 573 | Open in IMG/M |
| 3300028722|Ga0307319_10048754 | Not Available | 1327 | Open in IMG/M |
| 3300028768|Ga0307280_10312328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → unclassified Methylovirgula → Methylovirgula sp. HY1 | 575 | Open in IMG/M |
| 3300028778|Ga0307288_10348030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300028787|Ga0307323_10295460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → unclassified Methylovirgula → Methylovirgula sp. HY1 | 582 | Open in IMG/M |
| 3300028793|Ga0307299_10339589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Candidatus Rhodoblastus alkanivorans | 563 | Open in IMG/M |
| 3300028796|Ga0307287_10170367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Candidatus Rhodoblastus alkanivorans | 827 | Open in IMG/M |
| 3300028824|Ga0307310_10209046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 924 | Open in IMG/M |
| 3300028828|Ga0307312_10322235 | Not Available | 1008 | Open in IMG/M |
| 3300028872|Ga0307314_10062697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → unclassified Methylovirgula → Methylovirgula sp. HY1 | 956 | Open in IMG/M |
| 3300028876|Ga0307286_10120309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → unclassified Methylovirgula → Methylovirgula sp. HY1 | 930 | Open in IMG/M |
| 3300028885|Ga0307304_10113483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → unclassified Methylovirgula → Methylovirgula sp. HY1 | 1096 | Open in IMG/M |
| 3300028885|Ga0307304_10264751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300031198|Ga0307500_10292050 | Not Available | 515 | Open in IMG/M |
| 3300031232|Ga0302323_101884622 | Not Available | 678 | Open in IMG/M |
| 3300031543|Ga0318516_10022479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3241 | Open in IMG/M |
| 3300031547|Ga0310887_10434208 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300031549|Ga0318571_10400992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 535 | Open in IMG/M |
| 3300031549|Ga0318571_10401390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300031573|Ga0310915_10089347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2063 | Open in IMG/M |
| 3300031640|Ga0318555_10308632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 856 | Open in IMG/M |
| 3300031747|Ga0318502_10068525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1908 | Open in IMG/M |
| 3300031747|Ga0318502_10918481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| 3300031748|Ga0318492_10314598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 816 | Open in IMG/M |
| 3300031748|Ga0318492_10713783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300031751|Ga0318494_10114128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1500 | Open in IMG/M |
| 3300031765|Ga0318554_10260619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 987 | Open in IMG/M |
| 3300031779|Ga0318566_10389587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 686 | Open in IMG/M |
