


| Basic Information | |
|---|---|
| Family ID | F039833 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 163 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP |
| Number of Associated Samples | 136 |
| Number of Associated Scaffolds | 163 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.48 % |
| % of genes near scaffold ends (potentially truncated) | 95.71 % |
| % of genes from short scaffolds (< 2000 bps) | 94.48 % |
| Associated GOLD sequencing projects | 133 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.865 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.767 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.767 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.558 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 28.99% Coil/Unstructured: 71.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 163 Family Scaffolds |
|---|---|---|
| PF02798 | GST_N | 23.31 |
| PF06823 | DUF1236 | 11.04 |
| PF05175 | MTS | 11.04 |
| PF00082 | Peptidase_S8 | 3.68 |
| PF12697 | Abhydrolase_6 | 2.45 |
| PF03466 | LysR_substrate | 1.84 |
| PF02562 | PhoH | 1.23 |
| PF07581 | Glug | 1.23 |
| PF13589 | HATPase_c_3 | 0.61 |
| PF05231 | MASE1 | 0.61 |
| PF00313 | CSD | 0.61 |
| PF04226 | Transgly_assoc | 0.61 |
| PF16694 | Cytochrome_P460 | 0.61 |
| PF00149 | Metallophos | 0.61 |
| PF05598 | DUF772 | 0.61 |
| PF00872 | Transposase_mut | 0.61 |
| PF13419 | HAD_2 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 163 Family Scaffolds |
|---|---|---|---|
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 1.23 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 1.23 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.61 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.61 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.61 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.61 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.87 % |
| Unclassified | root | N/A | 6.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FHA1B5K04XYXSV | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 508 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10155833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 548 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10157396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1040613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 605 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10094705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 632 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1063957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
| 3300002074|JGI24748J21848_1014453 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300005163|Ga0066823_10074325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 658 | Open in IMG/M |
| 3300005328|Ga0070676_10304485 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300005332|Ga0066388_101184894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1304 | Open in IMG/M |
| 3300005332|Ga0066388_107143622 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300005355|Ga0070671_100326790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1307 | Open in IMG/M |
| 3300005364|Ga0070673_101042302 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300005434|Ga0070709_11302587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 586 | Open in IMG/M |
| 3300005546|Ga0070696_100571029 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300005547|Ga0070693_101675342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300005556|Ga0066707_10230877 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1202 | Open in IMG/M |
| 3300005586|Ga0066691_10670672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
| 3300005591|Ga0070761_11051114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM3983 | 518 | Open in IMG/M |
| 3300005615|Ga0070702_101699496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
| 3300005713|Ga0066905_101438413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300005713|Ga0066905_102275041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300005718|Ga0068866_10753735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 673 | Open in IMG/M |
| 3300005764|Ga0066903_103088517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 901 | Open in IMG/M |
