


| Basic Information | |
|---|---|
| Family ID | F039790 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 163 |
| Average Sequence Length | 40 residues |
| Representative Sequence | DTVGQPPSAEIGVSNMPSLKAKKLRKLPQEKVLLEL |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 163 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 11.18 % |
| % of genes near scaffold ends (potentially truncated) | 88.34 % |
| % of genes from short scaffolds (< 2000 bps) | 92.02 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (57.055 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (33.742 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.926 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.601 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.12% β-sheet: 0.00% Coil/Unstructured: 71.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 163 Family Scaffolds |
|---|---|---|
| PF00078 | RVT_1 | 1.84 |
| PF01656 | CbiA | 1.84 |
| PF05694 | SBP56 | 1.84 |
| PF00239 | Resolvase | 1.84 |
| PF01348 | Intron_maturas2 | 1.23 |
| PF01548 | DEDD_Tnp_IS110 | 1.23 |
| PF13669 | Glyoxalase_4 | 1.23 |
| PF01844 | HNH | 1.23 |
| PF04392 | ABC_sub_bind | 1.23 |
| PF07452 | CHRD | 0.61 |
| PF08028 | Acyl-CoA_dh_2 | 0.61 |
| PF06736 | TMEM175 | 0.61 |
| PF00140 | Sigma70_r1_2 | 0.61 |
| PF04075 | F420H2_quin_red | 0.61 |
| PF14706 | Tnp_DNA_bind | 0.61 |
| PF12680 | SnoaL_2 | 0.61 |
| PF05598 | DUF772 | 0.61 |
| PF01710 | HTH_Tnp_IS630 | 0.61 |
| PF03050 | DDE_Tnp_IS66 | 0.61 |
| PF01593 | Amino_oxidase | 0.61 |
| PF13586 | DDE_Tnp_1_2 | 0.61 |
| PF13701 | DDE_Tnp_1_4 | 0.61 |
| PF02371 | Transposase_20 | 0.61 |
| PF03150 | CCP_MauG | 0.61 |
| PF13604 | AAA_30 | 0.61 |
| PF03992 | ABM | 0.61 |
| PF12706 | Lactamase_B_2 | 0.61 |
| PF00589 | Phage_integrase | 0.61 |
| PF00563 | EAL | 0.61 |
| PF13551 | HTH_29 | 0.61 |
| PF01135 | PCMT | 0.61 |
| PF13614 | AAA_31 | 0.61 |
| PF13613 | HTH_Tnp_4 | 0.61 |
| PF13546 | DDE_5 | 0.61 |
| PF02417 | Chromate_transp | 0.61 |
| PF00296 | Bac_luciferase | 0.61 |
| PF13384 | HTH_23 | 0.61 |
| PF02796 | HTH_7 | 0.61 |
| PF14720 | NiFe_hyd_SSU_C | 0.61 |
| PF02452 | PemK_toxin | 0.61 |
| PF13751 | DDE_Tnp_1_6 | 0.61 |
| PF13358 | DDE_3 | 0.61 |
| PF11535 | Calci_bind_CcbP | 0.61 |
| PF00484 | Pro_CA | 0.61 |
| PF13649 | Methyltransf_25 | 0.61 |
| PF04326 | AlbA_2 | 0.61 |
| PF08241 | Methyltransf_11 | 0.61 |
| PF13340 | DUF4096 | 0.61 |
| PF01878 | EVE | 0.61 |
| PF04014 | MazE_antitoxin | 0.61 |
| PF07366 | SnoaL | 0.61 |
| PF03466 | LysR_substrate | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 163 Family Scaffolds |
|---|---|---|---|
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.84 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.84 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.84 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.23 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.61 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.61 |
| COG1673 | Predicted RNA-binding protein, contains PUA-like EVE domain | General function prediction only [R] | 0.61 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.61 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 0.61 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.61 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.61 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.61 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.61 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.61 |
| COG2947 | Predicted RNA-binding protein, contains EVE domain | General function prediction only [R] | 0.61 |
| COG3415 | CRISPR-associated protein Csa3, CARF domain | Defense mechanisms [V] | 0.61 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.61 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.61 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.61 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.61 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 57.06 % |
| All Organisms | root | All Organisms | 42.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004633|Ga0066395_10407358 | Not Available | 767 | Open in IMG/M |
| 3300005166|Ga0066674_10303824 | Not Available | 750 | Open in IMG/M |
| 3300005289|Ga0065704_10314357 | Not Available | 863 | Open in IMG/M |
| 3300005295|Ga0065707_10024960 | Not Available | 1196 | Open in IMG/M |