| 3300031780|Ga0318508_1022157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1553 | Open in IMG/M |
| 3300031780|Ga0318508_1227673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300031793|Ga0318548_10002779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5876 | Open in IMG/M |
| 3300031797|Ga0318550_10251462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 857 | Open in IMG/M |
| 3300031805|Ga0318497_10336266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 842 | Open in IMG/M |
| 3300031820|Ga0307473_10686773 | Not Available | 717 | Open in IMG/M |
| 3300031831|Ga0318564_10148572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1045 | Open in IMG/M |
| 3300031835|Ga0318517_10555518 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031859|Ga0318527_10189831 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
| 3300031897|Ga0318520_11100979 | Not Available | 503 | Open in IMG/M |
| 3300031910|Ga0306923_12009244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300031941|Ga0310912_11086818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300031942|Ga0310916_11300878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300031945|Ga0310913_10190020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1432 | Open in IMG/M |
| 3300031949|Ga0214473_11116923 | Not Available | 823 | Open in IMG/M |
| 3300032041|Ga0318549_10163591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 993 | Open in IMG/M |
| 3300032042|Ga0318545_10194913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
| 3300032043|Ga0318556_10028593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2571 | Open in IMG/M |
| 3300032044|Ga0318558_10647061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300032052|Ga0318506_10526423 | Not Available | 524 | Open in IMG/M |
| 3300032055|Ga0318575_10021176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2728 | Open in IMG/M |
| 3300032055|Ga0318575_10435695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 665 | Open in IMG/M |
| 3300032059|Ga0318533_10003812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8354 | Open in IMG/M |
| 3300032059|Ga0318533_10212446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1389 | Open in IMG/M |
| 3300032059|Ga0318533_11198895 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300032060|Ga0318505_10287807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 775 | Open in IMG/M |
| 3300032076|Ga0306924_11620039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
| 3300032091|Ga0318577_10389416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
| 3300032094|Ga0318540_10048121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1907 | Open in IMG/M |
| 3300032261|Ga0306920_103247244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
| 3300033289|Ga0310914_10437212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1184 | Open in IMG/M |
