


| Basic Information | |
|---|---|
| Family ID | F039802 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 163 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MWIIWYVAMMASLRAMGLAPSPVPVRTDEDRTPYGDI |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 163 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.23 % |
| % of genes near scaffold ends (potentially truncated) | 26.99 % |
| % of genes from short scaffolds (< 2000 bps) | 87.12 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.828 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (16.564 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.423 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (69.939 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 26.15% β-sheet: 0.00% Coil/Unstructured: 73.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 163 Family Scaffolds |
|---|---|---|
| PF02481 | DNA_processg_A | 36.81 |
| PF01751 | Toprim | 26.38 |
| PF13368 | Toprim_C_rpt | 1.84 |
| PF02660 | G3P_acyltransf | 0.61 |
| PF02548 | Pantoate_transf | 0.61 |
| PF13577 | SnoaL_4 | 0.61 |
| PF00571 | CBS | 0.61 |
| PF01510 | Amidase_2 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 163 Family Scaffolds |
|---|---|---|---|
| COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 73.62 |
| COG0344 | Phospholipid biosynthesis protein PlsY, probable glycerol-3-phosphate acyltransferase | Lipid transport and metabolism [I] | 0.61 |
| COG0413 | Ketopantoate hydroxymethyltransferase | Coenzyme transport and metabolism [H] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.83 % |
| Unclassified | root | N/A | 44.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02F96T1 | Not Available | 502 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig824991 | Not Available | 806 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig99619 | Not Available | 628 | Open in IMG/M |
| 2170459003|FZN2CUW02H59IV | Not Available | 511 | Open in IMG/M |
| 3300000550|F24TB_10179078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1211 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10030927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1445 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10032318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1409 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10178303 | Not Available | 503 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1024538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1128 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1044869 | Not Available | 796 | Open in IMG/M |
| 3300001867|JGI12627J18819_10053125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1690 | Open in IMG/M |
| 3300002908|JGI25382J43887_10193813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 984 | Open in IMG/M |
| 3300004629|Ga0008092_11222635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 725 | Open in IMG/M |
| 3300005181|Ga0066678_10031072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2907 | Open in IMG/M |
| 3300005332|Ga0066388_103557401 | Not Available | 795 | Open in IMG/M |
| 3300005363|Ga0008090_10044908 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1369 | Open in IMG/M |
| 3300005363|Ga0008090_15873323 | Not Available | 932 | Open in IMG/M |
| 3300005540|Ga0066697_10453253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 737 | Open in IMG/M |
| 3300005552|Ga0066701_10023136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3124 | Open in IMG/M |
| 3300005554|Ga0066661_10053496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2317 | Open in IMG/M |
| 3300005555|Ga0066692_10434780 | Not Available | 835 | Open in IMG/M |
| 3300005556|Ga0066707_10032012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2920 | Open in IMG/M |
| 3300005559|Ga0066700_10235922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1274 | Open in IMG/M |
| 3300005575|Ga0066702_10422082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 816 | Open in IMG/M |
| 3300005576|Ga0066708_10497973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 785 | Open in IMG/M |