| 3300005332|Ga0066388_102199398 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300005332|Ga0066388_104391627 | Not Available | 718 | Open in IMG/M |
| 3300005332|Ga0066388_105418279 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005347|Ga0070668_100672021 | Not Available | 911 | Open in IMG/M |
| 3300005445|Ga0070708_100242331 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
| 3300005562|Ga0058697_10433147 | Not Available | 658 | Open in IMG/M |
| 3300005574|Ga0066694_10197416 | Not Available | 955 | Open in IMG/M |
| 3300005598|Ga0066706_11191958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 579 | Open in IMG/M |
| 3300005713|Ga0066905_100515698 | Not Available | 997 | Open in IMG/M |
| 3300005713|Ga0066905_101955964 | Not Available | 543 | Open in IMG/M |
| 3300005719|Ga0068861_100579890 | Not Available | 1026 | Open in IMG/M |
| 3300005764|Ga0066903_100469567 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300005764|Ga0066903_100472786 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
| 3300005764|Ga0066903_103207659 | Not Available | 884 | Open in IMG/M |
| 3300005764|Ga0066903_107437298 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300005764|Ga0066903_108515322 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005842|Ga0068858_101488467 | Not Available | 667 | Open in IMG/M |
| 3300006032|Ga0066696_10551668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia pickettii | 753 | Open in IMG/M |
| 3300006032|Ga0066696_10831444 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006049|Ga0075417_10036933 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
| 3300006049|Ga0075417_10066635 | Not Available | 1586 | Open in IMG/M |
| 3300006049|Ga0075417_10072299 | Not Available | 1528 | Open in IMG/M |
| 3300006049|Ga0075417_10138676 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB3 → candidate division KSB3 bacterium | 1126 | Open in IMG/M |
| 3300006049|Ga0075417_10369111 | Not Available | 706 | Open in IMG/M |
| 3300006049|Ga0075417_10415001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 668 | Open in IMG/M |
| 3300006049|Ga0075417_10483768 | Not Available | 620 | Open in IMG/M |
| 3300006058|Ga0075432_10208321 | All Organisms → cellular organisms → Bacteria → PVC group | 777 | Open in IMG/M |
| 3300006173|Ga0070716_100389577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 998 | Open in IMG/M |
| 3300006173|Ga0070716_101521223 | Not Available | 548 | Open in IMG/M |
| 3300006194|Ga0075427_10012507 | Not Available | 1288 | Open in IMG/M |
| 3300006844|Ga0075428_100351309 | Not Available | 1582 | Open in IMG/M |
| 3300006844|Ga0075428_100806886 | Not Available | 997 | Open in IMG/M |
| 3300006844|Ga0075428_100905409 | Not Available | 935 | Open in IMG/M |
| 3300006844|Ga0075428_101106963 | Not Available | 836 | Open in IMG/M |
| 3300006844|Ga0075428_101288728 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300006845|Ga0075421_100322883 | All Organisms → cellular organisms → Bacteria | 1871 | Open in IMG/M |
| 3300006845|Ga0075421_101557402 | Not Available | 721 | Open in IMG/M |
| 3300006845|Ga0075421_101908453 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300006845|Ga0075421_102347429 | Not Available | 559 | Open in IMG/M |
| 3300006845|Ga0075421_102740486 | Not Available | 509 | Open in IMG/M |
| 3300006846|Ga0075430_100211429 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
| 3300006847|Ga0075431_100227696 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
| 3300006847|Ga0075431_100512621 | Not Available | 1189 | Open in IMG/M |
| 3300006852|Ga0075433_10214697 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
| 3300006852|Ga0075433_10786576 | Not Available | 832 | Open in IMG/M |
| 3300006853|Ga0075420_100318514 | Not Available | 1347 | Open in IMG/M |
| 3300006853|Ga0075420_101078842 | Not Available | 691 | Open in IMG/M |
| 3300006853|Ga0075420_101276489 | Not Available | 630 | Open in IMG/M |
| 3300006854|Ga0075425_101722257 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300006871|Ga0075434_100900726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 899 | Open in IMG/M |
| 3300006871|Ga0075434_102534898 | Not Available | 514 | Open in IMG/M |
| 3300006904|Ga0075424_100224223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1997 | Open in IMG/M |