| 3300005764|Ga0066903_105613129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300005764|Ga0066903_108946461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300005937|Ga0081455_10574363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300006031|Ga0066651_10702414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300006032|Ga0066696_10101987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1726 | Open in IMG/M |
| 3300006034|Ga0066656_10516068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
| 3300006049|Ga0075417_10486948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
| 3300006163|Ga0070715_11038271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300006800|Ga0066660_11578437 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006847|Ga0075431_100976286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 815 | Open in IMG/M |
| 3300006914|Ga0075436_100357144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1054 | Open in IMG/M |
| 3300007076|Ga0075435_101805818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. YR681 | 537 | Open in IMG/M |
| 3300009090|Ga0099827_10332283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1290 | Open in IMG/M |
| 3300009137|Ga0066709_100180484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2747 | Open in IMG/M |
| 3300009148|Ga0105243_10838563 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300009156|Ga0111538_11047707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1032 | Open in IMG/M |
| 3300009553|Ga0105249_13263653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300010046|Ga0126384_10915502 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300010047|Ga0126382_12214128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 529 | Open in IMG/M |
| 3300010321|Ga0134067_10274205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. BRP22 | 643 | Open in IMG/M |
| 3300010325|Ga0134064_10288224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300010326|Ga0134065_10215863 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
| 3300010358|Ga0126370_11090177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 735 | Open in IMG/M |
| 3300010359|Ga0126376_13219761 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300010360|Ga0126372_12639086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300010360|Ga0126372_12808832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 539 | Open in IMG/M |
| 3300010360|Ga0126372_12961448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300010361|Ga0126378_12925702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300010362|Ga0126377_11073424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 873 | Open in IMG/M |
| 3300010366|Ga0126379_11891917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
| 3300010366|Ga0126379_12166047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 657 | Open in IMG/M |
| 3300010366|Ga0126379_13171521 | Not Available | 550 | Open in IMG/M |
| 3300010366|Ga0126379_13884333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 500 | Open in IMG/M |
| 3300010376|Ga0126381_103172709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
| 3300010376|Ga0126381_105051762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300011119|Ga0105246_11490902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 635 | Open in IMG/M |
| 3300012189|Ga0137388_11802628 | Not Available | 544 | Open in IMG/M |
| 3300012202|Ga0137363_10330892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1257 | Open in IMG/M |
| 3300012212|Ga0150985_117729194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
| 3300012355|Ga0137369_10733393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
| 3300012361|Ga0137360_10494252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1041 | Open in IMG/M |
| 3300012361|Ga0137360_11047449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300012362|Ga0137361_11870969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 517 | Open in IMG/M |
| 3300012683|Ga0137398_11140242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300012927|Ga0137416_10578660 | Not Available | 976 | Open in IMG/M |
| 3300012948|Ga0126375_10733606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
| 3300012987|Ga0164307_10005288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6011 | Open in IMG/M |
| 3300013500|Ga0120195_1008086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300014325|Ga0163163_11194038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 823 | Open in IMG/M |
| 3300014325|Ga0163163_12688502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300014969|Ga0157376_11829574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 644 | Open in IMG/M |
