


| Basic Information | |
|---|---|
| Family ID | F040269 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 162 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPE |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 162 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.33 % |
| % of genes near scaffold ends (potentially truncated) | 74.07 % |
| % of genes from short scaffolds (< 2000 bps) | 67.28 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.136 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.926 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.457 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.827 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.61% β-sheet: 0.00% Coil/Unstructured: 89.39% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 162 Family Scaffolds |
|---|---|---|
| PF08281 | Sigma70_r4_2 | 90.74 |
| PF01565 | FAD_binding_4 | 1.85 |
| PF08241 | Methyltransf_11 | 1.23 |
| PF04229 | GrpB | 1.23 |
| PF14520 | HHH_5 | 0.62 |
| PF04030 | ALO | 0.62 |
| PF00501 | AMP-binding | 0.62 |
| PF12697 | Abhydrolase_6 | 0.62 |
| PF13379 | NMT1_2 | 0.62 |
| PF00378 | ECH_1 | 0.62 |
| PF07859 | Abhydrolase_3 | 0.62 |
| PF04542 | Sigma70_r2 | 0.62 |
| COG ID | Name | Functional Category | % Frequency in 162 Family Scaffolds |
|---|---|---|---|
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 1.23 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.62 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.62 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.62 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.62 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.62 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.62 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.14 % |
| Unclassified | root | N/A | 30.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10183054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 846 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101729815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300004635|Ga0062388_100187917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1616 | Open in IMG/M |
| 3300004635|Ga0062388_102142121 | Not Available | 581 | Open in IMG/M |
| 3300005332|Ga0066388_107070313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300005354|Ga0070675_101161291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 710 | Open in IMG/M |
| 3300005434|Ga0070709_10449548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 970 | Open in IMG/M |
| 3300005435|Ga0070714_100536914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1118 | Open in IMG/M |
| 3300005435|Ga0070714_101397241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 683 | Open in IMG/M |
| 3300005439|Ga0070711_101624100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300005445|Ga0070708_100608230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1030 | Open in IMG/M |
| 3300005467|Ga0070706_102124384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 507 | Open in IMG/M |
| 3300005468|Ga0070707_100087069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3021 | Open in IMG/M |
| 3300005471|Ga0070698_101183715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 713 | Open in IMG/M |
| 3300005471|Ga0070698_101798434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300005535|Ga0070684_100289900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1500 | Open in IMG/M |
| 3300005536|Ga0070697_100041651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 3718 | Open in IMG/M |
| 3300005536|Ga0070697_101078630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
| 3300005539|Ga0068853_100341914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1390 | Open in IMG/M |
| 3300005547|Ga0070693_100148706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1481 | Open in IMG/M |
| 3300005549|Ga0070704_100662237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 922 | Open in IMG/M |