| 3300006904|Ga0075424_100589168 | Not Available | 1187 | Open in IMG/M |
| 3300006904|Ga0075424_101287426 | Not Available | 777 | Open in IMG/M |
| 3300006914|Ga0075436_100439737 | Not Available | 948 | Open in IMG/M |
| 3300006969|Ga0075419_10131001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1629 | Open in IMG/M |
| 3300007790|Ga0105679_10526868 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1420 | Open in IMG/M |
| 3300009090|Ga0099827_10592729 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 955 | Open in IMG/M |
| 3300009090|Ga0099827_11744854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
| 3300009094|Ga0111539_12953012 | Not Available | 550 | Open in IMG/M |
| 3300009094|Ga0111539_13284937 | Not Available | 521 | Open in IMG/M |
| 3300009100|Ga0075418_10165907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2351 | Open in IMG/M |
| 3300009100|Ga0075418_10615200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1169 | Open in IMG/M |
| 3300009100|Ga0075418_12656931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300009100|Ga0075418_12668714 | Not Available | 545 | Open in IMG/M |
| 3300009100|Ga0075418_12696574 | Not Available | 543 | Open in IMG/M |
| 3300009100|Ga0075418_12987874 | Not Available | 516 | Open in IMG/M |
| 3300009137|Ga0066709_102830059 | Not Available | 643 | Open in IMG/M |
| 3300009147|Ga0114129_10299955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium C00003107 | 2142 | Open in IMG/M |
| 3300009147|Ga0114129_10723835 | Not Available | 1277 | Open in IMG/M |
| 3300009156|Ga0111538_12701489 | Not Available | 622 | Open in IMG/M |
| 3300009156|Ga0111538_13589499 | Not Available | 538 | Open in IMG/M |
| 3300009156|Ga0111538_13691556 | Not Available | 530 | Open in IMG/M |
| 3300009162|Ga0075423_10543194 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300009162|Ga0075423_12172654 | Not Available | 603 | Open in IMG/M |
| 3300009545|Ga0105237_11714293 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300009553|Ga0105249_10123170 | All Organisms → cellular organisms → Bacteria | 2467 | Open in IMG/M |
| 3300009553|Ga0105249_10263381 | Not Available | 1714 | Open in IMG/M |
| 3300009553|Ga0105249_10424512 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300009553|Ga0105249_11572182 | Not Available | 730 | Open in IMG/M |
| 3300009789|Ga0126307_11394213 | Not Available | 568 | Open in IMG/M |
| 3300009792|Ga0126374_10667798 | Not Available | 777 | Open in IMG/M |
| 3300009811|Ga0105084_1093790 | Not Available | 562 | Open in IMG/M |
| 3300009837|Ga0105058_1150406 | Not Available | 565 | Open in IMG/M |
| 3300010041|Ga0126312_10630318 | Not Available | 772 | Open in IMG/M |
| 3300010041|Ga0126312_10689490 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300010041|Ga0126312_11143177 | Not Available | 573 | Open in IMG/M |
| 3300010043|Ga0126380_10198858 | Not Available | 1340 | Open in IMG/M |
| 3300010046|Ga0126384_11422689 | Not Available | 647 | Open in IMG/M |
| 3300010046|Ga0126384_12089040 | Not Available | 543 | Open in IMG/M |
| 3300010046|Ga0126384_12101023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 542 | Open in IMG/M |
| 3300010047|Ga0126382_12332624 | Not Available | 518 | Open in IMG/M |
| 3300010047|Ga0126382_12519713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
| 3300010145|Ga0126321_1071032 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300010145|Ga0126321_1074832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2845 | Open in IMG/M |
| 3300010303|Ga0134082_10542961 | Not Available | 511 | Open in IMG/M |
| 3300010322|Ga0134084_10195523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 705 | Open in IMG/M |
| 3300010358|Ga0126370_11453053 | Not Available | 650 | Open in IMG/M |
| 3300010359|Ga0126376_10718773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca | 964 | Open in IMG/M |
| 3300010359|Ga0126376_13013838 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300010361|Ga0126378_13092354 | Not Available | 530 | Open in IMG/M |
| 3300010362|Ga0126377_10869813 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 963 | Open in IMG/M |
| 3300010362|Ga0126377_12515905 | Not Available | 590 | Open in IMG/M |
| 3300010362|Ga0126377_12988540 | Not Available | 546 | Open in IMG/M |
| 3300010362|Ga0126377_13329479 | Not Available | 519 | Open in IMG/M |