| 3300015372|Ga0132256_100272169 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
| 3300015372|Ga0132256_103473492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300015373|Ga0132257_100691645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1266 | Open in IMG/M |
| 3300016270|Ga0182036_10669323 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300016294|Ga0182041_10707915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 893 | Open in IMG/M |
| 3300016319|Ga0182033_11404890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300016371|Ga0182034_11813467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300017997|Ga0184610_1098499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 925 | Open in IMG/M |
| 3300018468|Ga0066662_10252728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1442 | Open in IMG/M |
| 3300018476|Ga0190274_10216783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1701 | Open in IMG/M |
| 3300020579|Ga0210407_10475305 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 977 | Open in IMG/M |
| 3300021082|Ga0210380_10364782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 660 | Open in IMG/M |
| 3300021082|Ga0210380_10521277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 545 | Open in IMG/M |
| 3300021168|Ga0210406_10535716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 922 | Open in IMG/M |
| 3300021178|Ga0210408_10792681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 742 | Open in IMG/M |
| 3300021361|Ga0213872_10081657 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1452 | Open in IMG/M |
| 3300021405|Ga0210387_11852958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300021478|Ga0210402_10506604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1121 | Open in IMG/M |
| 3300024055|Ga0247794_10218443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300025919|Ga0207657_11228312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300025935|Ga0207709_11041261 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300026075|Ga0207708_11454750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300026075|Ga0207708_11799802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
| 3300026075|Ga0207708_11813376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300026304|Ga0209240_1052780 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1530 | Open in IMG/M |
| 3300026355|Ga0257149_1040131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 668 | Open in IMG/M |
| 3300027381|Ga0208983_1101534 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300027646|Ga0209466_1095003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300027862|Ga0209701_10059951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2426 | Open in IMG/M |
| 3300027875|Ga0209283_10870133 | Not Available | 548 | Open in IMG/M |
| 3300028536|Ga0137415_10484549 | Not Available | 1044 | Open in IMG/M |
| 3300028589|Ga0247818_10588768 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300028720|Ga0307317_10135462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 32-66-8 | 824 | Open in IMG/M |
| 3300028755|Ga0307316_10051464 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300028784|Ga0307282_10159134 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300028790|Ga0307283_10039902 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300028807|Ga0307305_10116637 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300028824|Ga0307310_10151761 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300028876|Ga0307286_10082926 | Not Available | 1114 | Open in IMG/M |
| 3300028878|Ga0307278_10460936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300029636|Ga0222749_10178360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1050 | Open in IMG/M |
| 3300031093|Ga0308197_10304811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 589 | Open in IMG/M |
| 3300031170|Ga0307498_10078825 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300031474|Ga0170818_110906085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1384 | Open in IMG/M |
| 3300031545|Ga0318541_10731113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 552 | Open in IMG/M |
| 3300031561|Ga0318528_10571668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 606 | Open in IMG/M |
