


| Basic Information | |
|---|---|
| Family ID | F039531 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 163 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MTLDLTINEINIILQALGNAPYAQVFELVEKIRTQAQAQVQPAPTPEETH |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 163 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.27 % |
| % of genes near scaffold ends (potentially truncated) | 44.79 % |
| % of genes from short scaffolds (< 2000 bps) | 78.53 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.350 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (20.245 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.393 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (63.190 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.90% β-sheet: 0.00% Coil/Unstructured: 64.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 163 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 38.65 |
| PF07484 | Collar | 1.23 |
| PF13392 | HNH_3 | 1.23 |
| PF09374 | PG_binding_3 | 1.23 |
| PF13529 | Peptidase_C39_2 | 0.61 |
| PF01381 | HTH_3 | 0.61 |
| PF02311 | AraC_binding | 0.61 |
| PF01391 | Collagen | 0.61 |
| PF01264 | Chorismate_synt | 0.61 |
| PF00733 | Asn_synthase | 0.61 |
| PF02867 | Ribonuc_red_lgC | 0.61 |
| PF11351 | GTA_holin_3TM | 0.61 |
| PF05838 | Glyco_hydro_108 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 163 Family Scaffolds |
|---|---|---|---|
| COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 0.61 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.61 |
| COG3926 | Lysozyme family protein | General function prediction only [R] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.05 % |
| Unclassified | root | N/A | 15.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000176|TB03JUN2009E_c004313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3028 | Open in IMG/M |
| 3300000176|TB03JUN2009E_c009462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1787 | Open in IMG/M |
| 3300000203|TB18AUG2009E_c001669 | All Organisms → cellular organisms → Bacteria | 3733 | Open in IMG/M |
| 3300002091|JGI24028J26656_1001065 | All Organisms → cellular organisms → Bacteria | 6690 | Open in IMG/M |
| 3300002091|JGI24028J26656_1004794 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
| 3300002091|JGI24028J26656_1010032 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300002091|JGI24028J26656_1014355 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300002091|JGI24028J26656_1017642 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300002307|JGI24890J29729_1052620 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300002835|B570J40625_100070233 | All Organisms → cellular organisms → Bacteria | 4656 | Open in IMG/M |
| 3300002835|B570J40625_100425461 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300003375|JGI26470J50227_1010521 | All Organisms → cellular organisms → Bacteria | 2313 | Open in IMG/M |
| 3300003375|JGI26470J50227_1020309 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300003375|JGI26470J50227_1020405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 1464 | Open in IMG/M |
| 3300003375|JGI26470J50227_1020452 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300003375|JGI26470J50227_1022601 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300003375|JGI26470J50227_1028726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1127 | Open in IMG/M |
| 3300003375|JGI26470J50227_1052045 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300003787|Ga0007811_1006467 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300003798|Ga0007842_1001177 | All Organisms → Viruses → Predicted Viral | 2328 | Open in IMG/M |
| 3300003812|Ga0007861_1008442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 969 | Open in IMG/M |
| 3300003852|Ga0031655_10134870 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300003852|Ga0031655_10160079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 871 | Open in IMG/M |
| 3300003852|Ga0031655_10177289 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300004240|Ga0007787_10070714 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300004460|Ga0066222_1276225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 946 | Open in IMG/M |
| 3300004691|Ga0065176_1012900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 778 | Open in IMG/M |
| 3300004694|Ga0065170_1047328 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300004770|Ga0007804_1095885 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300004773|Ga0007795_10067270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 1078 | Open in IMG/M |
| 3300004774|Ga0007794_10167680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 656 | Open in IMG/M |
| 3300004792|Ga0007761_11174088 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300004793|Ga0007760_11430574 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300004805|Ga0007792_10242370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 554 | Open in IMG/M |
| 3300004807|Ga0007809_10074708 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300004807|Ga0007809_10076228 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300004807|Ga0007809_10167674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 642 | Open in IMG/M |
| 3300005805|Ga0079957_1000579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 32798 | Open in IMG/M |
| 3300005805|Ga0079957_1004983 | All Organisms → cellular organisms → Bacteria | 10928 | Open in IMG/M |
| 3300006071|Ga0007876_1096685 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300006114|Ga0007815_1026786 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300006118|Ga0007859_1097564 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006119|Ga0007866_1053063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
| 3300006802|Ga0070749_10321080 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300006802|Ga0070749_10696160 | Not Available | 543 | Open in IMG/M |