| 3300010366|Ga0126379_11700553 | Not Available | 736 | Open in IMG/M |
| 3300010366|Ga0126379_13194049 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300010366|Ga0126379_13726419 | Not Available | 511 | Open in IMG/M |
| 3300010398|Ga0126383_11918902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 680 | Open in IMG/M |
| 3300010398|Ga0126383_12033887 | Not Available | 662 | Open in IMG/M |
| 3300010398|Ga0126383_12762718 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300011270|Ga0137391_10104985 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
| 3300012203|Ga0137399_10824462 | Not Available | 781 | Open in IMG/M |
| 3300012212|Ga0150985_108887986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 974 | Open in IMG/M |
| 3300012349|Ga0137387_11128092 | Not Available | 557 | Open in IMG/M |
| 3300012356|Ga0137371_10355386 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300012359|Ga0137385_10454518 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1087 | Open in IMG/M |
| 3300012361|Ga0137360_10165064 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
| 3300012363|Ga0137390_11638478 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300012469|Ga0150984_106155611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 776 | Open in IMG/M |
| 3300012506|Ga0157324_1052249 | Not Available | 535 | Open in IMG/M |
| 3300012922|Ga0137394_10802628 | Not Available | 789 | Open in IMG/M |
| 3300012930|Ga0137407_12108374 | Not Available | 538 | Open in IMG/M |
| 3300012971|Ga0126369_11127559 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300012971|Ga0126369_12514134 | Not Available | 600 | Open in IMG/M |
| 3300012971|Ga0126369_13583946 | Not Available | 509 | Open in IMG/M |
| 3300013306|Ga0163162_10536102 | Not Available | 1299 | Open in IMG/M |
| 3300013306|Ga0163162_12312905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 617 | Open in IMG/M |
| 3300015372|Ga0132256_102164570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 661 | Open in IMG/M |
| 3300015373|Ga0132257_100336255 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1822 | Open in IMG/M |
| 3300015373|Ga0132257_104152300 | Not Available | 527 | Open in IMG/M |
| 3300016357|Ga0182032_10552355 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300016387|Ga0182040_10653797 | Not Available | 856 | Open in IMG/M |
| 3300016422|Ga0182039_10779007 | Not Available | 848 | Open in IMG/M |
| 3300016445|Ga0182038_10907650 | Not Available | 776 | Open in IMG/M |
| 3300016445|Ga0182038_12025672 | Not Available | 521 | Open in IMG/M |
| 3300018076|Ga0184609_10255471 | Not Available | 819 | Open in IMG/M |
| 3300018433|Ga0066667_11300139 | Not Available | 635 | Open in IMG/M |
| 3300018468|Ga0066662_12552083 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 539 | Open in IMG/M |
| 3300019356|Ga0173481_10462669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300021073|Ga0210378_10233789 | Not Available | 698 | Open in IMG/M |
| 3300022195|Ga0222625_1682486 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300026358|Ga0257166_1001896 | Not Available | 2041 | Open in IMG/M |
| 3300027577|Ga0209874_1131969 | Not Available | 575 | Open in IMG/M |
| 3300027873|Ga0209814_10065929 | Not Available | 1518 | Open in IMG/M |
| 3300027880|Ga0209481_10382837 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → unclassified Candidatus Brocadiae → Candidatus Brocadiae bacterium | 720 | Open in IMG/M |
| 3300027903|Ga0209488_10035752 | All Organisms → cellular organisms → Bacteria | 3629 | Open in IMG/M |
| 3300027903|Ga0209488_10719376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 714 | Open in IMG/M |
| 3300027907|Ga0207428_10155847 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
| 3300027907|Ga0207428_10881997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 633 | Open in IMG/M |
| 3300027909|Ga0209382_10871175 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300028608|Ga0247819_10612748 | Not Available | 657 | Open in IMG/M |
| 3300031114|Ga0308187_10010782 | Not Available | 1871 | Open in IMG/M |
| 3300031796|Ga0318576_10045379 | Not Available | 1886 | Open in IMG/M |
| 3300031995|Ga0307409_100019347 | All Organisms → cellular organisms → Bacteria | 4607 | Open in IMG/M |
| 3300032002|Ga0307416_100236103 | Not Available | 1767 | Open in IMG/M |