| 3300034115|Ga0364945_0278344 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300034150|Ga0364933_180746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300034354|Ga0364943_0287612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.49% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.85% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.85% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.23% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.23% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.62% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.62% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.62% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.62% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.62% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006935 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_03248320 | 2199352025 | Soil | MGLYNLSEIPEGKGLKIAGPVPARCSSRPPTRALMSDGAVPEAAREFIRFLSEPEARAKWLAAKLEPRADH |
| ICChiseqgaiiDRAFT_07469951 | 3300000033 | Soil | MGXYXVSEIPXGXGLAFAGXVPXXXQXXTSYEGAXMSDGXXPXAARAFIRFLAXPDARAK |
| JGI24743J22301_100046974 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | PLQLATTYEGALMSDGAVPEASRAFIRFLAEPDARAKWIAAKLEPFADH* |
| JGI25405J52794_101611421 | 3300003911 | Tabebuia Heterophylla Rhizosphere | TTYEGGLMSDGAVPEAARAFIRFLASPDARPKWVAGKLEPLADH* |
| Ga0062386_1011021242 | 3300004152 | Bog Forest Soil | ISTSYEGALMSDGAEPEAARAFIRFLAGPDAHAQWLAARLEPLGDR* |
| Ga0066685_106760651 | 3300005180 | Soil | TTSYEGALMSDGAVPEAARAFIRFLASHDARAKWLAAKLEPSER* |
| Ga0066388_1013422063 | 3300005332 | Tropical Forest Soil | KGLAFAGPVPALLQIATSYEGALMSDGSEPQAARAFIRFLANPDARAKWLAARLEPLADR |
| Ga0066388_1037805942 | 3300005332 | Tropical Forest Soil | ALAGPVPALLQVTTSYEGALMSDGSVPEAARAFIRFLANPEARTKWVAGRLEPLAER* |
| Ga0066388_1046107881 | 3300005332 | Tropical Forest Soil | ITTSYEGALMSDGSEPQAARAFIRFLANPDARAKWVAARLEPLTGR* |
| Ga0070669_1007815021 | 3300005353 | Switchgrass Rhizosphere | LKIAGPVPAPLQLATTYEGALMSDGAVPEASRAFIRFLTEPDARAKWIAAKLEPFADH* |
| Ga0070673_1018158501 | 3300005364 | Switchgrass Rhizosphere | QLATTYEGALMSDGAVPEAARAFIRFLAEPDARAKWIAAKLEPLADH* |
| Ga0070659_1002641713 | 3300005366 | Corn Rhizosphere | ATTYEGALMSDGAVPEASRAFIRFLAEPDARAKWIAAKLEPFADH* |
| Ga0070711_1019211012 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TTYEGALMSDGSVPQAARAFLRYLAEPEARPKWIAAKLEPAADH* |
| Ga0070705_1006376733 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LQLATTYEGALMSDGAVPEASRAFIRFLAEPDARAKWIAAKLEPFADH* |
| Ga0066692_110212341 | 3300005555 | Soil | SDGAVPEAARAFIRFLASAEARDQWVAAKLEPLPGH* |
| Ga0070664_1019328642 | 3300005564 | Corn Rhizosphere | LTTTYEGALMSDGSVPQAAREFIRFLSDPDARAKWLAAKLEPLADH* |
| Ga0066905_1020412611 | 3300005713 | Tropical Forest Soil | MSDGAVPEAARAFIRFLASPDARPKWVAAKLEPLADH* |
| Ga0066903_1001916686 | 3300005764 | Tropical Forest Soil | VSEIPEGKGLAFAGRVPALLQVATSHEGALMHGSEPQAARAFTRFLANPEARAKWVAARLEPLAER* |