| 3300008055|Ga0108970_10857631 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300008113|Ga0114346_1025658 | All Organisms → cellular organisms → Bacteria | 3128 | Open in IMG/M |
| 3300008266|Ga0114363_1020359 | All Organisms → cellular organisms → Bacteria | 3177 | Open in IMG/M |
| 3300008266|Ga0114363_1063338 | Not Available | 1429 | Open in IMG/M |
| 3300008448|Ga0114876_1247537 | Not Available | 556 | Open in IMG/M |
| 3300008448|Ga0114876_1254806 | Not Available | 540 | Open in IMG/M |
| 3300009225|Ga0103851_1000044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10653 | Open in IMG/M |
| 3300009235|Ga0103857_10083776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300009502|Ga0114951_10511480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300010230|Ga0136236_1031510 | Not Available | 696 | Open in IMG/M |
| 3300010354|Ga0129333_10169757 | Not Available | 1995 | Open in IMG/M |
| 3300010354|Ga0129333_10185871 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
| 3300010354|Ga0129333_10264348 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
| 3300010354|Ga0129333_10505443 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300010354|Ga0129333_10888832 | Not Available | 754 | Open in IMG/M |
| 3300010354|Ga0129333_11141173 | Not Available | 649 | Open in IMG/M |
| 3300010370|Ga0129336_10081860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1904 | Open in IMG/M |
| 3300010370|Ga0129336_10341498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Nilusvirus → Nilusvirus ssm2 | 825 | Open in IMG/M |
| 3300010370|Ga0129336_10627321 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300011268|Ga0151620_1032846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1760 | Open in IMG/M |
| 3300013093|Ga0164296_1145673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 948 | Open in IMG/M |
| 3300013093|Ga0164296_1251602 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300013093|Ga0164296_1266073 | Not Available | 647 | Open in IMG/M |
| 3300013093|Ga0164296_1327766 | Not Available | 571 | Open in IMG/M |
| 3300013093|Ga0164296_1330445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 568 | Open in IMG/M |
| 3300013093|Ga0164296_1347387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 552 | Open in IMG/M |
| 3300013094|Ga0164297_10083120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1402 | Open in IMG/M |
| 3300013094|Ga0164297_10123172 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
| 3300017722|Ga0181347_1069345 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300017747|Ga0181352_1015817 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2383 | Open in IMG/M |
| 3300017754|Ga0181344_1084752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300017761|Ga0181356_1163074 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300017766|Ga0181343_1186239 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300017774|Ga0181358_1288213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300017777|Ga0181357_1087716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1187 | Open in IMG/M |
| 3300017777|Ga0181357_1178087 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300017778|Ga0181349_1155443 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300017780|Ga0181346_1132156 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300019783|Ga0181361_112532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
| 3300019784|Ga0181359_1000859 | All Organisms → cellular organisms → Bacteria | 7437 | Open in IMG/M |
| 3300019784|Ga0181359_1223187 | Not Available | 591 | Open in IMG/M |
| 3300020151|Ga0211736_10925520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11673 | Open in IMG/M |
| 3300020530|Ga0208235_1017800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 879 | Open in IMG/M |
| 3300020578|Ga0194129_10585181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 527 | Open in IMG/M |
| 3300020686|Ga0214194_106184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1111 | Open in IMG/M |
| 3300020707|Ga0214238_1035020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 554 | Open in IMG/M |
| 3300020710|Ga0214198_1000719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6382 | Open in IMG/M |
| 3300020727|Ga0214246_1033944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 804 | Open in IMG/M |
| 3300020735|Ga0214219_1042642 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300021122|Ga0214195_1002430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2428 | Open in IMG/M |
| 3300021131|Ga0214206_1000663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8988 | Open in IMG/M |
| 3300021133|Ga0214175_1005198 | Not Available | 2168 | Open in IMG/M |
| 3300021137|Ga0214165_1079313 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300021138|Ga0214164_1011955 | Not Available | 2902 | Open in IMG/M |
| 3300021139|Ga0214166_1029829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 1299 | Open in IMG/M |
| 3300021961|Ga0222714_10195387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1173 | Open in IMG/M |
| 3300022190|Ga0181354_1000749 | All Organisms → cellular organisms → Bacteria | 6203 | Open in IMG/M |
| 3300022190|Ga0181354_1052098 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300022602|Ga0248169_100782 | Not Available | 48039 | Open in IMG/M |
| 3300022752|Ga0214917_10252519 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300023179|Ga0214923_10200697 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300024289|Ga0255147_1000111 | Not Available | 34315 | Open in IMG/M |
| 3300024306|Ga0255148_1079949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300024561|Ga0255288_1128649 | Not Available | 564 | Open in IMG/M |
| 3300024570|Ga0255276_1019321 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1824 | Open in IMG/M |
| 3300024864|Ga0255271_1024492 | Not Available | 1308 | Open in IMG/M |
| 3300024867|Ga0255267_1031635 | Not Available | 1228 | Open in IMG/M |
| 3300025339|Ga0208502_1001835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 1882 | Open in IMG/M |