| 3300005587|Ga0066654_10149168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1185 | Open in IMG/M |
| 3300005713|Ga0066905_100009669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4488 | Open in IMG/M |
| 3300005713|Ga0066905_100276587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1305 | Open in IMG/M |
| 3300005713|Ga0066905_100280249 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300005713|Ga0066905_100293312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1273 | Open in IMG/M |
| 3300005713|Ga0066905_100796415 | Not Available | 819 | Open in IMG/M |
| 3300005713|Ga0066905_100844259 | Not Available | 797 | Open in IMG/M |
| 3300005713|Ga0066905_102018148 | Not Available | 535 | Open in IMG/M |
| 3300005713|Ga0066905_102042757 | Not Available | 532 | Open in IMG/M |
| 3300005764|Ga0066903_102088168 | Not Available | 1090 | Open in IMG/M |
| 3300005764|Ga0066903_103259601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum | 877 | Open in IMG/M |
| 3300005764|Ga0066903_103641461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 829 | Open in IMG/M |
| 3300005764|Ga0066903_104331564 | Not Available | 758 | Open in IMG/M |
| 3300005764|Ga0066903_104514685 | Not Available | 742 | Open in IMG/M |
| 3300005764|Ga0066903_105915655 | Not Available | 641 | Open in IMG/M |
| 3300005937|Ga0081455_10015330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 7452 | Open in IMG/M |
| 3300005983|Ga0081540_1006286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes globisporus | 8693 | Open in IMG/M |
| 3300006028|Ga0070717_10097069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum | 2496 | Open in IMG/M |
| 3300006028|Ga0070717_10302502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1422 | Open in IMG/M |
| 3300006028|Ga0070717_11687027 | Not Available | 573 | Open in IMG/M |
| 3300006034|Ga0066656_11142185 | Not Available | 501 | Open in IMG/M |
| 3300006046|Ga0066652_100539657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1090 | Open in IMG/M |
| 3300006058|Ga0075432_10147073 | Not Available | 903 | Open in IMG/M |
| 3300006172|Ga0075018_10481269 | Not Available | 644 | Open in IMG/M |
| 3300006173|Ga0070716_100818100 | Not Available | 723 | Open in IMG/M |
| 3300006173|Ga0070716_101257351 | Not Available | 597 | Open in IMG/M |
| 3300006791|Ga0066653_10195873 | Not Available | 1021 | Open in IMG/M |
| 3300006796|Ga0066665_10598383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 887 | Open in IMG/M |
| 3300006796|Ga0066665_11562499 | Not Available | 518 | Open in IMG/M |
| 3300006797|Ga0066659_10214835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1417 | Open in IMG/M |
| 3300006804|Ga0079221_10896573 | Not Available | 650 | Open in IMG/M |
| 3300006844|Ga0075428_100119637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2867 | Open in IMG/M |
| 3300006854|Ga0075425_100054752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum | 4468 | Open in IMG/M |
| 3300006854|Ga0075425_102728100 | Not Available | 544 | Open in IMG/M |
| 3300006854|Ga0075425_103004907 | Not Available | 516 | Open in IMG/M |
| 3300006914|Ga0075436_100390084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum | 1008 | Open in IMG/M |
| 3300006939|Ga0081244_1504355 | Not Available | 675 | Open in IMG/M |
| 3300007076|Ga0075435_100440980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1122 | Open in IMG/M |
| 3300007255|Ga0099791_10057027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1754 | Open in IMG/M |
| 3300009147|Ga0114129_10820287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum | 1185 | Open in IMG/M |
| 3300009162|Ga0075423_10340428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1572 | Open in IMG/M |
| 3300009792|Ga0126374_10702575 | Not Available | 760 | Open in IMG/M |
| 3300009792|Ga0126374_10725185 | Not Available | 750 | Open in IMG/M |
| 3300010046|Ga0126384_10212154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 1540 | Open in IMG/M |
| 3300010046|Ga0126384_10451429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1098 | Open in IMG/M |
| 3300010046|Ga0126384_10999481 | Not Available | 761 | Open in IMG/M |