| Ga0066903_1035804901 | 3300005764 | Tropical Forest Soil | LLQIKTSYEGALMSDGAVPEAARAFIRFLASPEAHGKWLAAKLEPSAGRR* |
| Ga0066903_1044676111 | 3300005764 | Tropical Forest Soil | MSDGSVPEAVRAFLRFLASPEARARWTAAKLEPLSGR* |
| Ga0066903_1059249021 | 3300005764 | Tropical Forest Soil | ALMSDGSVPEAARAFIRFMTEPDARARWIAAKLEPLADH* |
| Ga0066903_1078496881 | 3300005764 | Tropical Forest Soil | PVPTLLQIATSYEGAVMSDGSEPQAARAFIRFLANPEARVKWLAARLEPLAER* |
| Ga0075018_102672332 | 3300006172 | Watersheds | ASAGTGTDASYEGALMSEGSAPQAARAFIQFLASEDARPHWLAAKLDPAER* |
| Ga0074049_100861061 | 3300006580 | Soil | EGALMSDGAVPEASRAFIRFLAEPDARAKWIAAKLEPFADH* |
| Ga0074048_101206371 | 3300006581 | Soil | LKIAGPVPAPLQLATTYEGALMSDGAVPEASRAFIRFLAEPDARAKWIAAKLEPFADH* |
| Ga0081246_13695341 | 3300006935 | Tropical Rainforest Soil | DGSEPQAARAFIRFLANPDARAKWVAARLEPLGDRR* |
| Ga0099794_107306101 | 3300007265 | Vadose Zone Soil | KHAGAVPAPLQISTTYEGALLSDGSVPEAVTAFIRFMAEPDARAKWIAAKLEPLLDH* |
| Ga0099829_110041052 | 3300009038 | Vadose Zone Soil | MMTDGAVPEAARALVRFSAGPEARAGWAAAKLEPLPDH* |
| Ga0099830_102401902 | 3300009088 | Vadose Zone Soil | MMTDGAVPETARAFVRFSAGPEARAGWAAAKLEPLPDH* |
| Ga0111539_118069551 | 3300009094 | Populus Rhizosphere | TSYECALMSAGAVPEAARAFIRFLAGPDARAKWLAAKLEPSADH* |
| Ga0075418_127198432 | 3300009100 | Populus Rhizosphere | SDGAVPEAARAFVRFLAGPDARAKWLAAKLEPSAEH* |
| Ga0111538_107358903 | 3300009156 | Populus Rhizosphere | PVPAPLQLTTTYEGALMSDGSVPQAAREFIRFLSDPDARAKWLAAKLEPLADH* |
| Ga0105249_113858242 | 3300009553 | Switchgrass Rhizosphere | DGAVPEAARAFIRFLAGPDARAKWLAAKLEPSADH* |
| Ga0126374_113002302 | 3300009792 | Tropical Forest Soil | LMSDGSEPQAARAFIRFLANPEARAKWLAARLEPLAER* |
| Ga0126305_105861141 | 3300010036 | Serpentine Soil | PVPAPLQLATTYEGALMSDGAVPEASRAFIRFLAEPDARAKWIAAKLEPFADH* |
| Ga0126380_104377663 | 3300010043 | Tropical Forest Soil | GDVTYEGGLMTDGSVPEAARAFVRFLAEPDARAKWLAIKFEPLADH* |
| Ga0126384_111015641 | 3300010046 | Tropical Forest Soil | LQIATSYEGALMSDGSEPQAARAFIRFLANPDAHAKWLAARLEPLAHR* |
| Ga0126384_114791781 | 3300010046 | Tropical Forest Soil | DGSEPQAARAFIRFLANPEARAKWLAARLEPLAER* |
| Ga0126382_107465061 | 3300010047 | Tropical Forest Soil | TSYEGALMSDGSVPEAARAFIRFLANPEARAKWVAARLEPLAER* |
| Ga0126376_106390373 | 3300010359 | Tropical Forest Soil | PVPTLLQIKTSYEGVLMSDGAVPEAARAFIRFLASPEARGKWLAAKLEPSPDR* |
| Ga0126376_128326131 | 3300010359 | Tropical Forest Soil | GLALAGPVPALLQIATSYEGALMSDGSEPQAARAFIRFLANPDAHAKWLAARLEPLAHR* |
| Ga0126378_102215652 | 3300010361 | Tropical Forest Soil | SDGAEPQAARAFIRFLANPEARAKWLAARLEPLAER* |
| Ga0134066_104279281 | 3300010364 | Grasslands Soil | DGAVPEAARAFIRFLASHDARAKWLAAKLEPSER* |
| Ga0126379_135869561 | 3300010366 | Tropical Forest Soil | GAEPQAARAFIRFLANPEARAKWVAAKLEPLAER* |
| Ga0134125_104458441 | 3300010371 | Terrestrial Soil | PLQLATTYEGALMSDGAVPEASRAFIRFLTEPDARAKWIAAKLEPFADH* |
| Ga0134128_121438461 | 3300010373 | Terrestrial Soil | GALMSDGAVPEAARAFIRFLAEPDARAKWIAAKLEPLADH* |