| 3300025357|Ga0208383_1000729 | All Organisms → cellular organisms → Bacteria | 5570 | Open in IMG/M |
| 3300025357|Ga0208383_1006666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 1531 | Open in IMG/M |
| 3300025429|Ga0208500_1001113 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → Opitutus terrae | 6340 | Open in IMG/M |
| 3300025532|Ga0208249_1096157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 673 | Open in IMG/M |
| 3300025598|Ga0208379_1002049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7443 | Open in IMG/M |
| 3300025598|Ga0208379_1089576 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → Zavarzinella formosa | 745 | Open in IMG/M |
| 3300025778|Ga0208388_1031545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300025778|Ga0208388_1051422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 584 | Open in IMG/M |
| 3300025779|Ga0208869_1045832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 503 | Open in IMG/M |
| 3300027597|Ga0255088_1097826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300027896|Ga0209777_10381510 | Not Available | 1065 | Open in IMG/M |
| 3300027896|Ga0209777_10641217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300027896|Ga0209777_10851185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300027896|Ga0209777_10875062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300027896|Ga0209777_10904333 | Not Available | 611 | Open in IMG/M |
| 3300027902|Ga0209048_10748521 | Not Available | 640 | Open in IMG/M |
| 3300031673|Ga0307377_10847513 | Not Available | 628 | Open in IMG/M |
| 3300031758|Ga0315907_10649779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 810 | Open in IMG/M |
| 3300031784|Ga0315899_10105518 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2898 | Open in IMG/M |
| 3300031787|Ga0315900_10323190 | All Organisms → Viruses → Predicted Viral | 1263 | Open in IMG/M |
| 3300031787|Ga0315900_10602393 | Not Available | 803 | Open in IMG/M |
| 3300031857|Ga0315909_10984136 | Not Available | 511 | Open in IMG/M |
| 3300031884|Ga0316220_1044314 | All Organisms → Viruses → Predicted Viral | 1870 | Open in IMG/M |
| 3300031884|Ga0316220_1072206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1355 | Open in IMG/M |
| 3300032093|Ga0315902_10149105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2437 | Open in IMG/M |
| 3300032093|Ga0315902_10522572 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
| 3300032560|Ga0316223_1153561 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300032560|Ga0316223_1228399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium | 584 | Open in IMG/M |
| 3300032605|Ga0316232_1015783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4630 | Open in IMG/M |
| 3300032605|Ga0316232_1265226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300032605|Ga0316232_1359589 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300032722|Ga0316231_1068111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1853 | Open in IMG/M |
| 3300032722|Ga0316231_1145510 | Not Available | 1089 | Open in IMG/M |
| 3300032753|Ga0316224_1107366 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
| 3300033816|Ga0334980_0108157 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300033993|Ga0334994_0020004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4459 | Open in IMG/M |
| 3300033993|Ga0334994_0045112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2779 | Open in IMG/M |
| 3300033993|Ga0334994_0381141 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300034061|Ga0334987_0001694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21162 | Open in IMG/M |
| 3300034061|Ga0334987_0011830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8090 | Open in IMG/M |
| 3300034062|Ga0334995_0016594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6693 | Open in IMG/M |
| 3300034062|Ga0334995_0203747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1372 | Open in IMG/M |
| 3300034101|Ga0335027_0610852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300034101|Ga0335027_0677899 | Not Available | 615 | Open in IMG/M |
| 3300034101|Ga0335027_0685603 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300034102|Ga0335029_0017924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5413 | Open in IMG/M |
| 3300034102|Ga0335029_0111849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1913 | Open in IMG/M |
| 3300034104|Ga0335031_0259468 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300034283|Ga0335007_0134352 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300034283|Ga0335007_0312493 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 20.25% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.56% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.04% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 8.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 7.98% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 5.52% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.29% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 4.29% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 3.68% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.84% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.84% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.23% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.23% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.23% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.23% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.23% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.61% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.61% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
| 3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
| 3300003798 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 | Environmental | Open in IMG/M |
| 3300003812 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004691 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul07 (version 2) | Environmental | Open in IMG/M |