| 3300005616|Ga0068852_102500249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300006028|Ga0070717_11086617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 728 | Open in IMG/M |
| 3300006173|Ga0070716_100995383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 662 | Open in IMG/M |
| 3300006175|Ga0070712_100973532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 733 | Open in IMG/M |
| 3300006755|Ga0079222_10431969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 932 | Open in IMG/M |
| 3300006755|Ga0079222_12426873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 525 | Open in IMG/M |
| 3300006806|Ga0079220_11731539 | Not Available | 548 | Open in IMG/M |
| 3300009088|Ga0099830_10565336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 931 | Open in IMG/M |
| 3300009148|Ga0105243_12215048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300009177|Ga0105248_11716111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 712 | Open in IMG/M |
| 3300009522|Ga0116218_1065322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1655 | Open in IMG/M |
| 3300009522|Ga0116218_1090015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1398 | Open in IMG/M |
| 3300009672|Ga0116215_1430584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300010343|Ga0074044_10027203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4065 | Open in IMG/M |
| 3300010371|Ga0134125_10900781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 972 | Open in IMG/M |
| 3300010376|Ga0126381_102740865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
| 3300010376|Ga0126381_103819801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
| 3300010379|Ga0136449_100362130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2598 | Open in IMG/M |
| 3300012198|Ga0137364_11294723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
| 3300012199|Ga0137383_10914048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 641 | Open in IMG/M |
| 3300012208|Ga0137376_10484161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1074 | Open in IMG/M |
| 3300012211|Ga0137377_10020010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5898 | Open in IMG/M |
| 3300012211|Ga0137377_10229113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1785 | Open in IMG/M |
| 3300012357|Ga0137384_11087828 | Not Available | 641 | Open in IMG/M |
| 3300012955|Ga0164298_10111807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1467 | Open in IMG/M |
| 3300012987|Ga0164307_10412327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 999 | Open in IMG/M |
| 3300014325|Ga0163163_10552391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1214 | Open in IMG/M |
| 3300015371|Ga0132258_10876529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2266 | Open in IMG/M |
| 3300015371|Ga0132258_10948293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2173 | Open in IMG/M |
| 3300015373|Ga0132257_102095709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
| 3300015373|Ga0132257_102095710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 731 | Open in IMG/M |
| 3300016270|Ga0182036_10978868 | Not Available | 696 | Open in IMG/M |
| 3300017926|Ga0187807_1205278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300017928|Ga0187806_1047273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1304 | Open in IMG/M |
| 3300017966|Ga0187776_10735882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 701 | Open in IMG/M |
| 3300018058|Ga0187766_11065637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
| 3300019875|Ga0193701_1080757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300019879|Ga0193723_1195054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300020579|Ga0210407_10624163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 839 | Open in IMG/M |