| Ga0126383_122573501 | 3300010398 | Tropical Forest Soil | GPVPALLQIATSYEGALMSDGSEPQAARAFIRFLANPDAHAKWLAARLEPLAHR* |
| Ga0134123_106034413 | 3300010403 | Terrestrial Soil | PAPLQLATTYEGALMSDGAVPEASRAFIRFLAEPDARAKWIAAKLEPFADH* |
| Ga0124844_11302521 | 3300010868 | Tropical Forest Soil | GAVPEAARAFIRFLASPDARAKWVAARLEPLADH* |
| Ga0105246_112705651 | 3300011119 | Miscanthus Rhizosphere | PLQLATTYEGALMSDGAVPEAARAFIRFLAEPDARARWIAAKLEPFADH* |
| Ga0137389_106850132 | 3300012096 | Vadose Zone Soil | TLLQITTSYEGALMSDGSEPQAARAFIRFLANPDARPKWVAARLEPLGER* |
| Ga0137365_100390196 | 3300012201 | Vadose Zone Soil | TNYEGALMSDGSVPEAARAFIRFLAGPDARGKWVAAKLEPPTDR* |
| Ga0137365_112135142 | 3300012201 | Vadose Zone Soil | TNYEGALMSDGSVPEAARAFIRFLAGPDARGKWVAAKLEPPADR* |
| Ga0137399_108874202 | 3300012203 | Vadose Zone Soil | APLQLVTTYEGALMSDGSVPEAARAFIRFLASADARDRWLAARLEPLADR* |
| Ga0137379_115057281 | 3300012209 | Vadose Zone Soil | IVTNYEGALMSDGSVPEAARAFIRFLAGPDARGKWVAAKLEPPTDR* |
| Ga0137375_102699404 | 3300012360 | Vadose Zone Soil | TNYEGALMSDGAVPEAARAFIRFLASPNARGKWLAARLEPPADR* |
| Ga0137360_106322632 | 3300012361 | Vadose Zone Soil | QMTTSYEGALMSDGSEPQAARAFIRFLANPEARAKWVAARLEPLAER* |
| Ga0150984_1221588243 | 3300012469 | Avena Fatua Rhizosphere | APLQLATTYEGALMSDGAVPEASRAFIRFLAEPDARAKWIAAKLEPFADH* |
| Ga0137398_109318782 | 3300012683 | Vadose Zone Soil | LKLAGAVPAPLQISTTYEGALLSDGSVPEAATAFIRFMAEPDARAKWIAAKLEPLLDH* |
| Ga0126375_100355376 | 3300012948 | Tropical Forest Soil | TNYEAALMSDGAVPEAARAFIRYLASHDARAKWIAAKLEPAER* |
| Ga0164298_106151042 | 3300012955 | Soil | KLLQVATSYEGALMSDGAVPEAARAFIRFLAGPDARAKWLAAKLEPSADH* |
| Ga0126369_104327423 | 3300012971 | Tropical Forest Soil | TSYEGAVMSDGAEPLAARAFIRFLASPETRAKWLAARLEPLAER* |
| Ga0126369_115499652 | 3300012971 | Tropical Forest Soil | LGLYNVSEIPQGKGLKLAGPVPAPLQINTTYEAAMTSDGDAFEATRAFILHLADPEARATWLAAKLEPLLDH* |
| Ga0126369_127833782 | 3300012971 | Tropical Forest Soil | DGSEPQAARAFIRFLANPDARAKWVAARLEPLTGR* |
| Ga0164306_111195251 | 3300012988 | Soil | TTYEGALMSDGAVPEAARAFIRFLAEPDARAKWLAAKLEPFAEH* |
| Ga0164306_112370812 | 3300012988 | Soil | SDGSEPQAARAFIRFLASPEARAKWLSARLEPRADR* |
| Ga0163163_129940441 | 3300014325 | Switchgrass Rhizosphere | LQLATTYEGALMSDGAVPEAARAFIRFLAEPDARARWIAAKLEPFADH* |
| Ga0157380_124039132 | 3300014326 | Switchgrass Rhizosphere | GPVPAPLQLATTYEGALMSDGAVPEASRAFIRFLAEPDARAKWIAAKLEPFADH* |
| Ga0157376_112065481 | 3300014969 | Miscanthus Rhizosphere | TTYEGALMSDGAVPEAARAFIRFLAEPDARARWIAAKLEPFADH* |
| Ga0132256_1037224001 | 3300015372 | Arabidopsis Rhizosphere | LQINTTYEGALMSDGSVPQAARAFLRYLAEPEARPKWIAAKLEPAADH* |
| Ga0182036_109263421 | 3300016270 | Soil | TLLQIKTSYEGALMSDGAVPEAARAFIRFLASNEVRAKWLAAKLEPSPDR |
| Ga0182041_108815061 | 3300016294 | Soil | VPALLQVATMYEAALMSDGSVPEAARAFIQFLSAPGARAKWTAAKLEPAGR |
| Ga0182034_118778501 | 3300016371 | Soil | SEIPEGKGLALAGPVPALLQIATSYEGALMSNGSVPEATRAFIRFLANPEARAKWVAAKLEPLAER |