| 3300031561|Ga0318528_10634349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300031573|Ga0310915_11018027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300031679|Ga0318561_10473423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 689 | Open in IMG/M |
| 3300031679|Ga0318561_10655922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 577 | Open in IMG/M |
| 3300031680|Ga0318574_10504953 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 708 | Open in IMG/M |
| 3300031680|Ga0318574_10529700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
| 3300031713|Ga0318496_10162754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1220 | Open in IMG/M |
| 3300031763|Ga0318537_10306591 | Not Available | 587 | Open in IMG/M |
| 3300031768|Ga0318509_10701797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
| 3300031769|Ga0318526_10094639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1188 | Open in IMG/M |
| 3300031771|Ga0318546_11308918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300031780|Ga0318508_1003669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3052 | Open in IMG/M |
| 3300031792|Ga0318529_10332381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 707 | Open in IMG/M |
| 3300031794|Ga0318503_10262546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
| 3300031796|Ga0318576_10352485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 695 | Open in IMG/M |
| 3300031796|Ga0318576_10468872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 594 | Open in IMG/M |
| 3300031797|Ga0318550_10604264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300031805|Ga0318497_10100102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1554 | Open in IMG/M |
| 3300031805|Ga0318497_10116191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → unclassified Methylocystaceae → Methylocystaceae bacterium | 1445 | Open in IMG/M |
| 3300031819|Ga0318568_10982282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300031879|Ga0306919_10357961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1115 | Open in IMG/M |
| 3300031879|Ga0306919_11466489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
| 3300031894|Ga0318522_10006969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3251 | Open in IMG/M |
| 3300031896|Ga0318551_10451182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 735 | Open in IMG/M |
| 3300031896|Ga0318551_10763711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300031896|Ga0318551_10816058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
| 3300031942|Ga0310916_10231115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1554 | Open in IMG/M |
| 3300032000|Ga0310903_10068866 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300032035|Ga0310911_10279061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 959 | Open in IMG/M |
| 3300032041|Ga0318549_10513800 | Not Available | 538 | Open in IMG/M |
| 3300032043|Ga0318556_10039749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2233 | Open in IMG/M |
| 3300032094|Ga0318540_10057233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1764 | Open in IMG/M |
| 3300032094|Ga0318540_10214518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 928 | Open in IMG/M |
| 3300032163|Ga0315281_11928729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300032174|Ga0307470_11834778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300032180|Ga0307471_100113774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2499 | Open in IMG/M |
| 3300032261|Ga0306920_103864746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300033289|Ga0310914_10230760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1659 | Open in IMG/M |
| 3300033551|Ga0247830_10614633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 861 | Open in IMG/M |
| 3300034149|Ga0364929_0079056 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.36% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.07% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.84% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.23% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.23% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.61% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.61% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.61% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.61% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013500 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_06689340 | 2070309004 | Green-Waste Compost | PLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP |
| AF_2010_repII_A1DRAFT_101558332 | 3300000597 | Forest Soil | SVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP* |
| AF_2010_repII_A1DRAFT_101573961 | 3300000597 | Forest Soil | AMQDLPAGVTRDVPPVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP* |
| AP72_2010_repI_A10DRAFT_10406132 | 3300000651 | Forest Soil | MQDLPASVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP* |
| AF_2010_repII_A001DRAFT_100947052 | 3300000793 | Forest Soil | EIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP* |
| AP72_2010_repI_A100DRAFT_10639573 | 3300000837 | Forest Soil | AGVPMQDLPAAVTRDIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP* |
| JGI24748J21848_10144531 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | DVPLVEGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP* |
| Ga0066823_100743251 | 3300005163 | Soil | VTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP* |
| Ga0070676_103044851 | 3300005328 | Miscanthus Rhizosphere | LHDLPAGVTRDVPLVEGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP* |
| Ga0066388_1011848943 | 3300005332 | Tropical Forest Soil | PLRDLPVSVIRQVPLVEGHQFVKFDDRILVVNPASRIVVAMIPRYKLLQ* |
| Ga0066388_1071436221 | 3300005332 | Tropical Forest Soil | GVTREIPLVGGHKFVKFDDRIVVVDPRNRVVVAMIPRYKLLP* |
| Ga0070671_1003267902 | 3300005355 | Switchgrass Rhizosphere | VPLHDLPAGVTRDVPLVEGHKFVKFDDRILVVDSASRVVVAMIPRYKLLP* |
| Ga0070673_1010423021 | 3300005364 | Switchgrass Rhizosphere | PLHDLPAGVTRDVPLVEGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP* |
| Ga0070709_113025871 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GVPLQDLPPGIAEEIPVVRDHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP* |
| Ga0070696_1005710291 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VPLHDLPAGVTRDVPLVEGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP* |
| Ga0070693_1016753422 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | DLPAGVTRDVPLVEGHKFVKFDDRILVVDSASRVVVAMIPRYKLLP* |
| Ga0066707_102308771 | 3300005556 | Soil | GVPMQDLPAAVTRDIPLVQGHKFVKFDDRIVVIEPASRLVVAMIPRYKLLP* |
| Ga0066691_106706721 | 3300005586 | Soil | MQDLPASLTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP* |
| Ga0070761_110511141 | 3300005591 | Soil | MQDLPAEVSQDVPLVQGHKFVKFDDRILIVHPSNRLVVAMIPRYKL |
| Ga0070702_1016994961 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | DIIREIPLIRGHKFVKFDDRILVVSSTSRLVVAMIPRYKLLP* |
| Ga0066905_1014384132 | 3300005713 | Tropical Forest Soil | VPLQDLPAGMAQEVPQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP* |
| Ga0066905_1022750411 | 3300005713 | Tropical Forest Soil | LPASVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP* |
| Ga0068866_107537352 | 3300005718 | Miscanthus Rhizosphere | DLPAGVTRDVPLVEGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP* |
| Ga0066903_1030885171 | 3300005764 | Tropical Forest Soil | TREIPLVRGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP* |
| Ga0066903_1056131292 | 3300005764 | Tropical Forest Soil | REIPLVQGHKFVKFDDRILVVNPASRLVVAMIPRYKLLP* |
| Ga0066903_1089464612 | 3300005764 | Tropical Forest Soil | PLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP* |
| Ga0081455_105743631 | 3300005937 | Tabebuia Heterophylla Rhizosphere | PLVRGHKFVKFDDRIVVVDPKSRVVVAMMPRYKLLP* |
| Ga0066651_107024141 | 3300006031 | Soil | MAQEIPQVEGHKFVKFEDRIVVVNPRSRVVAAMIPRYKPLP* |
| Ga0066696_101019873 | 3300006032 | Soil | VSRDIPLVQGHKFAKFDDRIVLVDPATRVVVAMIPRYKLLLQ* |
| Ga0066656_105160681 | 3300006034 | Soil | VQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP* |
| Ga0075417_104869481 | 3300006049 | Populus Rhizosphere | PADVPMQDLPAGLTREIPLVHGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP* |
| Ga0070715_110382712 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | DLPSGITRDIPAVRGHKFVKFDDRILVVSSEGRLVVAMIPRYKLLP* |
| Ga0066660_115784373 | 3300006800 | Soil | LPSGVPLHDLPTGMAQEIPQVEGHKFVKFEDRIVVVNPRSRVVVAMIPRYKLLP* |
| Ga0075431_1009762863 | 3300006847 | Populus Rhizosphere | PAGVTQDIPLAQGHKFVKFDDRILIVNPSSRLVVALIPRYKLVP* |
| Ga0075436_1003571441 | 3300006914 | Populus Rhizosphere | MQDLPAAVARDVPPVQGHKFAKFDDRIVVIDPASRLVVAMIPRYRLLP* |
| Ga0075435_1018058181 | 3300007076 | Populus Rhizosphere | ADDIEMQDLPLSVVRRLPQVEGYKFAKFDDRIVVVNPASRLVVAMIPRYKLMP* |
| Ga0099827_103322834 | 3300009090 | Vadose Zone Soil | VVREIPQVRGHKFVKFDDRILVVDPASRLVVAMIPRYKLMD* |
| Ga0066709_1001804842 | 3300009137 | Grasslands Soil | PQVEGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP* |