| 3300020581|Ga0210399_10959569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 691 | Open in IMG/M |
| 3300021088|Ga0210404_10154380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1205 | Open in IMG/M |
| 3300021171|Ga0210405_10672821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 801 | Open in IMG/M |
| 3300021171|Ga0210405_11071431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300021180|Ga0210396_10889349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
| 3300021405|Ga0210387_11275502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 636 | Open in IMG/M |
| 3300021445|Ga0182009_10357143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 747 | Open in IMG/M |
| 3300021474|Ga0210390_10906463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 725 | Open in IMG/M |
| 3300021478|Ga0210402_10464590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1175 | Open in IMG/M |
| 3300021478|Ga0210402_11192669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 688 | Open in IMG/M |
| 3300021559|Ga0210409_11306038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 601 | Open in IMG/M |
| 3300022756|Ga0222622_11375951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300025898|Ga0207692_11096220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300025913|Ga0207695_10897434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
| 3300025915|Ga0207693_11177770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
| 3300025917|Ga0207660_10500207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 986 | Open in IMG/M |
| 3300025922|Ga0207646_10075994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3001 | Open in IMG/M |
| 3300027765|Ga0209073_10100561 | Not Available | 1020 | Open in IMG/M |
| 3300027765|Ga0209073_10295598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 641 | Open in IMG/M |
| 3300027824|Ga0209040_10259102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 868 | Open in IMG/M |
| 3300027825|Ga0209039_10129124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1064 | Open in IMG/M |
| 3300027882|Ga0209590_10816814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
| 3300027884|Ga0209275_10862959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 522 | Open in IMG/M |
| 3300027905|Ga0209415_10082290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3697 | Open in IMG/M |
| 3300028380|Ga0268265_11851990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300028792|Ga0307504_10119366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 863 | Open in IMG/M |
| 3300028799|Ga0307284_10283467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| 3300028799|Ga0307284_10317836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 627 | Open in IMG/M |
| 3300028906|Ga0308309_10686569 | Not Available | 890 | Open in IMG/M |
| 3300030707|Ga0310038_10133361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1255 | Open in IMG/M |
| 3300031543|Ga0318516_10194187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1171 | Open in IMG/M |
| 3300031546|Ga0318538_10112646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1415 | Open in IMG/M |
| 3300031640|Ga0318555_10779541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300031681|Ga0318572_10293346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 960 | Open in IMG/M |
| 3300031681|Ga0318572_10927250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 517 | Open in IMG/M |
| 3300031715|Ga0307476_10385101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1035 | Open in IMG/M |
| 3300031765|Ga0318554_10144051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1351 | Open in IMG/M |
| 3300031771|Ga0318546_11213396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 530 | Open in IMG/M |
| 3300031798|Ga0318523_10204448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 987 | Open in IMG/M |
| 3300031831|Ga0318564_10124669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1147 | Open in IMG/M |