| Ga0163161_102269351 | 3300017792 | Switchgrass Rhizosphere | LSEIPEGKGLKIAGPVPAPLQLATTYEGALMSDGAVPETSRAFIRFLAEPDARAKWIAAKLEPFADH |
| Ga0163161_110855091 | 3300017792 | Switchgrass Rhizosphere | LMSDGAVPEAARAFIRFLAEPDARAKWLAAKLEPFAEH |
| Ga0184625_106665561 | 3300018081 | Groundwater Sediment | EGTGVKLAGPVPAPLQLTTTFEGALMSDGSVPEAARAYIRFLANADARDKWTAAKLEPLGDH |
| Ga0066662_119862821 | 3300018468 | Grasslands Soil | VTTSYEGALMSDGAVPEAARAFIRFLASHDARAKWLAAKLEPSER |
| Ga0066669_102879081 | 3300018482 | Grasslands Soil | YEGALMSDGAVPEAARAFIRFLAGPEARAKWLAAKLEPTPEH |
| Ga0193730_11134903 | 3300020002 | Soil | LMSDGSVPQAAREFIRFLSDPDARAKWLAARLEPLADH |
| Ga0210407_101947271 | 3300020579 | Soil | SYEGGLMSDGAVPEAARAFIRFLASIEARPKWVAAKLEPSTEH |
| Ga0126371_108077221 | 3300021560 | Tropical Forest Soil | EGAVMSDGAVPEAARAFIRFLAGSEARPKWLAAKLEPSPDR |
| Ga0126371_122764601 | 3300021560 | Tropical Forest Soil | IPEGKGLAFAGPVPALLQIATSYEGALMSDGSEPQAARAFIRFLANPDAHAKWLAARLEPLAHR |
| Ga0126371_138569191 | 3300021560 | Tropical Forest Soil | AGPVPALLQIATSYEGAVMSDGAEPLAARAFIRFLANPEARAKWVAARLEPLAER |
| Ga0222623_101944621 | 3300022694 | Groundwater Sediment | ALMSDGSVPQAAREFIRSLSDPDARAKWLAARLEPLADH |
| Ga0222622_104797941 | 3300022756 | Groundwater Sediment | GPVPAPLQLATTYEGALMSDGSVPQAAREFIRFLSEPEARAKWLAARLEPLADH |
| Ga0179589_102123361 | 3300024288 | Vadose Zone Soil | GALMSDGSEPQAVRAFVRFLASPEARAKWLAARLEPPADR |
| Ga0207710_100993531 | 3300025900 | Switchgrass Rhizosphere | ELQINTTYEGALMSDGSVPQAARAFLRYLAEPEARPKWIAAKLEPAADH |
| Ga0207690_115950872 | 3300025932 | Corn Rhizosphere | GALMSDGAVPEASRAFIRFLAEPDARAKWIAAKLEPFADH |
| Ga0207679_111064321 | 3300025945 | Corn Rhizosphere | LQLTTTYEGALMSDGSVPQAAREFIRFLSDPDARAKWLAAKLEPLADH |
| Ga0207703_105745632 | 3300026035 | Switchgrass Rhizosphere | YEGALMSDGSVPQAAREFIRFLSDPDARAKWLAAKLEPLADH |
| Ga0207678_108377011 | 3300026067 | Corn Rhizosphere | AGPVPAPLQLTTTYEGALMSDGSVPQAAREFIRFLSDPDARAKWLAAKLEPLADH |
| Ga0209350_10161313 | 3300026277 | Grasslands Soil | MSDGSVPEAARAFIRFLAGPDARGKWVAAKLEPPADR |
| Ga0179593_11376904 | 3300026555 | Vadose Zone Soil | MSDGSVPQAAREFIRFLSDPDARAKWLAARLEPLADH |
| Ga0209527_10252983 | 3300027583 | Forest Soil | ASAGTGMDASYEGALMSEGSVPQAARAFIHFLASEDARPHWLAAKLDPVGER |
| Ga0209331_10041063 | 3300027603 | Forest Soil | MSDGTAPEAARAFILLLASPDARSAWVAAKLEPASDR |
| Ga0209656_102120022 | 3300027812 | Bog Forest Soil | QISTSYEGALMSDGAEPEAARAFIRFLAGPDAHAQWLAARLEPLGDR |
| Ga0209701_101060822 | 3300027862 | Vadose Zone Soil | MMTDGAVPETARAFVRFSAGPEARAGWAAAKLEPLPDH |
| Ga0209590_102724781 | 3300027882 | Vadose Zone Soil | DGSEPQAARAFVRFLASPEARAKWLAARLKPLADR |
| Ga0209488_103714471 | 3300027903 | Vadose Zone Soil | PLQLATTYEGALMSDGSVPQAAREFIRFLSDPDARAKWLAARLEPLADH |
| Ga0307322_100373643 | 3300028710 | Soil | LKIAGPVPAPLQLATTYEGALMSDGSVPQAAREFIRFLSEPEARAKWLAARLEPLAGH |
| Ga0307317_102717582 | 3300028720 | Soil | DGSVPQAAREFIRFLSEPEARAKWLAARLEPLADH |