| 3300010046|Ga0126384_11167387 | Not Available | 709 | Open in IMG/M |
| 3300010047|Ga0126382_10013360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4033 | Open in IMG/M |
| 3300010159|Ga0099796_10340075 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300010322|Ga0134084_10014686 | Not Available | 2031 | Open in IMG/M |
| 3300010323|Ga0134086_10307581 | Not Available | 617 | Open in IMG/M |
| 3300010358|Ga0126370_11314550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 678 | Open in IMG/M |
| 3300010359|Ga0126376_10302517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1391 | Open in IMG/M |
| 3300010359|Ga0126376_12851183 | Not Available | 533 | Open in IMG/M |
| 3300010360|Ga0126372_10296305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum | 1419 | Open in IMG/M |
| 3300010360|Ga0126372_10561776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1086 | Open in IMG/M |
| 3300010360|Ga0126372_11877138 | Not Available | 644 | Open in IMG/M |
| 3300010361|Ga0126378_10937917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum | 971 | Open in IMG/M |
| 3300010361|Ga0126378_11591253 | Not Available | 742 | Open in IMG/M |
| 3300010366|Ga0126379_10495526 | Not Available | 1292 | Open in IMG/M |
| 3300010366|Ga0126379_11953917 | Not Available | 689 | Open in IMG/M |
| 3300010366|Ga0126379_12982688 | Not Available | 566 | Open in IMG/M |
| 3300010376|Ga0126381_100487035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1737 | Open in IMG/M |
| 3300010398|Ga0126383_11059476 | Not Available | 900 | Open in IMG/M |
| 3300010863|Ga0124850_1120876 | Not Available | 675 | Open in IMG/M |
| 3300010863|Ga0124850_1134632 | Not Available | 598 | Open in IMG/M |
| 3300011106|Ga0151489_1714148 | Not Available | 586 | Open in IMG/M |
| 3300012022|Ga0120191_10017978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 974 | Open in IMG/M |
| 3300012198|Ga0137364_10208884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1433 | Open in IMG/M |
| 3300012199|Ga0137383_10118601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1928 | Open in IMG/M |
| 3300012199|Ga0137383_10301435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1173 | Open in IMG/M |
| 3300012208|Ga0137376_10189577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum | 1777 | Open in IMG/M |
| 3300012354|Ga0137366_10212911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1440 | Open in IMG/M |
| 3300012355|Ga0137369_10298792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1195 | Open in IMG/M |
| 3300012362|Ga0137361_11324446 | Not Available | 644 | Open in IMG/M |
| 3300012948|Ga0126375_11213470 | Not Available | 628 | Open in IMG/M |
| 3300012951|Ga0164300_10525722 | Not Available | 682 | Open in IMG/M |
| 3300012986|Ga0164304_10505966 | Not Available | 883 | Open in IMG/M |
| 3300015373|Ga0132257_103905313 | Not Available | 542 | Open in IMG/M |
| 3300015374|Ga0132255_100141878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3337 | Open in IMG/M |
| 3300016341|Ga0182035_10229225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum | 1487 | Open in IMG/M |
| 3300016371|Ga0182034_10550369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 968 | Open in IMG/M |
| 3300018431|Ga0066655_10069435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1883 | Open in IMG/M |
| 3300018433|Ga0066667_10435746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1067 | Open in IMG/M |
| 3300018468|Ga0066662_11464637 | Not Available | 709 | Open in IMG/M |
| 3300018468|Ga0066662_11900244 | Not Available | 623 | Open in IMG/M |
| 3300020579|Ga0210407_11226058 | Not Available | 563 | Open in IMG/M |
| 3300020581|Ga0210399_10380408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum | 1178 | Open in IMG/M |
| 3300020581|Ga0210399_10492518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1019 | Open in IMG/M |
| 3300021168|Ga0210406_11289727 | Not Available | 527 | Open in IMG/M |
| 3300021178|Ga0210408_10300730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1279 | Open in IMG/M |
| 3300021439|Ga0213879_10005293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2530 | Open in IMG/M |