| 3300031890|Ga0306925_11195275 | Not Available | 762 | Open in IMG/M |
| 3300031890|Ga0306925_12014894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
| 3300031912|Ga0306921_10824558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1058 | Open in IMG/M |
| 3300031942|Ga0310916_11457441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 559 | Open in IMG/M |
| 3300032001|Ga0306922_12205842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 531 | Open in IMG/M |
| 3300032052|Ga0318506_10317450 | Not Available | 691 | Open in IMG/M |
| 3300032076|Ga0306924_10169848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2501 | Open in IMG/M |
| 3300032089|Ga0318525_10551371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300032090|Ga0318518_10164491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1130 | Open in IMG/M |
| 3300032160|Ga0311301_10650319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1500 | Open in IMG/M |
| 3300032160|Ga0311301_11708117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 757 | Open in IMG/M |
| 3300032180|Ga0307471_104055981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
| 3300032261|Ga0306920_102059287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 798 | Open in IMG/M |
| 3300032783|Ga0335079_10718855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1042 | Open in IMG/M |
| 3300032828|Ga0335080_10949761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 878 | Open in IMG/M |
| 3300032829|Ga0335070_10870331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 835 | Open in IMG/M |
| 3300032895|Ga0335074_11567879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
| 3300032954|Ga0335083_10103505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2798 | Open in IMG/M |
| 3300032955|Ga0335076_10304161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1483 | Open in IMG/M |
| 3300032955|Ga0335076_11729093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 514 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.79% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.32% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.09% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.09% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.09% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.47% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.23% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.23% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.23% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.62% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.62% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.62% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_101830541 | 3300001356 | Peatlands Soil | MSGPDAMHGEMPGFPPGRPGGERDEPLLDMIFDRRPIPPG |
| JGIcombinedJ26739_1017298152 | 3300002245 | Forest Soil | LNEPDAVASEMPGFPFPGRPGGEHDEPLLDMIIARRVL |
| Ga0062388_1001879173 | 3300004635 | Bog Forest Soil | MSGPDAMHGEMPGFFPGRPGGERDEPLLDMIFDRRPLPPGA |
| Ga0062388_1021421212 | 3300004635 | Bog Forest Soil | MSGPDAMYGEMPGFSPGRPGGERDEPLLDMIFDRRPLPPGA |
| Ga0066388_1070703132 | 3300005332 | Tropical Forest Soil | MQGEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEIHGL |
| Ga0070675_1011612912 | 3300005354 | Miscanthus Rhizosphere | LSARHAMHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAS |
| Ga0070709_104495481 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LSGPDAMHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGASPEFHGLARMLA |
| Ga0070714_1005369141 | 3300005435 | Agricultural Soil | LRPPDAMHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAP |
| Ga0070714_1013972412 | 3300005435 | Agricultural Soil | LSPPDAMHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAP |
| Ga0070711_1016241001 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LSPPDAMHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPP |
| Ga0070708_1006082301 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LSARDAMHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPG |
| Ga0070706_1021243841 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LSARDAMDDEMPGFFPGRPGGEHDEPLLDMILERRPIPPG |
| Ga0070707_1000870691 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LSGPDAMHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPE |
| Ga0070698_1011837152 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LSGPDAMHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEIHGL |
| Ga0070698_1017984342 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LSPPDAMHDEMPGSFPGRPGGEHDEPLLDMILERRPIPPGAPPEIHGLARMLA |
| Ga0070684_1002899004 | 3300005535 | Corn Rhizosphere | MSGPDAMHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGA |
| Ga0070697_1000416517 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LSGLDAMHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPG |
| Ga0070697_1010786301 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LSPPDAMHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEIHGLA |
| Ga0068853_1003419144 | 3300005539 | Corn Rhizosphere | LSGPDAMRDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGA |
| Ga0070693_1001487064 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MHGEMPGFFPGRPGGEHDEPLLDMILERRPIPPGASPEFHGL |
| Ga0070704_1006622372 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LSGPDAMHGEMPGFFPGRPGGEHDEPLLDMILERRPIPPGA |
| Ga0070763_107307532 | 3300005610 | Soil | MPGSPFPGRPGGEHDEPLLDMIIARRALPPDAPQPMHDLAR |
| Ga0068852_1025002491 | 3300005616 | Corn Rhizosphere | MHGEMPGFFPGRPGGEHDEPLLDMILERRPIPPGA |
| Ga0066903_1090588011 | 3300005764 | Tropical Forest Soil | MPGFSIPGRPGGEHDEPLLDMIIARRALPPDAPQEMHDLARMLAA |
| Ga0070717_110866172 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LSPPDAMHDEMPGFFPGRPGGEHDEPLLDMILERRPI |
| Ga0070716_1009953831 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MHGEMPGFFPGRPGGEHDEPLLDMILERRPIPPGASPEFHGLA |
| Ga0070712_1009735321 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGFFPGRPGGEDDEPLLDMILERRPIPPGASPEFHGLARMLAAVAG |
| Ga0079222_104319691 | 3300006755 | Agricultural Soil | LSGPDAIHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPE |
| Ga0079222_124268731 | 3300006755 | Agricultural Soil | MNGPDAMHDEMPGFFPGRPGGEHDEPLLDMLLERRPIPPGAP |
| Ga0079220_117315392 | 3300006806 | Agricultural Soil | MSGPDAMHDEMPGFFPGRPGGEHDEPLLDMLLERRPIPPGAP |
| Ga0099830_105653361 | 3300009088 | Vadose Zone Soil | MHGEMPGFFPGRPGGEHDEPLLDMLLERRPIPPGAPPEVHDLACMLVAAARP |
| Ga0105243_122150481 | 3300009148 | Miscanthus Rhizosphere | MHGEMPGFFPGRPGGEHDEPLLDMILERRPIPPGASPEFHGLALML |
| Ga0105248_117161112 | 3300009177 | Switchgrass Rhizosphere | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAS |
| Ga0116218_10653221 | 3300009522 | Peatlands Soil | MSGADAMRGEMPGFFPGRPGGERGEPLLDMIFDRRPLPPGAP |
| Ga0116218_10900151 | 3300009522 | Peatlands Soil | MHGEMPGFFPGRPGGERDEPLLDMIFDRRPLPPGAPPEMHDLARMLAA |
| Ga0116215_14305841 | 3300009672 | Peatlands Soil | MSGPDALHGEMPGFPPGRPGGERDEPLLDMIFDRRP |
| Ga0116224_100395341 | 3300009683 | Peatlands Soil | VNDPDAVQDEMPGFSFPGRPGGEHDEPLLDMIIARRALPPDAPQAMHDLA |
| Ga0074044_100272031 | 3300010343 | Bog Forest Soil | MSGPDAMHGEMPGFFPGRPGGERDEPLLDMIFDRRPLPPGAPPEMHDL |
| Ga0126372_107449742 | 3300010360 | Tropical Forest Soil | MPGFFPGRPGGEHDEPLLDMIISRRALPPDAPHEMHDLARMLAAL |
| Ga0134125_109007813 | 3300010371 | Terrestrial Soil | MHDEMPGFFPGRPGGEHDEPLLGMILERRPIPPGAPP |
| Ga0126381_1027408652 | 3300010376 | Tropical Forest Soil | MQGEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEIH |
| Ga0126381_1038198011 | 3300010376 | Tropical Forest Soil | MPGEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEIHGL |
| Ga0136449_1003621305 | 3300010379 | Peatlands Soil | MSGPDALHGEMPGFPPGRPGGERDEPLLDMIFDRRPIPPGAPPEMHDLARML |