| Ga0307319_100487543 | 3300028722 | Soil | YEGALMSDGSVPQAAREFIRFLSEPEARAKWLAARLEPLADH |
| Ga0307280_103123282 | 3300028768 | Soil | GLKIAGSVPAPLQLATTYEGALMSDGSVPQAAREFIRFLSDPDARAKWLAARLEPLADH |
| Ga0307288_103480302 | 3300028778 | Soil | LMSDGSVPQAAREFIRFLSEPEARAKWLAARLEPLADH |
| Ga0307323_102954601 | 3300028787 | Soil | LQLATTYEGALMSDGSVPQAAREFIRFLSDPDARAKWLAARLEPLADH |
| Ga0307299_103395891 | 3300028793 | Soil | PAPLQLATTYEGALMSDGSVPQAAREFIRFLSDPDARAKWLAARLEPLADH |
| Ga0307287_101703671 | 3300028796 | Soil | IAGPVPAPLQLATTYEGALMSDGSVPQAAREFIRFLSEPEARAKWLAARLEPLADH |
| Ga0307310_102090463 | 3300028824 | Soil | PVPAPLQLATTYEGALMSDGSVPQAAREFIRFLSEPEARAKWLAARLEPLADH |
| Ga0307312_103222351 | 3300028828 | Soil | GPVPAPLQLATTYEGALMSDGSVPQAAREFIRFLSDPDARAKWLAARLEPLADH |
| Ga0307314_100626973 | 3300028872 | Soil | SYEGALMSDGSVPQAAREFIRFLSEPEARAKWLAARLEPLADH |
| Ga0307286_101203092 | 3300028876 | Soil | AGPVPAPLHLATTYEGALMSDGSVPQAAREFIRFLSEPEARAKWLAARLEPLADH |
| Ga0307304_101134833 | 3300028885 | Soil | ATTYEGALMSDGSVPQAAREFIRFLSEPEARAKWLAARLEPLAGH |
| Ga0307304_102647511 | 3300028885 | Soil | PVPAPLQLATTYEGALMSDGSVPQAAREFIRFLSDPDARAKWLAARLEPLADH |
| Ga0307500_102920502 | 3300031198 | Soil | TDGRVPEAARAFVRFLSEPDARAKWISSKLEPLADH |
| Ga0302323_1018846221 | 3300031232 | Fen | KSGAPDAETYEAALMSDGAAVEASRAFVNFLAGEDVRAKWAAAGLEPLGDR |
| Ga0318516_100224795 | 3300031543 | Soil | IDTTYEGALMSDGVEADTARAFIRFLASPEARASWVAARLEPLGEQ |
| Ga0310887_104342081 | 3300031547 | Soil | YEGALMSDGAVPEASRAFIRFLAEPDARAKWIAAKLEPFADH |
| Ga0318571_104009922 | 3300031549 | Soil | GALMSDGAVPEAARAFIRFLASNEVRAKWLAAKLEPSPDR |
| Ga0318571_104013902 | 3300031549 | Soil | LMSDGVEADTARAFIRFLASPEARASWVAARLEPLGEQ |
| Ga0310915_100893471 | 3300031573 | Soil | GPVPARLQIATSYEGALMSDGSEPLAARAFIRFLANPEARAKWLAARLEPLADH |
| Ga0318555_103086321 | 3300031640 | Soil | LQIKTSYEGALMSDGAVPEAARAFIRFLASNEVRAKWLAAKLEPSPDR |
| Ga0318502_100685251 | 3300031747 | Soil | GLTLAGPVPAPLQLTTSYEGALMSDGSEPQAARAFIRFLANLDARAKWIAARLEPLGDRR |
| Ga0318502_109184812 | 3300031747 | Soil | IATSYEGALMSDGSVPEATRAFIRFLANPEARAKWLAARLEPPAER |
| Ga0318492_103145982 | 3300031748 | Soil | YNVSEIPEGKGLALAGPVPALLQIATSYEGALMSDGSVPEATRAFIRFLANPEARAKWLAARLEPPAER |
| Ga0318492_107137832 | 3300031748 | Soil | YEGALMSDGSEPQAARAFIRFLANLDARAKWIAARLEPLGDRR |
| Ga0318494_101141283 | 3300031751 | Soil | GALMSDGVEADTARAFIRFLASPEARASWVAARLEPLGEQ |
| Ga0318554_102606191 | 3300031765 | Soil | TYEGALMSDGVEADTARAFIRFLASPEARASWVAARLEPLGEQ |
| Ga0318566_103895872 | 3300031779 | Soil | GKGLALAGPVPALLQIATSYEGALMSNGSVPEATRAFIRFLANPEARAKWVAAKLEPLAE |
| Ga0318508_10221573 | 3300031780 | Soil | DTTYEGALMSDGVEADTARAFIRFLASPEARASWVAARLEPLGEQ |
| Ga0318508_12276732 | 3300031780 | Soil | SEIPEGKGLALAGPVPALLQIATSYEGALMSDGSVPEATRAFIRFLANPEARAKWLAARLEPPAER |
| Ga0318548_100027799 | 3300031793 | Soil | MSDGSEPQAARAFIRFLANLDARAKWIAARLEPLGDRR |
| Ga0318550_102514622 | 3300031797 | Soil | GLYNVSEIPEGKGLALAGPVPALLQIATSYEGALMSNGSVPEATRAFIRFLANPEARAKWVAAKLEPLAER |