| 3300033551|Ga0247830_10335895 | Not Available | 1165 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 33.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.34% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.75% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.84% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.84% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.23% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.23% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.23% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.23% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.23% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.61% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.61% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Host-Associated | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066395_104073581 | 3300004633 | Tropical Forest Soil | KRADTVGQPPSAEIGVLNMPSLKAKKLRKPSQEKVLLEL* |
| Ga0066674_103038241 | 3300005166 | Soil | LKKGRDTVGELTSAEMCVSHMPSWKAKKLGKLTQEKVLPEL* |
| Ga0065704_103143571 | 3300005289 | Switchgrass Rhizosphere | TYGVDEKRPDTVGELKSANICVSHMPSWKAKKRGRLPQENVLLEL* |
| Ga0065707_100249601 | 3300005295 | Switchgrass Rhizosphere | KRPDTVGEPRSVEICLSNMPSLKAKKRGKCAPEKVLLEP* |
| Ga0066388_1021993981 | 3300005332 | Tropical Forest Soil | MSLKLHDTVGELGSAVLCVSYMSSLKAKKLEKLTREKAVLER* |
| Ga0066388_1043916272 | 3300005332 | Tropical Forest Soil | SVPIRKRPDTVGELRSAKICMSYMPSLKARKLEMLAPEKVVLER* |
| Ga0066388_1054182791 | 3300005332 | Tropical Forest Soil | KRPDTVGQPPSAEIGVLNMPFLQAKKLRKPSQEKVLLEL* |
| Ga0070668_1006720213 | 3300005347 | Switchgrass Rhizosphere | MARSQHVENLPDTVGELRTAEFCVSYMPSLKAKKLEKLTQEKAVLER* |
| Ga0070708_1002423312 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | CLTKPPDTVGELKSADMCVSHMPSVKAKKRGKRAQDKVLLEP* |
| Ga0058697_104331471 | 3300005562 | Agave | DTVGQPPSTEIGVLNMSSWKAKKLRKFPQEKVLLEL* |
| Ga0066694_101974163 | 3300005574 | Soil | DTVGELKSAEIYVSDMPSLKAKKLGKLPQEEVLLEL* |
| Ga0066706_111919582 | 3300005598 | Soil | DTVGELGSAEICVSHMPSWKAKKLGKLTQEKVLLEL* |
| Ga0066905_1005156982 | 3300005713 | Tropical Forest Soil | DTVGQPPSAEICVYNMPSLEVKKLWKLTQEKVLLEL* |
| Ga0066905_1019559641 | 3300005713 | Tropical Forest Soil | DTVGQPPGTEISVSTMPSWKAKKLGKLPQEKVLLEL* |
| Ga0068861_1005798901 | 3300005719 | Switchgrass Rhizosphere | PDTVGELRTAEFCVSYMPSLKAKKLEKLTQEKAVLER* |
| Ga0066903_1004695674 | 3300005764 | Tropical Forest Soil | VHDKRPDTVGQPLSTEISVPNIPSLKAKKLIKLSREKVLLEL* |
| Ga0066903_1004727861 | 3300005764 | Tropical Forest Soil | PDTVGQPPSTEIGVAIMPTLKAKRLRKPPQEKVLLEL* |
| Ga0066903_1032076592 | 3300005764 | Tropical Forest Soil | DTVGQPPSAEIGVLNMPSLKAKKLRKPSQEKVLLEL* |
| Ga0066903_1074372981 | 3300005764 | Tropical Forest Soil | MHENRPDTVGQPSSAEIRVANMPSLKAKKLGKLPREKVLLEL* |
| Ga0066903_1085153222 | 3300005764 | Tropical Forest Soil | DTVGQPPDTEIGVPNIPSLKAKKLGKLPREKVLLEL* |
| Ga0068858_1014884672 | 3300005842 | Switchgrass Rhizosphere | DTVGEPRSVEICLSNMPSLKAKKRGKCAPEKVLLEP* |
| Ga0066696_105516683 | 3300006032 | Soil | DTVGELKSAEICGSHMPSLKAKKLGELAPEKVLLEL* |
| Ga0066696_108314441 | 3300006032 | Soil | VSKKRADTVGQPPSTEIGVSNMPSLKAKKLRKLPREKVLLEL* |
| Ga0075417_100369335 | 3300006049 | Populus Rhizosphere | MSTKRADTVGQPPGAEICVSNMPALKAKKLGKLPQEKVL |
| Ga0075417_100666351 | 3300006049 | Populus Rhizosphere | MTGESLSLTKRLDTVGQPPGTKIGVPNMPSLKAKKLRKLPREKVLLEL* |
| Ga0075417_100722992 | 3300006049 | Populus Rhizosphere | DTVGELKSAEICVSHIPSLKAKNLGKLPQEKVLLEL* |
| Ga0075417_101386761 | 3300006049 | Populus Rhizosphere | PDTVGQPPSTEIGVPNMPSLKAKKLSKLPREKVLLEP* |
| Ga0075417_103691112 | 3300006049 | Populus Rhizosphere | DTVGELGSAEICVSHMPAWKAKKLETLTQEKVLLER* |
| Ga0075417_104150011 | 3300006049 | Populus Rhizosphere | TDTVGQPPSTEIGVPNMPSLKAKKLRKLPQEKVLLEL* |
| Ga0075417_104837682 | 3300006049 | Populus Rhizosphere | DTVGQPPSTEIGVPNMPALKAKKLRKLPQEKVLLEL* |
| Ga0075432_102083211 | 3300006058 | Populus Rhizosphere | KRPDTVGELKSAEIGVSQMPSLKAKKRGKRVQEKVLLEP* |
| Ga0070716_1003895772 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DTVGQPPSAEIGVSNMPSLKAKKLRKLPQEKVLLEL* |
| Ga0070716_1015212231 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DTVGELKSAEICVSHMPSWKAKKLGKLTQEKVLLEL* |
| Ga0075427_100125072 | 3300006194 | Populus Rhizosphere | PDTVGEPPSAEMGVSHMPSLKAKTLGKLTQEKVLLEL* |