| 3300021560|Ga0126371_10642943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1209 | Open in IMG/M |
| 3300021560|Ga0126371_11474643 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300021560|Ga0126371_12068556 | Not Available | 686 | Open in IMG/M |
| 3300021560|Ga0126371_12202533 | Not Available | 665 | Open in IMG/M |
| 3300021560|Ga0126371_12485643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
| 3300021560|Ga0126371_12889780 | Not Available | 582 | Open in IMG/M |
| 3300024288|Ga0179589_10423380 | Not Available | 612 | Open in IMG/M |
| 3300025898|Ga0207692_11036529 | Not Available | 542 | Open in IMG/M |
| 3300025939|Ga0207665_11368155 | Not Available | 564 | Open in IMG/M |
| 3300026304|Ga0209240_1004662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5178 | Open in IMG/M |
| 3300026310|Ga0209239_1015943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3844 | Open in IMG/M |
| 3300026310|Ga0209239_1050656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1874 | Open in IMG/M |
| 3300026327|Ga0209266_1175637 | Not Available | 821 | Open in IMG/M |
| 3300026528|Ga0209378_1109478 | Not Available | 1206 | Open in IMG/M |
| 3300026538|Ga0209056_10166027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1664 | Open in IMG/M |
| 3300026550|Ga0209474_10022916 | Not Available | 4795 | Open in IMG/M |
| 3300027548|Ga0209523_1040291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 949 | Open in IMG/M |
| 3300027646|Ga0209466_1001783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4370 | Open in IMG/M |
| 3300027874|Ga0209465_10121350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1289 | Open in IMG/M |
| 3300027874|Ga0209465_10436049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300027903|Ga0209488_10843577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
| 3300028718|Ga0307307_10040171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1351 | Open in IMG/M |
| 3300028881|Ga0307277_10000014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 56671 | Open in IMG/M |
| 3300031543|Ga0318516_10060441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2083 | Open in IMG/M |
| 3300031543|Ga0318516_10180840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1215 | Open in IMG/M |
| 3300031543|Ga0318516_10424198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 765 | Open in IMG/M |
| 3300031544|Ga0318534_10106447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1607 | Open in IMG/M |
| 3300031545|Ga0318541_10138966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum | 1327 | Open in IMG/M |
| 3300031545|Ga0318541_10209141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum | 1080 | Open in IMG/M |
| 3300031545|Ga0318541_10511981 | Not Available | 671 | Open in IMG/M |
| 3300031573|Ga0310915_10029376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3418 | Open in IMG/M |
| 3300031573|Ga0310915_10107094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1895 | Open in IMG/M |
| 3300031724|Ga0318500_10333897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 746 | Open in IMG/M |
| 3300031744|Ga0306918_10311138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1215 | Open in IMG/M |
| 3300031744|Ga0306918_10707078 | Not Available | 788 | Open in IMG/M |
| 3300031770|Ga0318521_10471988 | Not Available | 752 | Open in IMG/M |
| 3300031794|Ga0318503_10118548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 846 | Open in IMG/M |
| 3300031846|Ga0318512_10281621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 824 | Open in IMG/M |
| 3300031893|Ga0318536_10188090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1051 | Open in IMG/M |
| 3300031912|Ga0306921_12453015 | Not Available | 542 | Open in IMG/M |
| 3300031941|Ga0310912_11248682 | Not Available | 564 | Open in IMG/M |
| 3300031954|Ga0306926_12451374 | Not Available | 573 | Open in IMG/M |
| 3300032001|Ga0306922_11011249 | Not Available | 857 | Open in IMG/M |
| 3300032001|Ga0306922_11233792 | Not Available | 759 | Open in IMG/M |
| 3300032054|Ga0318570_10062174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium aquaticum | 1573 | Open in IMG/M |