| Ga0137364_112947232 | 3300012198 | Vadose Zone Soil | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEIHGLA |
| Ga0137383_109140482 | 3300012199 | Vadose Zone Soil | MHDEMSGFFPGRPGGEHDEPLLDMILERRPIPPGAP |
| Ga0137376_104841613 | 3300012208 | Vadose Zone Soil | MHDEMSGFFPGRPGGEHDEPLLDMILERRPIAPGAPP |
| Ga0137377_100200101 | 3300012211 | Vadose Zone Soil | MHDEMSGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEIHGLALML |
| Ga0137377_102291131 | 3300012211 | Vadose Zone Soil | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEIHGLALML |
| Ga0137384_110878282 | 3300012357 | Vadose Zone Soil | MHDEMPGFFPGRPGGEHDEPLLDMLLERRPIPPGAPPELHDLAR |
| Ga0164298_101118074 | 3300012955 | Soil | MHGEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEFHGLARMLA |
| Ga0164307_104123273 | 3300012987 | Soil | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEFHGLARMLAA |
| Ga0163163_105523911 | 3300014325 | Switchgrass Rhizosphere | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPVASPEFHGLALML |
| Ga0132258_108765295 | 3300015371 | Arabidopsis Rhizosphere | MQGEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEFHGLA |
| Ga0132258_109482935 | 3300015371 | Arabidopsis Rhizosphere | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEFHGLA |
| Ga0132257_1020957091 | 3300015373 | Arabidopsis Rhizosphere | MHDEMPGFSPGRPGGEHDEPLLDMILERRPIPPGAPPEFHGLALMLATV |
| Ga0132257_1020957101 | 3300015373 | Arabidopsis Rhizosphere | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEFHGLALMLATV |
| Ga0182036_109788681 | 3300016270 | Soil | MTGPGAMHGEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEI |
| Ga0182040_115544501 | 3300016387 | Soil | MPGIPFPGRPGGEHDEPLLDMLIMRRALPPDAPQEMHDLARMLGA |
| Ga0187812_11128171 | 3300017821 | Freshwater Sediment | MPGFPFPGRPGGEHDEPLLDMIIARRALPPDAPQAMHDL |
| Ga0187807_12052783 | 3300017926 | Freshwater Sediment | MSGPYARHGEMPGFFPGRPGGERDEPLLDMIFDRRPLPPGAPPEMH |
| Ga0187806_10472733 | 3300017928 | Freshwater Sediment | MNEPDAVQDEMPGFPFPGRPGGEHDEPLLDMIIARRA |
| Ga0187814_101409253 | 3300017932 | Freshwater Sediment | MPGFPFPGRPGGERDEPLLDMIIARRALPPDAPSAM |
| Ga0187801_102821382 | 3300017933 | Freshwater Sediment | MSDAGAMQGEMPGFPFPGRPGGEHDEPLLDMIIARRALPPDAPQEMHDL |
| Ga0187808_100743093 | 3300017942 | Freshwater Sediment | MPGFPIPGRPGGEHDEPLLDMIIARRALPPDAPQEMHDLARMLAALAGP |
| Ga0187817_104052122 | 3300017955 | Freshwater Sediment | MSDAGAMQGEMPGFPFPGRPGGEHDEPLLDMIIARRALPPDAPQE |
| Ga0187817_110222251 | 3300017955 | Freshwater Sediment | MQGEMPGFPFPGRPGGEHDEPLLDMIIARRALPPDAPQE |
| Ga0187779_107236161 | 3300017959 | Tropical Peatland | MPGFPFPGRPGGEHDEPLLDMIIARRALPPDAPQEMHDLA |
| Ga0187776_107358821 | 3300017966 | Tropical Peatland | MQGEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPE |
| Ga0187780_104693961 | 3300017973 | Tropical Peatland | MQGEMPGFPFPGRPGGEHDEPLLDMIIARRALPPDAPQEMHDLA |
| Ga0187766_103304281 | 3300018058 | Tropical Peatland | MPGFPFPGRPGGEHDEPLLDMIITRRALPPDAPLEMHDLARMLAA |
| Ga0187766_110656372 | 3300018058 | Tropical Peatland | MSVPDASHDEMPGFSTPSRPGGEHDELLLDMIFDGRVIPPD |
| Ga0193701_10807572 | 3300019875 | Soil | VSAPDAMHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEFHGLARVLA |
| Ga0193723_11950542 | 3300019879 | Soil | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEFHGL |
| Ga0210407_106241632 | 3300020579 | Soil | LSPPDAMHDEMPGFSPGRPGGEHDEPLLDMILERRPIPPG |
| Ga0210399_109595691 | 3300020581 | Soil | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGA |
| Ga0210404_101543803 | 3300021088 | Soil | MHDEMPGFFPGRPGGEHDEPLLDMILERCPIPPGAPPETHGL |
| Ga0210404_104420212 | 3300021088 | Soil | MSPPDASPSEMPGIPFPGRPGGEHDEPLLDMLFGARVLPPDAPPELHDLA |
| Ga0210405_106728213 | 3300021171 | Soil | LSPPDATHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEIHGL |
| Ga0210405_110714311 | 3300021171 | Soil | LHGEMPGFFPGRPGGERDEPLLDMIFDRRPLPPGAP |
| Ga0210396_108893491 | 3300021180 | Soil | LSPPDAMHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEIHGL |
| Ga0210396_109016041 | 3300021180 | Soil | MSPPDASPSEMPGIPFPGRPGGEHDEPLLDMLFGARVLPPDAPPELHDLARMLAAL |
| Ga0210387_112755021 | 3300021405 | Soil | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPE |
| Ga0210383_101730641 | 3300021407 | Soil | MSPPDASPSEMPGIPFPGRPGGEHDEPLLDMLFGARVLPPDAPPE |
| Ga0210383_117348342 | 3300021407 | Soil | MPGFPFPGRPGGEHDEPLLDMIIARRVLPPDAPQPMHDLASMLAALAGPA |
| Ga0182009_103571431 | 3300021445 | Soil | MPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEFHGLA |
| Ga0210390_109064631 | 3300021474 | Soil | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEIHGLAR |
| Ga0210402_104645901 | 3300021478 | Soil | LSGSSAMQDEMPGFFPGRPGGEHDEPLLDMILERRPI |
| Ga0210402_111926691 | 3300021478 | Soil | LSLPDAMHDEMPGFFPGRPGGEHDEPLLDMILERR |
| Ga0210409_113060382 | 3300021559 | Soil | MPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEI |
| Ga0222622_113759511 | 3300022756 | Groundwater Sediment | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEFHG |
| Ga0224564_11036142 | 3300024271 | Soil | MSPPDAPHGEMPGFPLPGRPGGEHDESLLDMIFDGRVIPPDAPIQMHDLERML |
| Ga0207692_110962201 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPLEFHGLARML |
| Ga0207695_108974341 | 3300025913 | Corn Rhizosphere | LSGPDAMHGEMPGFFPGRPGGEHDEPLLDMILERRPIPPGASP |
| Ga0207693_111777702 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEFHGLAR |
| Ga0207660_105002071 | 3300025917 | Corn Rhizosphere | MHGEMPGFFPGRPGGEHDEPLLDMILERRPIPPGASPEFHGLAR |
| Ga0207646_100759946 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPP |
| Ga0209073_101005613 | 3300027765 | Agricultural Soil | MSGPDAMHDEMPGFFPGRPGGEHDEPLLDMLLERRPIPPGAPP |
| Ga0209073_102955982 | 3300027765 | Agricultural Soil | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGASPEFHGLARML |
| Ga0209040_102591021 | 3300027824 | Bog Forest Soil | MSGPDAMHDEMPGFPPGRPGGERDEPLLDMLFDRRPI |
| Ga0209039_101291243 | 3300027825 | Bog Forest Soil | MSGPDAMHDEMPGFPPGRPGGERDEPLLDMLFDRRPIPP |
| Ga0209274_103625942 | 3300027853 | Soil | MPGFPFPGRPGGEHDEPLLDMIIARRALPPDAPEPM |
| Ga0209579_104851652 | 3300027869 | Surface Soil | MRPPDATPNEMPGIPFPGRPGGEHDEPLLDMIIARHVLPPDAPQPMHDLARMLAA |
| Ga0209590_108168142 | 3300027882 | Vadose Zone Soil | MHREMPGFYPGRPGGERDEPLLDMILARRPIPPGA |
| Ga0209275_108629591 | 3300027884 | Soil | MNPSDALHGEMPGFPFPGRPGGEHDEPLLDMIFDGRVIPPDAPRE |
| Ga0209415_100822905 | 3300027905 | Peatlands Soil | MSGPDAMHGEMPGFPPGRPGGERDEPLLDMIFDRRPIPPGAPSEMHDL |
| Ga0268265_118519901 | 3300028380 | Switchgrass Rhizosphere | MHGEMPGFFPGRPGGEHDEPLLDMILERRPIPPGASPEFHGLARML |
| Ga0307504_101193662 | 3300028792 | Soil | LSARDAMHDEMPGFFPGRPGGEHGEHDEPLLDMILERRPIPPGAPPE |
| Ga0307284_102834671 | 3300028799 | Soil | VSAPDAMHDEMPGFFPGRPGGEHDEPLLDMILERRPIPP |
| Ga0307284_103178362 | 3300028799 | Soil | MHDEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEFHGLARMLAAVA |
| Ga0308309_106865692 | 3300028906 | Soil | MSGPDAMQGEMPGFSFPGRLGGEHDEPLLDMIIARRAL |
| Ga0308309_116462142 | 3300028906 | Soil | MPGFPFPGRPGGEHDEPLLDMIIARRALPPDAPQPM |
| Ga0311370_112118672 | 3300030503 | Palsa | MPGFPFPGRPGGEHDEPLLDMIIARRALPPDAPEPMHDL |
| Ga0310038_101333613 | 3300030707 | Peatlands Soil | MSGPDAMHGEMPGFFPGRPGGERDEPLLDMIFDRRPLPPGAPPA |
| Ga0307482_10926801 | 3300030730 | Hardwood Forest Soil | MPGFPFPGRPGGEHDEPLLDMIIARRVLPPDAPEPMHDLARMLAAL |
| Ga0318516_101941871 | 3300031543 | Soil | MTGPGAMHGEMPGFFPGRPGGGDHDEPLLDMILDRRPLPPGAPVKDHV |
| Ga0318538_101126461 | 3300031546 | Soil | VKEPDALQGEMPGFPFPGRPGGELDEPLLDMIIARRAL |
| Ga0318555_107795411 | 3300031640 | Soil | LSRRDALHNEMPGFFPGRPGGEHDEPLLDMILERRP |
| Ga0318572_102933461 | 3300031681 | Soil | LSGPDAVQGEMPGYFPGRPGGEHDEPLLDMILERRPIPPGAPPEIYG |
| Ga0318572_109272502 | 3300031681 | Soil | MHSEMPGFFPGRPGGEHDEPLLDMILERCPIPPGAPPEIH |
| Ga0318560_102676041 | 3300031682 | Soil | MPGFPFPGRPGGELDEPLLDMIIARRALPPDAPQEMHD |