| Ga0105243_108385632 | 3300009148 | Miscanthus Rhizosphere | PAGVTRDVPLVEGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP* |
| Ga0111538_110477071 | 3300009156 | Populus Rhizosphere | PLVSGHKFVKFDDRILVISATSRLVVAMIPRYKLLQ* |
| Ga0105249_132636532 | 3300009553 | Switchgrass Rhizosphere | DVPLHDLPAGVTRDVPLVEGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP* |
| Ga0126384_109155022 | 3300010046 | Tropical Forest Soil | VTREIPLVRGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP* |
| Ga0126382_122141281 | 3300010047 | Tropical Forest Soil | EVPMQDLPASVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP* |
| Ga0134067_102742051 | 3300010321 | Grasslands Soil | GMAQEIPQVEGHKFVKFEDRIVVVDPRSRVVVAMIPRYKLLP* |
| Ga0134064_102882241 | 3300010325 | Grasslands Soil | TRDIPLVQGHKFVKFDDRIVVIEPASRLVVAMIPRYKLLP* |
| Ga0134065_102158632 | 3300010326 | Grasslands Soil | AVTRDIPLVQGHKFVKFDDRIVVIEPASRLVVAMIPRYKLLP* |
| Ga0126370_110901771 | 3300010358 | Tropical Forest Soil | DLPASVTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP* |
| Ga0126376_132197611 | 3300010359 | Tropical Forest Soil | PLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP* |
| Ga0126372_126390862 | 3300010360 | Tropical Forest Soil | PQVRGHKFVKFDDRILVIDPASRLVVAMIPRYKLMD* |
| Ga0126372_128088322 | 3300010360 | Tropical Forest Soil | TREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP* |
| Ga0126372_129614482 | 3300010360 | Tropical Forest Soil | MAQEIPQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP* |
| Ga0126378_129257022 | 3300010361 | Tropical Forest Soil | QEIPQVRGHKFVKFDDRVVVVDPKSRVVVAMIARYKLLP* |
| Ga0126377_110734242 | 3300010362 | Tropical Forest Soil | VALQDLPAGVTREIPLVDGHKFVKFDDRIVVVEPASRVVVAMIPRYRLLP* |
| Ga0126379_118919172 | 3300010366 | Tropical Forest Soil | MQDLPASVTREIPLVQGHKFVKFDDRILVVNPASRLVVAMIPRYKLLP* |
| Ga0126379_121660472 | 3300010366 | Tropical Forest Soil | RDIPPVQGHKFVKFDDRIVVVDPASRLVVAMIPRYRLLP* |
| Ga0126379_131715211 | 3300010366 | Tropical Forest Soil | LPGEVPMQDLPTSVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP* |
| Ga0126379_138843331 | 3300010366 | Tropical Forest Soil | ADALPQGVPMQDLPPGVTREIPLARGHKFVKFDDRIVVVDPLSCLVVAMIPRYKLLP* |
| Ga0126381_1031727092 | 3300010376 | Tropical Forest Soil | EIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP* |
| Ga0126381_1050517622 | 3300010376 | Tropical Forest Soil | LPASVTREIPLVRGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP* |
| Ga0105246_114909021 | 3300011119 | Miscanthus Rhizosphere | RDIPLVEGHQFAKFDDRILVVNSSSRVVVAMIPRYKLLP* |
| Ga0137388_118026282 | 3300012189 | Vadose Zone Soil | LQDLPMSVTRKLPLIKDYKFVKFDDRILVVNPASRVVVAMIPRYKLLQ* |
| Ga0137363_103308921 | 3300012202 | Vadose Zone Soil | PAGVPMQDLPAAVTRDIPLVQGHKFVKFDDRIVVIDPASRLVVAMIPRYRLLP* |
| Ga0150985_1177291941 | 3300012212 | Avena Fatua Rhizosphere | TQDLPDDIIREIPLIRGHKFVKFDDRILVVSSSRLVVAMIPRYKLLP* |
| Ga0137369_107333932 | 3300012355 | Vadose Zone Soil | SGVPLQDLPFGIAQEIPLVRDHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP* |
| Ga0137360_104942521 | 3300012361 | Vadose Zone Soil | ALPGEVPMQDLPVSVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP* |
| Ga0137360_110474492 | 3300012361 | Vadose Zone Soil | PAAVTRDIPLVQGHKFVKFDDRIVVIDPASRLVVAMIPRYKLLP* |
| Ga0137361_118709691 | 3300012362 | Vadose Zone Soil | TREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP* |
| Ga0137398_111402421 | 3300012683 | Vadose Zone Soil | TRDVPLVRGHQFAKFDDRILVVDSASRVVVAMIPRYKLLP* |
| Ga0137416_105786602 | 3300012927 | Vadose Zone Soil | ADALPSEVLLQDMPMSVTRKLPLIKDYKFVKFDDRILVVNPASRVVVAMIPRYKLLQ* |
| Ga0126375_107336062 | 3300012948 | Tropical Forest Soil | QDLPAGVTRDVPPVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP* |
| Ga0164307_100052887 | 3300012987 | Soil | PLVEGHRFAKFEDRILVVNSASRLVVAMIPRYKLLP* |
| Ga0120195_10080862 | 3300013500 | Terrestrial | MQDLPAGLAREIPLVHGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP* |
| Ga0163163_111940381 | 3300014325 | Switchgrass Rhizosphere | DIIHEIPMVRGHRFVKFDDRILVVSSTSRLVVAMIPRYKLLP* |
| Ga0163163_126885021 | 3300014325 | Switchgrass Rhizosphere | IPLARGHKFVKFDDRILVVSSTSRLVVAMIPRYKLLP* |
| Ga0157376_118295741 | 3300014969 | Miscanthus Rhizosphere | RLPQVEGYKFAKFDDRIVVVNPASRLVVAMIPRYRLMP* |
| Ga0132256_1002721691 | 3300015372 | Arabidopsis Rhizosphere | DVPLVRGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP* |
| Ga0132256_1034734922 | 3300015372 | Arabidopsis Rhizosphere | AGIVREIPRVRGHKFVKFDDRIVVVDPKSRVVVAMMPRYKLLP* |