| 3300032076|Ga0306924_11703897 | Not Available | 660 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 16.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 12.27% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.52% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.52% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.45% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 2.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.23% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.23% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.23% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.61% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.61% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006939 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_00371430 | 2065487018 | Soil | MWIVMYIAMMASLRAMGLAPGFVPVRTDEDRPPFGEI |
| KansclcFeb2_16490030 | 2124908045 | Soil | MWIIWYIGMMASLRAMGLAPGVVPVRIDEDRKPYGDF |
| KansclcFeb2_09812290 | 2124908045 | Soil | MWIIWYIGMMASLRAMGFAPNLVPIRTDEDRTPFDGV |
| E4A_10276500 | 2170459003 | Grass Soil | AMWIIMYVVMMASLRAMGVAPSVVPVRTDEDPRPPFGEI |
| F24TB_101790782 | 3300000550 | Soil | MWIIWYIGMMASLRAMGLAPNLLPIRTDEDRTPFGDV* |
| AF_2010_repII_A1DRAFT_100309272 | 3300000597 | Forest Soil | MWIIWYVAMMASLRAVGLAPNPVPVRIXEDRKPYGDF* |
| AF_2010_repII_A1DRAFT_100323182 | 3300000597 | Forest Soil | MWIIWYIGMMASLRAMGLAPSLVPIKIDEDRKPFGDM* |
| AF_2010_repII_A1DRAFT_101783031 | 3300000597 | Forest Soil | MWIIWYVAMMASLRAMGLAPSPVLVRTDVDRKPYGDF* |
| AF_2010_repII_A100DRAFT_10245383 | 3300000655 | Forest Soil | MWIIWYVAMVASLRAMGLAPSPVPVRTDEDRTPFTDI* |
| AF_2010_repII_A100DRAFT_10448692 | 3300000655 | Forest Soil | MWIIWYIGLMASLRAMGLAPSLVPIKIDEDRKPFGDM* |
| JGI12627J18819_100531253 | 3300001867 | Forest Soil | MWIIWYIGMMASLRAMGLAPGVVPVRTDEDRKPYGDF* |
| JGI25382J43887_101938131 | 3300002908 | Grasslands Soil | DWAMWIIWYVAMVASLRAMGLAPSVVPVRTDEDRTPFGDI* |
| Ga0008092_112226351 | 3300004629 | Tropical Rainforest Soil | GDWAMWIIWYVAMVASLRATGLAPSPVPVRTDEDRTPFTDI* |
| Ga0066678_100310722 | 3300005181 | Soil | LIRGDWAMWIIWYIGMMASLRAMGLAPGVVPVRIDEDRKPYGDF* |
| Ga0066388_1035574011 | 3300005332 | Tropical Forest Soil | VGDGAMWIIWYIGLMASLRAMGLAPSLVPIKIDEDRKPFGDM* |
| Ga0008090_100449082 | 3300005363 | Tropical Rainforest Soil | VGFVGDGAMWIIWYIGLMASLRAMGLAPSLVPIKIDEDRKPFGDM* |
| Ga0008090_158733231 | 3300005363 | Tropical Rainforest Soil | LGYVDIWYVAMMASLRAMGLAPSPVLVRTDVDRKPYGDF* |
| Ga0066697_104532532 | 3300005540 | Soil | GSRAMWIIMYIAMVASLRAMGLAPSMVPVRTDEDRPPFGEI* |
| Ga0066701_100231362 | 3300005552 | Soil | MWIIMYIAVMASLRAMGLAPDLVQVRTDDDHRPPYGDI* |
| Ga0066661_100534962 | 3300005554 | Soil | MWIIWYIGMMASLRAMGLAPGVVPVRIDEDRKPYGDF* |
| Ga0066692_104347801 | 3300005555 | Soil | MWIIWYVAMVASLRAMGLAPSVVPVRTDEDRTPFGDI* |
| Ga0066707_100320124 | 3300005556 | Soil | MWIIWYIGMMASLRTMGLAPGVVPVRIDEDRKPYGDF* |
| Ga0066700_102359221 | 3300005559 | Soil | MWIIMYIAVMASLQAMGLEPSLVPVKTDDDDRPPCGDI* |
| Ga0066702_104220822 | 3300005575 | Soil | MWIIMYIAMVASLRAMGLAPSMVPVRTDEDRPPFGEI* |
| Ga0066708_104979733 | 3300005576 | Soil | IMYIAVMASLRAMGLAPDLVQVRTDDDHRPPYGDI* |
| Ga0066654_101491681 | 3300005587 | Soil | AMWIIMYIAVMASLRAMGLAPDLVQVRTDDDHRPPYGDI* |
| Ga0066905_1000096695 | 3300005713 | Tropical Forest Soil | MWIIMYIAMVASMRAMGLAPSLVPVRTDEDRPPFGEM* |
| Ga0066905_1002765872 | 3300005713 | Tropical Forest Soil | MWIIMYVAVMASLRAMGLAPSFVPIRNDDDRRPPFGEI* |
| Ga0066905_1002802493 | 3300005713 | Tropical Forest Soil | MWIVFYVAMMGSLRAMGLAPNLMQVETDEDLDSEI* |
| Ga0066905_1002933122 | 3300005713 | Tropical Forest Soil | MWIIWYIGMMASLRAMGLAPGVVPVRINEDRKPYGDF* |
| Ga0066905_1007964153 | 3300005713 | Tropical Forest Soil | MWIIWYVAMVASLRALGLAPSPVPVRTDEDRKPYGDF* |
| Ga0066905_1008442591 | 3300005713 | Tropical Forest Soil | MWIIWYVAMMASLRAMGLAPIAVPVRTDDERTPFSDI* |
| Ga0066905_1020181481 | 3300005713 | Tropical Forest Soil | MWIIWYVAMVASLRAIGLAPSPVPVRTDEDRKPYGDF* |
| Ga0066905_1020427571 | 3300005713 | Tropical Forest Soil | MWIIWYVAMVASLRAMGLAPSPVPVRTDEDRKPYGDF* |
| Ga0066903_1020881682 | 3300005764 | Tropical Forest Soil | MWIIWYVAMVASLRAMGLAPSPVPVRTDEDRKPYGEF* |