| Ga0310686_1014436652 | 3300031708 | Soil | MPGFPFPGRPGGEHDEPLLDMIIARRVLPPDAPQPMHDLASMLAA |
| Ga0318496_104603381 | 3300031713 | Soil | MPGFPFPGRPGGEHDEPLLDMIIARRVGGEGAPQEMHD |
| Ga0307476_103851011 | 3300031715 | Hardwood Forest Soil | LSGPDAMHDEMPGFFPGRPGGEHDEPLLDMILERRP |
| Ga0318494_102489031 | 3300031751 | Soil | MPGFPIPGRPGGEHDEPLLDMIITRRALPPDAPPEMHDLA |
| Ga0318554_101440511 | 3300031765 | Soil | MSGRDAMHGEMPGFIPGRPGGGDHDEPLLDMILDRRPLPPGAPPEIHVLARTLA |
| Ga0318521_105408012 | 3300031770 | Soil | MPGIPFPGRPGGEHDEPLLDMLIMWRALPPDASQEMHD |
| Ga0318546_112133961 | 3300031771 | Soil | MSAPDAMHGEMPGSFPGRPGSEHEPLLDVIFERRPLPPGAPSEI |
| Ga0318548_102193591 | 3300031793 | Soil | VKEPDALQGEMPGFPFPGRPGGELDEPLLDMIIARRALPPDAPQEMHDLA |
| Ga0318523_102044483 | 3300031798 | Soil | MHGEMPGFFPGRPGGEHDEPLLDMILERRPLPPGAPPEIHGLARML |
| Ga0318523_102766111 | 3300031798 | Soil | MPGFPFPGRPGGEHDEPLLDMIIARRALPPDAPAEMHDL |
| Ga0318568_105591871 | 3300031819 | Soil | MPGFPIPGRPGGEHDEPLLDMIITRRALPPDAPQEMHDL |
| Ga0318564_101062361 | 3300031831 | Soil | MPGIPFPGRPGGEHDEPLLDMLIMRRALPPDAPQE |
| Ga0318564_101246693 | 3300031831 | Soil | MTGPGAMHGEMPGFFPGRPGGGDHDEPLLDMILDRRPLPPGAPPEVHVLA |
| Ga0318499_103960641 | 3300031832 | Soil | MPGFPFPGRPGGEHDEPLLDMIIARRALPPDAPQEMHDLARMLAAVA |
| Ga0310917_105707782 | 3300031833 | Soil | MQSEMPGFLFPGRPGGEHDEPLLDMIIARRALPPDAPQEMHD |
| Ga0306925_111952751 | 3300031890 | Soil | MSGRDAMHGEMPGFIPGRPGGGDHDEPLLDMILDRRPLPPGAPPEIH |
| Ga0306925_120148941 | 3300031890 | Soil | MQGEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEIHGLARLFAA |
| Ga0306921_108245583 | 3300031912 | Soil | LSRRDALHNEMPGFFPGRPGGEHDEPLLDMILERRPIPP |
| Ga0310916_114574412 | 3300031942 | Soil | MHNEMPGFFPGRPGGEHDEPLLDTILERRPIPPGAPPEIHGL |
| Ga0306926_129148121 | 3300031954 | Soil | MPGFPFPGRPGGEHDEPLLDMIIGRRALPPDAPAEMH |
| Ga0306922_122058422 | 3300032001 | Soil | MTGPGAMHGEMPGFFPGRPGGGDHDEPLLDMILDRRPLPPGAPPEVHV |
| Ga0318545_101872351 | 3300032042 | Soil | MPGFPFPGRPGGEHDEPLLDMIIARRALPPDAPQE |
| Ga0318506_100367643 | 3300032052 | Soil | VKEPDALQGEMPGFPFPGRPGGELDEPLLDMIIARRALPPDAPQE |
| Ga0318506_103174501 | 3300032052 | Soil | MTGPGAMHGEMPGFFPGRPGGGDHDEPLLDMILDRRPLPPGAPP |
| Ga0306924_101698481 | 3300032076 | Soil | MHSEMPGFFPGRPGGEHDEPLLDMILERCPIPPGAPPEIHGLARMLAA |
| Ga0306924_120848902 | 3300032076 | Soil | MPGFPIPGRPGGEHDEPLLDMIITRRALPPDAPQEMHDLA |
| Ga0318525_105513712 | 3300032089 | Soil | LSRRDALHNEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPP |
| Ga0318518_101644913 | 3300032090 | Soil | MSAPDAYPGEMPGFAYPGRPGGEHDEPLLDMIFDGSAIPPGAPQEM |
| Ga0318540_104363211 | 3300032094 | Soil | MPGFPFPGRPGGELDEPLLDMIIARRALPPDAPQEM |
| Ga0311301_106503191 | 3300032160 | Peatlands Soil | MSGPDAMHGEMPGFFPGRPGGERDEPLLDMIFDRRPLPPGAPPEMHDLAR |
| Ga0311301_117081172 | 3300032160 | Peatlands Soil | MSGPDAMHGEMPGFFPGRPGGEHDEPLLDMIFDRRPLPPRAPPEMHDLAR |
| Ga0307471_1040559812 | 3300032180 | Hardwood Forest Soil | LSPSDAMHDEMPGFFPGRPGGEHDEPLLDMILERCPIPPGAPPEIHGLARM |
| Ga0306920_1020592871 | 3300032261 | Soil | MSGPDAMHGEMPGFFPGRPGGEHDEPLLDTILERR |
| Ga0306920_1040089472 | 3300032261 | Soil | MPGFPIPGRPGGEHDEPLLDMIITRRALPPDAPQEMHDLARMLAALA |
| Ga0335079_107188553 | 3300032783 | Soil | MHSEMPGFFPGRPGGEHDEPLLDMILERCPIPPGAPPEIRGLAR |
| Ga0335080_109497612 | 3300032828 | Soil | MHSEMPGFFPGRPGGEHDEPLLDMILERRPIPPGAPPEIHGLARMLA |
| Ga0335070_108703312 | 3300032829 | Soil | LSGRDALQGEMPGFFPGRPGGEHDEPLLDMILERRPLPPG |
| Ga0335074_115678792 | 3300032895 | Soil | MSGPDAMHGEMPGFIPGRPGGEHDEPLLDTIFDRRP |
| Ga0335083_101035051 | 3300032954 | Soil | MSGPDAMHDEMPGFIPGRPGGEHDEPLLDTIFDRRPLPPGAPPEMRALVRT |
| Ga0335076_103041611 | 3300032955 | Soil | MHSEMPGFFPGRPGGEHDEPLLDMILERCPIPPGAPPEIR |
| Ga0335076_117290932 | 3300032955 | Soil | MSAPDAMHGEMPGSFPGRPGGEHEPLLDVIFERRPLPPGAPPEIHD |
| Ga0318519_105453752 | 3300033290 | Soil | VKEPDALQGEMPGFPFPGRPGGELDEPLLDMIIARRALPPDAPQEM |
| ⦗Top⦘ |