| Ga0132257_1006916451 | 3300015373 | Arabidopsis Rhizosphere | LPAGIVREIPLVRGHKFVKFDDRIVVVDPKSRVVVALMPRYKLLP* |
| Ga0182036_106693231 | 3300016270 | Soil | DLPASVTREIPLVQGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP |
| Ga0182041_107079152 | 3300016294 | Soil | LVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP |
| Ga0182033_114048901 | 3300016319 | Soil | PLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP |
| Ga0182034_118134671 | 3300016371 | Soil | EVPQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP |
| Ga0184610_10984991 | 3300017997 | Groundwater Sediment | LPAGIVREIPLVRGHKFVKFDDRIVVVDPKSRVVVAMMPRYKLLP |
| Ga0066662_102527281 | 3300018468 | Grasslands Soil | SRGIRLVQGHKFVKFDDRIVLVDPATRLVVAMIPRYKLLQ |
| Ga0190274_102167835 | 3300018476 | Soil | NDIIREIPLVRGHKFVKFDDRILVVSSASRLVIAMIPRYKLLP |
| Ga0210407_104753051 | 3300020579 | Soil | PMQDLPAAVARDVPLVQGHKFVKFDDRIVVVDPASRLVVAMIPRYRLLP |
| Ga0210380_103647822 | 3300021082 | Groundwater Sediment | PLPEEVPMQELPTDIIDEIPLVRGHKFVKFDDRILVVSSTSRLVVAMIPRYKLLP |
| Ga0210380_105212771 | 3300021082 | Groundwater Sediment | QGEIPMQDLPVRITEDIPMVQGHKFVKFEDRILIVNPSSQLVVAMIPRYRLLP |
| Ga0210406_105357162 | 3300021168 | Soil | PAAVARDVPLVQGHKFVKFDDRIVVVDPASRLVVAMIPRYRLLP |
| Ga0210408_107926811 | 3300021178 | Soil | ANVTADIPLVRGHKFMKLEDRILLVEPASRVVVAMIPRYKLLP |
| Ga0213872_100816571 | 3300021361 | Rhizosphere | EIPLVRGHKFVKFDDRIVVVEPASRVVVAMIPRYKLLP |
| Ga0210387_118529581 | 3300021405 | Soil | AVARDVPLVQGHKFVKFDDRIVVVDPASRLVVAMIPRYRLLP |
| Ga0210402_105066042 | 3300021478 | Soil | MQDLPAAVARDVPLVQGHKFVKFDDRIVVVDPASRLVVAMIPRYRLLP |
| Ga0247794_102184432 | 3300024055 | Soil | LHDLPAGVTRDVPLVEGHKFVKFDDRILVVDSASRVVVAMIPRYKLLP |
| Ga0207657_112283122 | 3300025919 | Corn Rhizosphere | TRDVPLVEGHKFVKFDDRILVVDSASRVVVAMIPRYKLLP |
| Ga0207709_110412611 | 3300025935 | Miscanthus Rhizosphere | DLPAGVTRDVPLVEGHQFAKFDDRILVVNAESRVVVAMIPRYKLLP |
| Ga0207708_114547501 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | SAVPLQDLPAGIAREIPPVQGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP |
| Ga0207708_117998023 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | NDIIREIPPVRGHKFVKFDDRILVVSSASRLVIAMIPRYKLLP |
| Ga0207708_118133762 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | IIHEIPLVRGHKFVKFDDRILVVSSASRLVVAMIPRYKLLP |
| Ga0209240_10527801 | 3300026304 | Grasslands Soil | GVPLQDLPASLTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP |
| Ga0257149_10401312 | 3300026355 | Soil | VPLQDLPASLTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP |
| Ga0208983_11015341 | 3300027381 | Forest Soil | DVPLHDLPAGVTRDVPLVRGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP |
| Ga0209466_10950032 | 3300027646 | Tropical Forest Soil | TSVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP |
| Ga0209701_100599511 | 3300027862 | Vadose Zone Soil | VAMQDLPAGVVREIPQVRGHKFVKFDDRILVVDPASRLVVAMIPRYKLMD |
| Ga0209283_108701332 | 3300027875 | Vadose Zone Soil | GVVREIPQVRGHKFVKFDDRILVVDPASRLVVAMIPRYKLMD |
| Ga0137415_104845491 | 3300028536 | Vadose Zone Soil | ADALPSEVLLQDMPMSVTRKLPLIKDYKFVKFDDRILVVNPASRVVVAMIPRYKLLQ |
| Ga0247818_105887682 | 3300028589 | Soil | SRVTLVEGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP |
| Ga0307317_101354621 | 3300028720 | Soil | HEIPLVRGHKFVKFDDRILVVSSTSRLVVAMIPRYKLLP |
| Ga0307316_100514643 | 3300028755 | Soil | TRDVPLVEGHQFAKFDDRILVVNSTSRVVVAMIPRYKLLP |
| Ga0307282_101591341 | 3300028784 | Soil | VPLVRGHQFAKFDDRILVVNSASRVVVAMIPRYKILP |
| Ga0307283_100399021 | 3300028790 | Soil | PAGVTRDVPLVEGHKFAKFDDRILVVNSTSRVVVAMIPRYKLLP |
| Ga0307305_101166371 | 3300028807 | Soil | VPLHDLPAGVTRDVPLVRGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP |
| Ga0307310_101517613 | 3300028824 | Soil | TRDVPLVRGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP |
| Ga0307286_100829261 | 3300028876 | Soil | PTDIIHEIPLVRGHKFVKFDDRILVVSSTSRLVVAMIPRYKLLP |
| Ga0307278_104609362 | 3300028878 | Soil | VPMQDLPAGLAREIPLMHGHKFVKFDDRIVAVNPASRLVVAMIPRYKLLP |
| Ga0222749_101783602 | 3300029636 | Soil | ASVTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP |
| Ga0308197_103048111 | 3300031093 | Soil | REIPLVRGHKFVKFDDRILVVSSASRLVVAMIPRYKLLP |
| Ga0307498_100788253 | 3300031170 | Soil | VTRDVPLVRGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP |
| Ga0170818_1109060851 | 3300031474 | Forest Soil | LIRGHKFVKFDDRILVVSSTSRLVVAMIPRYKLLP |
| Ga0318541_107311131 | 3300031545 | Soil | DLPATVTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP |
| Ga0318528_105716682 | 3300031561 | Soil | MQDLPATVTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP |
| Ga0318528_106343491 | 3300031561 | Soil | VTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP |
| Ga0310915_110180272 | 3300031573 | Soil | EIPQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP |
| Ga0318561_104734232 | 3300031679 | Soil | SGVAMQDLPATVTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP |
| Ga0318561_106559221 | 3300031679 | Soil | LQDLPAGMAQEVPQVLGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP |
| Ga0318574_105049531 | 3300031680 | Soil | SVTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP |
| Ga0318574_105297002 | 3300031680 | Soil | TREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP |
| Ga0318496_101627541 | 3300031713 | Soil | GVAMQDLPASVTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP |
| Ga0318537_103065912 | 3300031763 | Soil | DLPASVTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP |
| Ga0318509_107017972 | 3300031768 | Soil | MQDLPASVTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP |
| Ga0318526_100946391 | 3300031769 | Soil | LPASVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP |
| Ga0318546_113089181 | 3300031771 | Soil | VPLHDLPAGIVQAIPLVQGHKFVKFDDQIVVVDPKSRVVVAMIPRYKLLP |
| Ga0318508_10036692 | 3300031780 | Soil | GMAQEVPQVLGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP |
| Ga0318529_103323812 | 3300031792 | Soil | VPMQDLPASVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP |
| Ga0318503_102625461 | 3300031794 | Soil | VAMQDLPAGVTRDVPPVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP |
| Ga0318576_103524851 | 3300031796 | Soil | MQDLPASVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP |
| Ga0318576_104688721 | 3300031796 | Soil | AMQDLPATVTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP |
| Ga0318550_106042642 | 3300031797 | Soil | AQEIPQVEGHTFVKFDDRIVVVDPKSRVVVAMIPRYKLLP |
| Ga0318497_101001021 | 3300031805 | Soil | AEVAMQDLPAGVTRDVPPVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP |
| Ga0318497_101161912 | 3300031805 | Soil | SSEVPMQDLPASVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP |
| Ga0318568_109822822 | 3300031819 | Soil | GMAQEVPQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP |
| Ga0306919_103579612 | 3300031879 | Soil | EIPQVEGHTFVKFDDRIVVVDPKSRVVVAMIPRYKLLP |
| Ga0306919_114664892 | 3300031879 | Soil | AQEVPQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP |
| Ga0318522_100069691 | 3300031894 | Soil | SGVAMQDLPASVTREIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP |
| Ga0318551_104511821 | 3300031896 | Soil | TRDVPPVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP |
| Ga0318551_107637111 | 3300031896 | Soil | AGMAQEVPQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP |
| Ga0318551_108160581 | 3300031896 | Soil | EIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP |
| Ga0310916_102311151 | 3300031942 | Soil | DVPPVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP |
| Ga0310910_104012553 | 3300031946 | Soil | IPLLRGHKFMKLEDRILLVEPATRAVVAMFPRYKLLP |
| Ga0310903_100688661 | 3300032000 | Soil | VTRDVPLVEGHQFAKFDDRILVVNAASRVVVAMIPRYKLLP |
| Ga0310911_102790612 | 3300032035 | Soil | PQVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP |
| Ga0318549_105138002 | 3300032041 | Soil | AMQDLPASVTREIPLVRGHKFVKFDDRIVVVDPASRVVVAMIPRYKLLP |
| Ga0318549_105582931 | 3300032041 | Soil | LLSAYKFMKLEDRILLIEPAARVVVAMIPRYKLLP |
| Ga0318556_100397493 | 3300032043 | Soil | RVTLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP |
| Ga0318540_100572331 | 3300032094 | Soil | EIPLVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP |
| Ga0318540_102145182 | 3300032094 | Soil | VTRDVPPVRGHKFVKFDDRIVVVDPASRLVVAMIPRYKLLP |
| Ga0315281_119287291 | 3300032163 | Sediment | IREVPLVNDHKFVKFDDRILVVDPASRLVVAMIPRYKLLP |
| Ga0307470_118347781 | 3300032174 | Hardwood Forest Soil | VPLQDLPAGIVREIPLVRGHKFVKFDDRIVVVDPKSRVVVAMMPRYKLLP |
| Ga0307471_1001137741 | 3300032180 | Hardwood Forest Soil | TRDIPLVQGHKFVKFDDRIVVVDPASRLIVAMIPRYKLLP |
| Ga0306920_1038647462 | 3300032261 | Soil | QVRGHKFVKFDDRIVVVDPKSRVVVAMIPRYKLLP |
| Ga0310914_102307603 | 3300033289 | Soil | DLPASVTREIPLVQGHKFVKFDDRIVVVNPASRLVVAMIPRYKLLP |
| Ga0247830_106146331 | 3300033551 | Soil | REVPLHDLPAGVTRDVPLVEGHKFVKFDDRILVVDSASRVVVAMIPRYKLLP |
| Ga0364929_0079056_886_1020 | 3300034149 | Sediment | PAGVTRDVPLVRGHQFAKFDDRILVVNSASRVVVAMIPRYKLLP |
| ⦗Top⦘ |