| Ga0066903_1032596012 | 3300005764 | Tropical Forest Soil | MWIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYG |
| Ga0066903_1036414613 | 3300005764 | Tropical Forest Soil | GDWAMWIIWYVAMMASLRAMGLAPSPVLVRTDVDRKPYGDF* |
| Ga0066903_1043315642 | 3300005764 | Tropical Forest Soil | MWIIWYVAMVASLRALGLAPSVVPVRIDEDRTPYGDV* |
| Ga0066903_1045146851 | 3300005764 | Tropical Forest Soil | MWIIWYVAMMASLRAMGLAPIAVPVRTDEERTPFCDI* |
| Ga0066903_1059156552 | 3300005764 | Tropical Forest Soil | FRLGEWAMWIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF* |
| Ga0081455_100153302 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MWIIWYIGMMASLRAMGLAPSLVPIRTDEDRKPFGDM* |
| Ga0081540_10062863 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MWIIMYIAMVASLRAMGLAPSMVPVRTDEDRPPFGEM* |
| Ga0070717_100970693 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MWIVMYIAMMASLRAMGLAPGFVPVRTDEDRPPFGEI* |
| Ga0070717_103025021 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MWIIMYVAMIASLRAMGLAPSSVPVRTDDDHRPPFGEI* |
| Ga0070717_116870271 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AMWIIWYIGMMASLRAMGLAPGVVPVRIDEDRKPYGDF* |
| Ga0066656_111421851 | 3300006034 | Soil | MWIIWYIGMLASLRAMGLAHGVVPVRIDEDRKPYGDF* |
| Ga0066652_1005396572 | 3300006046 | Soil | MWIIWYIGMMASLRAMGFAPNLLPIRTDEDRKPFGDM* |
| Ga0075432_101470732 | 3300006058 | Populus Rhizosphere | MWIVMYIAMMASLRAMGLAPSFVSVRTDEDRPPFGEI* |
| Ga0075018_104812692 | 3300006172 | Watersheds | MWIIWYIGMMASLRAMGLAPGVVPVRIDEDHTPYGDV* |
| Ga0070716_1008181002 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GRGSRAMWIVMYIAMMASLRAMGLAPSFVSVRTDEDRPPFGEI* |
| Ga0070716_1012573511 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AMWIVMYIAMMASLRAMGLAPNLVTVRTDEDRPPFGEI* |
| Ga0066653_101958731 | 3300006791 | Soil | MWIIMYIAVMASLRAMGLAPDLVQVWTDDDHRPPYGDI* |
| Ga0066665_105983832 | 3300006796 | Soil | MWIIWYVAMMASLRAMGLAPSVVPVRTDEDRTPFSDI* |
| Ga0066665_115624991 | 3300006796 | Soil | MWIIMYIAVMASLQAMGLEPGLVPIRTDDDDRPPCGDI* |
| Ga0066659_102148352 | 3300006797 | Soil | MWIIMYIAVMASLQAMGLEPSLVPIRTDDDDRPPCGDI* |
| Ga0079221_108965731 | 3300006804 | Agricultural Soil | MWIIWYVAMMASPSAMGLAPSVVPVRTDEDRTPFSDT* |
| Ga0075428_1001196372 | 3300006844 | Populus Rhizosphere | MWIIWYIGMMASLRAMGLAPSLVPIRTDEDRKPYGDM* |
| Ga0075425_1000547522 | 3300006854 | Populus Rhizosphere | MWIIMYIAMVASLRAMGLSPSMVPVRTDEDRPPFGDI* |
| Ga0075425_1027281002 | 3300006854 | Populus Rhizosphere | WAMWIIWYIGMMASLRAMGLAPGVVPVRIDEDRKPYGDF* |
| Ga0075425_1030049071 | 3300006854 | Populus Rhizosphere | MWIIMYIAMVASLRAMGLSPSMVPVRTDEDRPPFG |
| Ga0075436_1003900842 | 3300006914 | Populus Rhizosphere | MWIIWYIGMMASLRAMGLAPSPVLMRTDEDRKPYGDF* |
| Ga0081244_15043552 | 3300006939 | Tropical Rainforest Soil | MWIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF* |
| Ga0075435_1004409802 | 3300007076 | Populus Rhizosphere | MWIIWYVAMMASLRAMGLAPSPVLMRTDEDRKPYGDF* |
| Ga0099791_100570272 | 3300007255 | Vadose Zone Soil | MWIIWYIGMMASLRAMGLAPDVVPVRIDEDHTPYGDV* |
| Ga0114129_108202871 | 3300009147 | Populus Rhizosphere | MWIIWYIGMMASLRAMGLAPSPVLMRTDEDRKPYGGF* |
| Ga0075423_103404281 | 3300009162 | Populus Rhizosphere | MWIVMYIAMMASLRAMGLAPSFVPVRTDEDRPPFGEI* |
| Ga0126374_107025751 | 3300009792 | Tropical Forest Soil | MWIIWYIGMMASLRAMGLAPSPVPVRIDEDRKPYGDF* |
| Ga0126374_107251851 | 3300009792 | Tropical Forest Soil | MWIIIYIAMVASMRAMGLAPSLVSVRTDEDRPPFGDI* |
| Ga0126384_102121542 | 3300010046 | Tropical Forest Soil | MWIIWYVAMMASLRAMGLAPSPVPVRTDEDRTPYGDI* |
| Ga0126384_104514292 | 3300010046 | Tropical Forest Soil | MWIIWYVAMMASLRAMGLAPIAVPVRTDEDRTPFSDI* |
| Ga0126384_109994811 | 3300010046 | Tropical Forest Soil | MWIIWYVAMVASLRAMGLAPDPVPVRIDEDRTPYGDI* |
| Ga0126384_111673871 | 3300010046 | Tropical Forest Soil | MWIIWYIGMMASLRAMGLAPSPVLVRTDEDRKPYGDL* |
| Ga0126382_100133602 | 3300010047 | Tropical Forest Soil | MWIIWYVAMMASLRAMGLAASPVPVRTDEDRTPYGDI* |
| Ga0099796_103400753 | 3300010159 | Vadose Zone Soil | MWIVMYIAMMASLRAMGLAPNLVTVRTDEDRPPFGEI* |
| Ga0134084_100146862 | 3300010322 | Grasslands Soil | MWIIMYIAVMASLQAMGLEPSLVPIRTDDDHRPPYGDI* |