| Ga0075428_1003513092 | 3300006844 | Populus Rhizosphere | MSRFIHVLDYRPDTVGEFKSAEICVSHMPSWKAKKPGKLTQEKVLLEFE |
| Ga0075428_1008068862 | 3300006844 | Populus Rhizosphere | MHEKRSDTVGQPPGAEICVSNMPSKKAKKLEKISQEKVLLEP* |
| Ga0075428_1009054091 | 3300006844 | Populus Rhizosphere | MVLLRLPHELSSISLEKRTDTVGQPPSTEIGVLNMPSWKAKKLGKLSQEKVLLEL* |
| Ga0075428_1011069631 | 3300006844 | Populus Rhizosphere | DTVGQPPRAEICVPNMPSWKAKKLRKLPQEKVLLEL* |
| Ga0075428_1012887281 | 3300006844 | Populus Rhizosphere | TDTVGQPPSTEIGVLNMPSLKAKKLRKLPRDKVLLEL* |
| Ga0075421_1003228831 | 3300006845 | Populus Rhizosphere | RPDTVGQPPSTEMGVLNMPSLKAKKLRKLLQEKVLLEL* |
| Ga0075421_1015574021 | 3300006845 | Populus Rhizosphere | KKRADTVGQPPSTEIGVSNMPSLKAKKLRQLPRDKVLLEL* |
| Ga0075421_1019084532 | 3300006845 | Populus Rhizosphere | TDTVGQPPSTEIGVPNMPSLKAKKLGKLAQEKVLLER* |
| Ga0075421_1023474291 | 3300006845 | Populus Rhizosphere | VRTKRADTVGEFKSAEMGVLYLPALKAKKRGKLAQEKVL |
| Ga0075421_1027404862 | 3300006845 | Populus Rhizosphere | DTVGELKSAEICVSHMPAWKAKKLGTLAQEKVLLEP* |
| Ga0075430_1002114293 | 3300006846 | Populus Rhizosphere | RPDTVGELGSAEICVSHMPAWKAKKLETLTQEKVLLER* |
| Ga0075431_1002276962 | 3300006847 | Populus Rhizosphere | DTVGEPPSAEMGVSHMPSLKAKTLGKLTQEKVLLEL* |
| Ga0075431_1005126213 | 3300006847 | Populus Rhizosphere | KRADTVGQPQSTEMGVPNMLSLKAKKLRKLLQAKVLLER* |
| Ga0075433_102146973 | 3300006852 | Populus Rhizosphere | PDTVGQPPSTEMGVLNMPSLKAKKLRKLLQEKVLLEL* |
| Ga0075433_107865762 | 3300006852 | Populus Rhizosphere | DTVGEFKSAEICVSHMPSWMAKTLGKLTQEKALLEP* |
| Ga0075420_1003185141 | 3300006853 | Populus Rhizosphere | MTGESLSLTKRLDTVGQPPSTKIGVPNMPSLKAKKLSKLPREKVLLEL* |
| Ga0075420_1010788422 | 3300006853 | Populus Rhizosphere | DTVGEFKSAEMGVPHMPAWKAKTLGKLTQERVLLEP* |
| Ga0075420_1012764892 | 3300006853 | Populus Rhizosphere | RPDTVGEPPSAEICVSHMPAWKAKKLGKLLQEKVLLEL* |
| Ga0075425_1017222571 | 3300006854 | Populus Rhizosphere | KRPDTVGQPPRTEIGVLNMPSLKAKKLRNLPREKVLLEP* |
| Ga0075434_1009007263 | 3300006871 | Populus Rhizosphere | LTNSIRADTVGQPPSTEIGVPNMPSWKAKKPGKLTQEKVLLE |
| Ga0075434_1025348981 | 3300006871 | Populus Rhizosphere | KRPDTVGQPPGAEICVSNMPALKAKKLGKLPQEKVLLEL* |
| Ga0075424_1002242234 | 3300006904 | Populus Rhizosphere | LSLENPPDTVGEPPSAEMGVSHMPSLKAKTLGKLTQEKVLLE |
| Ga0075424_1005891681 | 3300006904 | Populus Rhizosphere | DTVGEFKSAEMCVSHMPALKAKKRRKLAQEKVLLEP* |
| Ga0075424_1012874262 | 3300006904 | Populus Rhizosphere | MKRSDTVGQPPSTEMGVLNMPSLKAKKLRKLLQEKVLLEFE |
| Ga0075436_1004397371 | 3300006914 | Populus Rhizosphere | TVGEFKSAEICVSHLPSKKAKKLGKLAPEKVLLEL* |
| Ga0075419_101310012 | 3300006969 | Populus Rhizosphere | DTVGQPPSAEICVSNMPSLKAKKLRKLPRDKVLLEL* |
| Ga0105679_105268682 | 3300007790 | Soil | MLMPEKRADTVGELKSAEIYVFDMPSWQALKLGKPSQEKVLLEL* |
| Ga0099827_105927291 | 3300009090 | Vadose Zone Soil | MSLLEAQSKKRPDTVGELRSAEICVSYMPSLKAKKLEKLTQEKAVLER* |
| Ga0099827_117448542 | 3300009090 | Vadose Zone Soil | TVGQPPSAEIYVSNMPALKAKKLGKLPQEKVLLEL* |
| Ga0111539_129530121 | 3300009094 | Populus Rhizosphere | MKVRESLPKPPDTVGQPPSTEMGVLNMPSLKAKKLRKLLQEKVL |
| Ga0111539_132849372 | 3300009094 | Populus Rhizosphere | RVDTVGQPPSTEIGVLNMSSGKAKKLRKLPQEKVLLEL* |
| Ga0075418_101659071 | 3300009100 | Populus Rhizosphere | MLTNSLTKGGDTVGQPPGAEICVSNMPSKKAKKLEKISQEK |
| Ga0075418_106152002 | 3300009100 | Populus Rhizosphere | MGLEKPPDTVGEPPSAEICVSHMPAWKAKKLGKLLQEKVLLEL* |
| Ga0075418_126569312 | 3300009100 | Populus Rhizosphere | GDTVGQPPSTEIGVLNMSSWKAKKLRKLPQEKVLLEL* |
| Ga0075418_126687142 | 3300009100 | Populus Rhizosphere | DTVGQPPSTEIGMPNMPSLKAKKLSKLPREKVLLEL* |
| Ga0075418_126965741 | 3300009100 | Populus Rhizosphere | DTVGQPPSAEIGVPNLPSLKAKRLSKLPRENVLLEL* |
| Ga0075418_129878742 | 3300009100 | Populus Rhizosphere | LEDREKVTDTVGQPPSAEIGVSNIPSLKAKKLRKLLQEEVLLEL* |
| Ga0066709_1028300591 | 3300009137 | Grasslands Soil | KRPDTVGQPPSTEISVLNMPSLKAKKLRKLPRDKVLLEL* |
| Ga0114129_102999551 | 3300009147 | Populus Rhizosphere | DTVGQPPSAEIGVPNMPALKVKKPRKLPQDKVRLEP* |
| Ga0114129_107238352 | 3300009147 | Populus Rhizosphere | PPPSPRSLPREKRPDTVGELRSAKICVADMSSLKAKKLIKLPQEKVLLEL* |
| Ga0111538_127014891 | 3300009156 | Populus Rhizosphere | GLRKPDTVGELPSAETCLSNMPSLKAKKRGKRAPEKVLLEP* |
| Ga0111538_135894991 | 3300009156 | Populus Rhizosphere | DTVGQPPSTEIGVLNMSSWKAKKLRKLPQEKVLLEL* |