| Ga0318497_103362662 | 3300031805 | Soil | LQIATSYEGALMSDGSVPEATRAFIRFLANPEARAKWLAARLEPPAER |
| Ga0307473_106867731 | 3300031820 | Hardwood Forest Soil | EGGLMTDGSVPEAASAFVRFLAEPDARAKWLAAKLDPLADH |
| Ga0318564_101485723 | 3300031831 | Soil | QIATSYEGALMSDGSEPQAARAFIRFLANPEARAKWVAARLEPLADH |
| Ga0318517_105555182 | 3300031835 | Soil | LQLTTSYEGALMSDGSEPQAARAFIRFLANPDARAKWVAARLEPLTGR |
| Ga0318527_101898312 | 3300031859 | Soil | VPPPLQVHTVYEGALMSDGSEPEASRAFIRFLAGSGTRATWVAARLEPLGDR |
| Ga0318520_111009791 | 3300031897 | Soil | LLQVATMYEAALMSDGSVPEAARAFIQFLSAPGARAKWTAAKLEPAGR |
| Ga0306923_120092441 | 3300031910 | Soil | SYEGALMSDGSEPQAARAFIRFLANPDARAKWVAARLEPLTGR |
| Ga0310912_110868182 | 3300031941 | Soil | KGLTLAGPVPAPLQLTTSYEGALMSDGSEPQAARAFIRFLANLDARAKWIAARLEPLGDR |
| Ga0310916_113008782 | 3300031942 | Soil | SDGSEPQAARAFIRFLANPDARAKWLAARLEPLGDRR |
| Ga0310913_101900201 | 3300031945 | Soil | YEGALMSDGSEPEASRAFIRFLAGSGTRATWVAARLEPLGDR |
| Ga0214473_111169231 | 3300031949 | Soil | FAGPVPNPLQINTVYEAALMSDGSVVEAARAFIRFLASADARPRWAAAKLEPLADH |
| Ga0318549_101635911 | 3300032041 | Soil | PVPALLQIATSYEGALMSDGSEPLAARAFIRFLANPEARAKWLAARLEPLADH |
| Ga0318545_101949131 | 3300032042 | Soil | LYNVSEIPEGKGLALAGPVPALLQIATSYEGALMSDGSVPEATRAFIRFLANPEARAKWLAARLEPPAER |
| Ga0318556_100285934 | 3300032043 | Soil | LTTSYEGALMSDGSEPQAARAFIRFLANLDARAKWIAARLEPLGDRR |
| Ga0318558_106470612 | 3300032044 | Soil | TTYEGALMSDGVEADTARAFIRFLASPEARASWVAARLEPLGEQ |
| Ga0318506_105264231 | 3300032052 | Soil | LQVATMYEAALMSDGSVPEAARAFIQFLSAPGARAKWTAAKLEPAGR |
| Ga0318575_100211765 | 3300032055 | Soil | APLQLTTSYEGALMSDGSEPQAARAFIRFLANLDARAKWIAARLEPLGDRR |
| Ga0318575_104356952 | 3300032055 | Soil | GLALAGPVPALLQIATSYEGALMSDGSVPEATRAFIRFLANPEARAKWLAARLEPPAER |
| Ga0318533_100038127 | 3300032059 | Soil | QIDTTYEGALMSDGVEADTARAFIRFLASPEARASWVAARLEPLGEQ |
| Ga0318533_102124462 | 3300032059 | Soil | SYEGAVMSDGAEPQAARAFIRFLANPEARAKWLAAKLEPLAER |
| Ga0318533_111988951 | 3300032059 | Soil | EGALMSDGSEPQAARAFIRFLANLDARAKWIAARLEPLGDRR |
| Ga0318505_102878072 | 3300032060 | Soil | GALMSDGSEPEASRAFIRFLAGSGTRATWVAARLEPLGDR |
| Ga0306924_116200392 | 3300032076 | Soil | PAPLQVDTSYEGGLLSDGSVPEAARALIEFLASSDNHPHWSAARLEPLGDR |
| Ga0318577_103894161 | 3300032091 | Soil | QVHTVYEGALMSDGSEPEASRAFIRFLAGSGTRATWVAARLEPLGDR |
| Ga0318540_100481214 | 3300032094 | Soil | TTSYEGALMSDGSEPQAARAFIRFLANLDARAKWIAARLEPLGDRR |
| Ga0306920_1032472441 | 3300032261 | Soil | PVQITTSYEGALMSDGSEPQAARAFIRFLANPDARAKWVAARLEPLTGR |
| Ga0310914_104372121 | 3300033289 | Soil | IVYEGALMSDGAAPEAARAFILFLGSPDARPAWIAAKLDPAPDR |
| Ga0364945_0278344_341_454 | 3300034115 | Sediment | MSDGSVPEAARAFVRFLASADARDKWTAAKLEPLGEH |
| Ga0364933_180746_411_524 | 3300034150 | Sediment | MSDGSVPEAARAYIRFLANADARDKWTAAKLEPLGDH |
| Ga0364943_0287612_496_609 | 3300034354 | Sediment | MSDGAVPEASRAFIRFLAEPDARAKWIAAKLEPFADH |
| ⦗Top⦘ |