| Ga0134086_103075811 | 3300010323 | Grasslands Soil | RAMWIIWYIGMMASLRAMGFAPNLLPIRTDEDRKPFGDM* |
| Ga0126370_113145502 | 3300010358 | Tropical Forest Soil | GDWAMWIIWYVAMMASLRAMGLAPIAVPVRTDEDRTPFSDI* |
| Ga0126376_103025172 | 3300010359 | Tropical Forest Soil | MWIIWYVAMMASLRAMGLAPIAVPVRTDEERTPFSDI* |
| Ga0126376_128511832 | 3300010359 | Tropical Forest Soil | MWIIWYIGMMASLRAMGLAPSPVPGIDEDRTPYGDV* |
| Ga0126372_102963051 | 3300010360 | Tropical Forest Soil | MWIIWYIGMMASLRAMGLAPGMVPVRINEDRKPYGDF* |
| Ga0126372_105617762 | 3300010360 | Tropical Forest Soil | MWIIWYVAMVASLRAMGLAPSPVPVRIDEDRKPYGDL* |
| Ga0126372_118771382 | 3300010360 | Tropical Forest Soil | MWIIWYVAMMASLRAMGLAPSPLPVRIDEERKPYGDF* |
| Ga0126378_109379172 | 3300010361 | Tropical Forest Soil | MWIIWYIGMMASLRAMGLAPSLVPIKIDEDRKPFG |
| Ga0126378_115912531 | 3300010361 | Tropical Forest Soil | MWIIWYVAIMASLRAMGLAPIAVPVRTDEDRAPFSDI* |
| Ga0126379_104955262 | 3300010366 | Tropical Forest Soil | MWIIWYVAMVASLRAMGLAPSAVPVRTDEDRKPYGEF* |
| Ga0126379_119539173 | 3300010366 | Tropical Forest Soil | IIWYIGMMASLRAMGLAPSLVPIKIDEDRKPFGDM* |
| Ga0126379_129826881 | 3300010366 | Tropical Forest Soil | MWIIMYIAMVASMRAMGLAPSVVPVRTDEDRPPFGEI* |
| Ga0126381_1004870352 | 3300010376 | Tropical Forest Soil | MWIIWYVGMMASLRAMGLAPSLVPIKIDEDRKPFGDM* |
| Ga0126383_110594761 | 3300010398 | Tropical Forest Soil | MWIIWYVAMVASLRAMGLAPSPVPMRTDEDLTPFTDI* |
| Ga0124850_11208762 | 3300010863 | Tropical Forest Soil | SIGGWAMWIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF* |
| Ga0124850_11346322 | 3300010863 | Tropical Forest Soil | VVGFAGDGAMWIIWYIGMMASLRAMGLAPSLVPIKIDEDRKPFGDM* |
| Ga0151489_17141481 | 3300011106 | Soil | MWIIWYIGMMASLRAMGLAPGVVPVRTDEDRTPYGDV* |
| Ga0120191_100179781 | 3300012022 | Terrestrial | MWIIWYIGMMASLRAMGLAPNLVPIRTDEDRTPFGDV* |
| Ga0137364_102088842 | 3300012198 | Vadose Zone Soil | MWIIWYIGMMASLRAMGFAPNLVPIRTDEDRKPFGDM* |
| Ga0137383_101186012 | 3300012199 | Vadose Zone Soil | MWIIMYIAVMASLQAMGLEPSLVPVRTDDDDRPPCGDI* |
| Ga0137383_103014352 | 3300012199 | Vadose Zone Soil | MWIIWYVAMVASLRAMGLAPSVVPVRTDEDRTPFSDI* |
| Ga0137376_101895772 | 3300012208 | Vadose Zone Soil | MWIIMYIAMVASMRAMGLAPSVVPVRIDEDRPPFGEM* |
| Ga0137366_102129112 | 3300012354 | Vadose Zone Soil | MWIIWYVAMVASLRATGLAPSVVPVRTDEDRTPFSDI* |
| Ga0137369_102987921 | 3300012355 | Vadose Zone Soil | MWIIWYIGMMASLRAMGLAPSLVPIRTDEDRTPFGDV* |
| Ga0137361_113244461 | 3300012362 | Vadose Zone Soil | IWYVAMMASLRAMGIAPSPVPVRTDEDRKPYGDF* |
| Ga0126375_112134702 | 3300012948 | Tropical Forest Soil | GDWAMWIIWYVAMVASLRAMGLAPSPVPVRTDEDRTPFTDI* |
| Ga0164300_105257222 | 3300012951 | Soil | MWIIWYIGMMASLRALGLAPGVVPVWIDEDRKPYGDF* |
| Ga0164304_105059662 | 3300012986 | Soil | MWIIWYIGMMASLRALGLAPGVVPVRIDEDRKPYGDF* |
| Ga0132257_1039053131 | 3300015373 | Arabidopsis Rhizosphere | MWIIWYIGMMASLRAMGLAPGVVPVRTDEARKPYGDF* |
| Ga0132255_1001418785 | 3300015374 | Arabidopsis Rhizosphere | DRAMWIIMYIAMVASLRAMGLSPSMVPVRTDEDRPPFGDI* |
| Ga0182035_102292251 | 3300016341 | Soil | MWIIWYIGMMASLRAMELAPSLVPVKIDEDRKPFCDM |
| Ga0182034_105503692 | 3300016371 | Soil | MWIIWYVAMMASLRAMGLAPIAVPVRTDDERTPFSDI |
| Ga0066655_100694352 | 3300018431 | Grasslands Soil | MWIIMYIAVMASLRAMGLAPDLVQVRTDDDHRPPYGDI |
| Ga0066667_104357461 | 3300018433 | Grasslands Soil | MWIIWYIGMMASLRAMGFAPNLQPIRTDEDRKPFCDM |
| Ga0066662_114646372 | 3300018468 | Grasslands Soil | MWIIMYIAVMASLQAMGLEPSLVPIRTDDDDRPPCGDI |
| Ga0066662_119002442 | 3300018468 | Grasslands Soil | MWIIWYVAMMASLRAMGLAPSVVPVRTDEDRTPFSDI |
| Ga0210407_112260582 | 3300020579 | Soil | MWIIMYVAMIASLRAMGLAPSSVPVRTDDDHRPPFGEI |
| Ga0210399_103804082 | 3300020581 | Soil | MWIIWYIGMMASLRAMGLAPGVVLVRTDEDRKPYGDF |
| Ga0210399_104925181 | 3300020581 | Soil | MWIVMYIAMMASLRAMGLAPNLATVRTDEDRPPFGEV |
| Ga0210406_112897271 | 3300021168 | Soil | MWIIWYIGMMASLRAMGLAPSPLPVRIDEDRTPYGDV |
| Ga0210408_103007302 | 3300021178 | Soil | WAMWIIWYIGMMASLRAMGLAPSPLPVRIDEDRTPYGDV |
| Ga0213879_100052931 | 3300021439 | Bulk Soil | MWIIWYIGMMASLRAMGLAPSVVPVRIDEDRKPYGDF |
| Ga0126371_106429432 | 3300021560 | Tropical Forest Soil | MWIIWYVAMMASLRAMGLAPIAVPVRTDEERTPFSDI |