| Ga0111538_136915561 | 3300009156 | Populus Rhizosphere | LLLSENLFASNYPGAATKPPDTVGELKSAAIGVSHMPSLKAKKLRKLLQEKVCLEL* |
| Ga0075423_105431942 | 3300009162 | Populus Rhizosphere | DTVGQPPSTEMGVLNMPSLKAKKLRKLLQEKVLLEL* |
| Ga0075423_121726542 | 3300009162 | Populus Rhizosphere | LVGQPPRAEICVPNMPSGKAKKLRKLPQEKVLLEL* |
| Ga0105237_117142932 | 3300009545 | Corn Rhizosphere | MTRAARCSNRADTVGELPSAETCLSNMSSLKAKKRGKRAPEKVLL |
| Ga0105249_101231702 | 3300009553 | Switchgrass Rhizosphere | MYSKWADNVGELRNDKFCVSYMPSLKAKKLEKLTQEKAVLER* |
| Ga0105249_102633811 | 3300009553 | Switchgrass Rhizosphere | DTVGQPPGAEICVSNMPALKAKKLGKLPQEKVLLEL* |
| Ga0105249_104245121 | 3300009553 | Switchgrass Rhizosphere | PCDTVGEIKSPEVCVFHMPSWKAKTLEKLKQEKVLLEL* |
| Ga0105249_115721821 | 3300009553 | Switchgrass Rhizosphere | MPKNRPDTVGELRTAEFCVSYMPSLKAKKLEKLTQEKAVLER |
| Ga0126307_113942131 | 3300009789 | Serpentine Soil | PDTVGQPPSTEIRVLNMSSWKAKKLRKLPQEKVLLEL* |
| Ga0126374_106677981 | 3300009792 | Tropical Forest Soil | DTVGQPPSAEIWVSKIPSLKAKKLRILPQEKVLLEL* |
| Ga0105084_10937901 | 3300009811 | Groundwater Sand | RFTCLKNPPDTVGELRSAKMSVPYMPSWKAKKLGTLAQEKVLLEP* |
| Ga0105058_11504062 | 3300009837 | Groundwater Sand | MDTVGELKSAEICVSHMPSLKAKKLGKLAQEKVLLEL* |
| Ga0126312_106303181 | 3300010041 | Serpentine Soil | KCCLEKPSDTVGQPPSAEIGVTHMPSLKAKKLGKLPQEKVLLEL* |
| Ga0126312_106894901 | 3300010041 | Serpentine Soil | MSLEKGPDTVGELRTAEICVSYVPSLKAKKLRKLTQEKAVLER |
| Ga0126312_109651711 | 3300010041 | Serpentine Soil | MRFVYGSLKNRPDTVGQPLSAEIGVLNMPAWKAKKLEKLPRDKVLLEL* |
| Ga0126312_111431771 | 3300010041 | Serpentine Soil | DSNFPGAADTVGELKSAEICVSHISSLKAKKRGKFTQEKVLLEL* |
| Ga0126380_101988581 | 3300010043 | Tropical Forest Soil | MANSIRADAVGELRTAEICVSSMPSLKAKKLEKLTQAKAVLE |
| Ga0126384_114226891 | 3300010046 | Tropical Forest Soil | MESINWKKRAVTVGEPPSTEIGVPNMPSLKAKKLSKLPREKVFLEL* |
| Ga0126384_120890401 | 3300010046 | Tropical Forest Soil | YVADVSSLSKNRADTVGQPLSAEIGVLNMPSWKTKKLRKLPREKVLLKL* |
| Ga0126384_121010232 | 3300010046 | Tropical Forest Soil | CLENPPDTVGQPPSTEIGVPNMASLKAKKLRKLLQEKVLLEL* |
| Ga0126382_123326241 | 3300010047 | Tropical Forest Soil | GTDTVGQPPNSEIGVPDLPSWKAKKLSKLSREKVLLEL* |
| Ga0126382_125197132 | 3300010047 | Tropical Forest Soil | DTVGEPPSAEIGVSHMPSLKAKTLGKLTQEKVLLEL* |
| Ga0126321_10710323 | 3300010145 | Soil | DTVGELKSAEICVSHVPSWKAKKRGNLTQEEVLLEP* |
| Ga0126321_10748321 | 3300010145 | Soil | RDTVGELKSAEIYVSHVPSLKAKKLRKLPQEKLLLEL* |
| Ga0134082_105429611 | 3300010303 | Grasslands Soil | LSQKRGDTVGQPPRAEIWVSNMPSLKAKKLRKLPQEKVLIEL* |
| Ga0134084_101955232 | 3300010322 | Grasslands Soil | FRWCLTKPPDTVGEFKSAEIGASHMLSWKAKKLGELTQEKVLLEL* |
| Ga0126370_114530531 | 3300010358 | Tropical Forest Soil | STEFSACLVKGPDTVGEPPSAEICASHMPSWKAKKLGKLAQEKVLLEP* |
| Ga0126376_107187732 | 3300010359 | Tropical Forest Soil | MSITNPPDTVGQPPGIEIDVPDMPSLKAKKLSKLPREKVLL |
| Ga0126376_130138381 | 3300010359 | Tropical Forest Soil | RKRGSVKKRADTVGQPPSAEIGVLNMPALKAKKLRKPSQEKYF* |
| Ga0126378_130923541 | 3300010361 | Tropical Forest Soil | HPYGLTNFGQEPTDTVGEPPSAENGASHMPSWKAKKRGKLTQEKVLLEL* |
| Ga0126377_107242071 | 3300010362 | Tropical Forest Soil | DLQLCLANPPDTVGEPKSAEVCLSHMPSLKAKKLGKLSREKVLLEL* |
| Ga0126377_108698131 | 3300010362 | Tropical Forest Soil | DPADVSKNGGDTVGELKSAEICVPYMPSWKTNKLGKLAQEKVLLEP* |
| Ga0126377_125159051 | 3300010362 | Tropical Forest Soil | RPDTVGELRSAEICVSHMPSWKAKKLGELPQEKALLEL* |
| Ga0126377_129885402 | 3300010362 | Tropical Forest Soil | TVGQPPSAEICVYNMPSLEVKKLRKLAQEKVLLEL* |
| Ga0126377_133294792 | 3300010362 | Tropical Forest Soil | GQTPDTVGHPPSTEIGVPNMPSLKAKKLNKLPQEKVLLEL* |
| Ga0126379_117005532 | 3300010366 | Tropical Forest Soil | QKGWDTVGQPPSTEIGVLNMPSLKAKKLRKPPQEKVLLEL* |
| Ga0126379_131940491 | 3300010366 | Tropical Forest Soil | VGEPPGAEICVSHMPSRKAKKLGKLPQEKVLLEL* |
| Ga0126379_137264192 | 3300010366 | Tropical Forest Soil | DTVGEFKSAEMCVSHMPALKAKKRGKLAQEKVLLEL* |
| Ga0126383_119189023 | 3300010398 | Tropical Forest Soil | VGQPPGIEIDVPDMPSLKAKKLSKLPREKVLLER* |
| Ga0126383_120338871 | 3300010398 | Tropical Forest Soil | KLLCLENPPDTVGELKSAEICVPHMPSLKAKKLGKLSREKVLLEL* |
| Ga0126383_127627181 | 3300010398 | Tropical Forest Soil | NRPDTVGELKSAKICVSHMPSLKAKKLGKLTREKVLLEL* |
| Ga0137391_101049854 | 3300011270 | Vadose Zone Soil | DIVGELKGAEMCVSHMPSWKAEKLGKRTQEKVLLEL* |
| Ga0137399_108244621 | 3300012203 | Vadose Zone Soil | FVKRPDTVGQPPDAETCVSDTPFLKAKKLRKLPQEKVLLEL* |
| Ga0150985_1088879861 | 3300012212 | Avena Fatua Rhizosphere | EKGTDTVGELKSAEICVPHMPSLKAKQLGKLSREKVLLEL* |
| Ga0137387_111280921 | 3300012349 | Vadose Zone Soil | DTVGQPPSTEIGVPNMPSLKAKKLRKLPREKVLLEL* |
| Ga0137371_103553861 | 3300012356 | Vadose Zone Soil | DTVGQPPSTEIGVLNMPSLKAKKLRKLPRDKVLLEL* |
| Ga0137385_104545182 | 3300012359 | Vadose Zone Soil | PDTVGELKSAEVCGSYKPSLKAKKLGKLTQEKEVLER* |
| Ga0137360_101650641 | 3300012361 | Vadose Zone Soil | LQKPTDTVGELKSAEICVSYMPSLKAKKLGALTQEKVLLEL* |
| Ga0137390_116384782 | 3300012363 | Vadose Zone Soil | DTVGELKSAEMGVPPMPSLKAKKLGKLMRQRVLLEL* |
| Ga0150984_1061556113 | 3300012469 | Avena Fatua Rhizosphere | VITVSNRRDTVGELKSAEICVSHMPSWKAKKLEKLTQEKVLLEL* |
| Ga0157324_10522491 | 3300012506 | Arabidopsis Rhizosphere | PDTVGESPRADICVSNMPSWKARKLGKLPQEKVLLEL* |
| Ga0137394_108026281 | 3300012922 | Vadose Zone Soil | DTVGELRSSAICVSYMPSLKAKKLEKLTQEKTVLAR* |
| Ga0137407_121083741 | 3300012930 | Vadose Zone Soil | GSDTVGELKSAEICVSHMPSWKAKKLGKLAQEKVLLEL* |
| Ga0126369_111275593 | 3300012971 | Tropical Forest Soil | DTVDQPPSAEIGVLNMPSLQAKKLRKPSPEKVLLEL* |
| Ga0126369_125141342 | 3300012971 | Tropical Forest Soil | DTVGQPLSTEIGVPNMPSLKAKKLNKLPREKVLLEL* |
| Ga0126369_135839461 | 3300012971 | Tropical Forest Soil | IRPDTVGQPPSTEIGVPNMPSLKAKKLRELPQDKVLLEL* |
| Ga0163162_105361022 | 3300013306 | Switchgrass Rhizosphere | DTVGELRTAEFCVSYMPSLKAKKLEKLTQEKAVLER* |
| Ga0163162_123129051 | 3300013306 | Switchgrass Rhizosphere | DTVGESPSAEIGVSHMPSLKAKKLGKLTQEKVLLEL* |
| Ga0132256_1021645701 | 3300015372 | Arabidopsis Rhizosphere | PDTVGQPPIAEIGVPHMPSLKAKKLGKLSRENVLLEL* |
| Ga0132257_1003362553 | 3300015373 | Arabidopsis Rhizosphere | TDTVGEPPGTEIRVSHMPSWKAKKLGKLPQEKKYF* |
| Ga0132257_1041523001 | 3300015373 | Arabidopsis Rhizosphere | PDTVGQPPGAAICVSNLPALKAKKLGKLPQEKVLLGL* |
| Ga0182032_105523551 | 3300016357 | Soil | KNPPDTVGEFKSAEMGVPHMPAWKAKTLGKLTQEKVLLEP |
| Ga0182040_106537971 | 3300016387 | Soil | KPPDTVGHPSSAESGVLNMPSWKAQKLGKLPQEKGRLEL |
| Ga0182039_107790071 | 3300016422 | Soil | PDTVGELKSAAICVSHMPSLKAKKLRKLSQEKVRLEL |
| Ga0182038_109076501 | 3300016445 | Soil | LILCLENPPDTVGQPPSTALGVPNMPSWQAKQLRKLPREKVLLEL |
| Ga0182038_120256722 | 3300016445 | Soil | WVTVGEPQSADMCVSHMPALKAKKRGIRALEKVLLEP |
| Ga0184609_102554712 | 3300018076 | Groundwater Sediment | LIKGMDTVSELKSAEIYVSHLPSWKAKKLGKLTQEKVLLEL |
| Ga0066667_113001391 | 3300018433 | Grasslands Soil | SLQKRPDTVGELRTAEVCVSYMPSLKAKKLAKLTQEKAVLER |
| Ga0066662_125520832 | 3300018468 | Grasslands Soil | DTVGEPPSAEICVSHMPSWKAKKLGKLPQEKVLLEL |
| Ga0173481_104626691 | 3300019356 | Soil | LYRKRADTVGQPPSAEICVSNMPSLKAKKLRKLPQEKVLLEL |
| Ga0210378_102337892 | 3300021073 | Groundwater Sediment | PPDTVGELKSAEICVSHMPSLKAKKLGKLTQEKVLLEP |
| Ga0222625_16824863 | 3300022195 | Groundwater Sediment | SDTVGELKSAEICVSYIPSLKAKKLEKLTQGKVVLKR |
| Ga0257166_10018961 | 3300026358 | Soil | MSQKPPDTVGELTSAEMDVPHIPSLKAKKLGKLVQGK |
| Ga0209874_11319691 | 3300027577 | Groundwater Sand | KHWDTVGELKSAEMCVSHMSSWKAKKLGKLTQEKVLLVL |
| Ga0209814_100659292 | 3300027873 | Populus Rhizosphere | MTGESLSLTKRLDTVGQPPGTKIGVPNMPSLKAKKLRKLPREKVLLEL |
| Ga0209481_103828371 | 3300027880 | Populus Rhizosphere | PGDTVGQPPSTEIGVLNMSAWKAKKLRKLPQEKVLLEL |
| Ga0209488_100357521 | 3300027903 | Vadose Zone Soil | DTVGELKSAEICVSYIPSLKAKKLEKLTQGKVVLKR |
| Ga0209488_107193761 | 3300027903 | Vadose Zone Soil | FICLEKPGDTVGQPPSIEIGVLNIPSLKAKKLRKLPQDKVLLEL |
| Ga0207428_101558471 | 3300027907 | Populus Rhizosphere | PDTVGQPPSTEMGVLNMPSLKAKKLRKLLQEKVLLEL |
| Ga0207428_108819971 | 3300027907 | Populus Rhizosphere | GLTNSIRPDTVGEPPSAEMGVSHMPSLKAKTLGKLTQEKVLLEL |
| Ga0209382_108711751 | 3300027909 | Populus Rhizosphere | SKKRADTVGEPPSTEIGVPNMPSLKAKKLGKLPREKVLLEL |
| Ga0247819_106127482 | 3300028608 | Soil | PDTVGQPPSTEIGVPNMPSLKAKKLNKLPREKVLLER |
| Ga0308187_100107824 | 3300031114 | Soil | LEIFPDTVGELRRAEVCVSCMPSLKAKKLEKLTQGKVVLKR |
| Ga0318576_100453795 | 3300031796 | Soil | LKTLPDTVGEPRSAETCVSHMPSWKQKSLKPTQKEVVLERLK |
| Ga0307409_1000193474 | 3300031995 | Rhizosphere | IVNRKRADTVGELKSAEIYVSDMPSLKAKKLGKRPQEKVLLER |
| Ga0307416_1002361033 | 3300032002 | Rhizosphere | VRHVLQEDTVGEPPSTEVSVPNMLPLKAKKLRKRPQEKVLLEL |
| Ga0247830_103358951 | 3300033551 | Soil | MYTKRADTVGQPPSTEIGVPNMPSLKAKKLSKLPREK |
| ⦗Top⦘ |