| Ga0126371_114746432 | 3300021560 | Tropical Forest Soil | MWIIWYVAMVASLRAMGLAPSPVPVRTDEDRTPFTDI |
| Ga0126371_120685561 | 3300021560 | Tropical Forest Soil | MWIIWYVAMVASLRAMGLAPSPVPVRIDEDRKPYGDF |
| Ga0126371_122025332 | 3300021560 | Tropical Forest Soil | MWIIMYIAMVASMRAMGLAPSLVPVRTDEDRPPFGDI |
| Ga0126371_124856431 | 3300021560 | Tropical Forest Soil | MWIIWYIGMMASLRAMGLAPSPVLVRTDEDRKPYGDL |
| Ga0126371_128897802 | 3300021560 | Tropical Forest Soil | AMWIIMYIAMVASLRAMGLAPSMVPVRTDEDRPPFGEI |
| Ga0179589_104233802 | 3300024288 | Vadose Zone Soil | MWIIWYIGMMASLRAMGLAPGVVPVRIDEDHTPYGDV |
| Ga0207692_110365292 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | IVMYIAMMASLRAMGLAPGFVPVRTDEDRPPFGEI |
| Ga0207665_113681552 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPGTRAMWIVMYIAMMASLRAMGLAPNLVTVRTDEDRPPFGEI |
| Ga0209240_10046623 | 3300026304 | Grasslands Soil | MWIIWYIGMMASLRAMGLAPDVVPVRIDEDHTPYGDV |
| Ga0209239_10159433 | 3300026310 | Grasslands Soil | MWIIWYIGMMASLRAMGLAPSPVPVRIDEDRTPYGDV |
| Ga0209239_10506562 | 3300026310 | Grasslands Soil | MWIIWYIGMMASLRAMGFAPNLLPIRTDEDRKPFGDM |
| Ga0209266_11756371 | 3300026327 | Soil | MWIIMYIAVMASLRAMGLAPDLVQVRTDDDHRPPYG |
| Ga0209378_11094782 | 3300026528 | Soil | MWIIWYIGMMASLRTMGLAPGVVPVRIDEDRKPYGDF |
| Ga0209056_101660271 | 3300026538 | Soil | MWIIMYIAVMASLQAMGLEPGLVPIRTDDDDRPPCGDI |
| Ga0209474_100229162 | 3300026550 | Soil | MWIIMYIAMVASLRAMGLAPSMVPVRTDEDRPPFGEI |
| Ga0209523_10402911 | 3300027548 | Forest Soil | MWIIWYIGMMASLRAMGLAPGVVPVRTDEDRKPYGDF |
| Ga0209466_10017832 | 3300027646 | Tropical Forest Soil | MWIIWYVAMVASLRAMGLAPSPVPVRTDEDRKPYGDF |
| Ga0209465_101213502 | 3300027874 | Tropical Forest Soil | MWIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF |
| Ga0209465_104360491 | 3300027874 | Tropical Forest Soil | MWIIWYIGMMASLRAMGLAPSPVLVRTDEDRKPYGDF |
| Ga0209488_108435772 | 3300027903 | Vadose Zone Soil | MWIIMYIAMVASMRAMGLAPSVVPVRTDEDRPPFGEM |
| Ga0307307_100401712 | 3300028718 | Soil | MWIVMYIAMMASLRAMGMAPGFVPVRTDEDRPPFGEI |
| Ga0307277_100000143 | 3300028881 | Soil | MWIVMYIAMMASLRAMGLAPSFVPVRTDEDRPPFGEI |
| Ga0318516_100604413 | 3300031543 | Soil | WIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF |
| Ga0318516_101808402 | 3300031543 | Soil | MWIIWYVAMMASLRAMGLAPSPVLVRTDEDRKPYGDF |
| Ga0318516_104241982 | 3300031543 | Soil | GGWAMWIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF |
| Ga0318534_101064472 | 3300031544 | Soil | MWIIWYVAMVASLRAMGLAPDPVPVRIDEDRTPYGDI |
| Ga0318541_101389662 | 3300031545 | Soil | MWIIWYIGMMASLRAMGLAPSLVPVKIDEDRKPFGDM |
| Ga0318541_102091412 | 3300031545 | Soil | MWIIWYVAMVASLRAMGLAPDPVPVRIDEDRTPYG |
| Ga0318541_105119811 | 3300031545 | Soil | WAMWIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF |
| Ga0310915_100293762 | 3300031573 | Soil | VWIIWYIGMMASLRAMGLAPSLVPVKIDEDRKPFGDM |
| Ga0310915_101070942 | 3300031573 | Soil | MWIIWYIGMMASLRAMGLAPSPVPIRTDENRKPYGDF |
| Ga0318500_103338972 | 3300031724 | Soil | IIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF |
| Ga0306918_103111381 | 3300031744 | Soil | AMWIIWYVAMMASLRAVGLAPNPVPVRIDEDRKPYGDF |
| Ga0306918_107070782 | 3300031744 | Soil | MWIIWYVAMVASLRAMGLAPSPLPVRTDEDRTPFTDI |
| Ga0318521_104719882 | 3300031770 | Soil | DGAMWIIWYIGMMASLRAMGLAPSLVPVKIDEDRKPFGDM |
| Ga0318503_101185482 | 3300031794 | Soil | AMWIIWYIGMMASLRAMGLAPSPVPVRIDEDRKPYGDF |
| Ga0318512_102816211 | 3300031846 | Soil | GLIRGDWAMWIIWYIGMMASLRAMGLAPGVVPVRTDEERKPYGDF |
| Ga0318536_101880902 | 3300031893 | Soil | MWIIWYIGMMASLRAMGLAPGVVPVRTDEDRTPYGDV |
| Ga0306921_124530151 | 3300031912 | Soil | AMWIIWYIGMMASLRAVGLAPSPVPIRTDEDRKPYGDF |
| Ga0310912_112486821 | 3300031941 | Soil | MWIIWYVAMVASLRAMGLAPSPVPVRIDEDRKPYGDLLV |
| Ga0306926_124513741 | 3300031954 | Soil | WAMWIIWYIGMMASLRAVGLAPSPVPIRTDEDRKPYGDF |
| Ga0306922_110112492 | 3300032001 | Soil | MWIIWYVAMMASLRAVGLAPNPVPVRMDEDRKPYGDF |
| Ga0306922_112337921 | 3300032001 | Soil | MWIIWYVAMVASLRAMGLAPSPVPVRIDEDRKPYGD |
| Ga0318570_100621741 | 3300032054 | Soil | MWIIWYVAMVASLRAMGLAPSPLPVRTDEDRTPFT |
| Ga0306924_117038971 | 3300032076 | Soil | MWIIWYIGMMASLRAVGLAPSPVPIRTDEDRKPYGDF |
| ⦗Top⦘ |