| 3300004694 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2) | Environmental | Open in IMG/M |
| 3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
| 3300004773 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
| 3300006114 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 | Environmental | Open in IMG/M |
| 3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
| 3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009225 | Microbial communities of water from Amazon river, Brazil - RCM4 | Environmental | Open in IMG/M |
| 3300009235 | Microbial communities of water from Amazon river, Brazil - RCM10 | Environmental | Open in IMG/M |
| 3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
| 3300010230 | Filterable freshwater microbial communities from Conwy River, North Wales, UK. Not filtered control. After WGA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
| 3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300020686 | Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300020707 | Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 hypolimnion | Environmental | Open in IMG/M |
| 3300020710 | Freshwater microbial communities from Trout Bog Lake, WI - 20SEP2008 epilimnion | Environmental | Open in IMG/M |
| 3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
| 3300020735 | Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300021122 | Freshwater microbial communities from Trout Bog Lake, WI - 19AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
| 3300021133 | Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 epilimnion | Environmental | Open in IMG/M |
| 3300021137 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
| 3300021138 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
| 3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024561 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024864 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024867 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025339 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025429 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025532 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA1M (SPAdes) | Environmental | Open in IMG/M |
| 3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
| 3300025779 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027597 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031884 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032560 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009 | Environmental | Open in IMG/M |
| 3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
| 3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
| 3300032753 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18013 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB03JUN2009E_0043135 | 3300000176 | Freshwater | MTLDLNINDINLILQALGNAPYAQVFELVQKIREQAQVQVQPIPTPEETH* |
| TB03JUN2009E_0094621 | 3300000176 | Freshwater | NINDINLILQALGNAPYAQVFELVQKIREQAQAQVQPIPTPEETH* |
| TB18AUG2009E_0016692 | 3300000203 | Freshwater | MTLDLTINEINIILQALGNAPYDSVAEVIEKIRTQAQAQLQPAPTPEETH* |
| JGI24028J26656_10010658 | 3300002091 | Lentic | MTLDLTINEINLILQALGAPYAQVFELIEKIRTQAQAQVQPAPTPEETH* |
| JGI24028J26656_10047943 | 3300002091 | Lentic | MTLDLTINEINIILQALGNAPYASVFELIEKIRTQAQAQVQPTPTPEETH* |
| JGI24028J26656_10100321 | 3300002091 | Lentic | MTLDLTINEINIILQALGNAPYASVFELIEKIRTQAQAQVQPTPTPEE |
| JGI24028J26656_10143552 | 3300002091 | Lentic | MTIDLTINEINIIPQSLGNAPYAQVFELIEKIRTQAQAQVQPAPTPEETH* |
| JGI24028J26656_10176422 | 3300002091 | Lentic | MTLDLTINEINIILQALGNAPYASVFELIEKIRTQAQAQVQPAPTPEETH* |
| JGI24890J29729_10526201 | 3300002307 | Lentic | MTLDLTVNEINIILQALGNAPYASVFELIEKIRTQAQAQV |
| B570J40625_1000702333 | 3300002835 | Freshwater | MKLELTINEINMILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQANG* |
| B570J40625_1004254611 | 3300002835 | Freshwater | MKLELTINDVNTILQALGNAPYAQVFELVEKIRTQAQAQVQSTEQQNG* |
| JGI26470J50227_10105211 | 3300003375 | Freshwater | MTLDLTINEVNLILQALGNAPYAQVFELIEKIRTQAQAQVQPAPIPEETH* |
| JGI26470J50227_10203095 | 3300003375 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIDKIRTQAQAQVQPIPTPEETH* |
| JGI26470J50227_10204052 | 3300003375 | Freshwater | MTLDLTINEVNLILQTLGNAPYAQVFELVQKIRDQAQSQIQPAPTPEETH* |
| JGI26470J50227_10204522 | 3300003375 | Freshwater | MTLDLNINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH* |
| JGI26470J50227_10226012 | 3300003375 | Freshwater | MTLDLTINEINIILQALGNAPYAQVFELVEKIRTQAQAQVQPAPTPEETH* |
| JGI26470J50227_10287262 | 3300003375 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEE |
| JGI26470J50227_10520452 | 3300003375 | Freshwater | MTLNLNINEINIILQALGNAPYVSVAEVIDKIRTQAQAQVQPAPTPEETH* |
| Ga0007811_10064672 | 3300003787 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH* |
| Ga0007842_10011771 | 3300003798 | Freshwater | TINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH* |
| Ga0007861_10084423 | 3300003812 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEXIRTQAQAQVQPAPTPEETH* |
| Ga0031655_101348701 | 3300003852 | Freshwater Lake Sediment | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPT |
| Ga0031655_101600793 | 3300003852 | Freshwater Lake Sediment | RGRTMTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH* |
| Ga0031655_101772892 | 3300003852 | Freshwater Lake Sediment | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQV |
| Ga0007787_100707142 | 3300004240 | Freshwater Lake | MKLELTINEINMILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQQNG* |
| Ga0066222_12762253 | 3300004460 | Marine | GRTMTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH* |
| Ga0065176_10129003 | 3300004691 | Freshwater | EINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH* |
| Ga0065170_10473281 | 3300004694 | Freshwater | MKFDLTINEINIILQALGNAPYAQVFELIEKIRTQAQAQVQPAPTPEE |
| Ga0007804_10958852 | 3300004770 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTSEETH* |
| Ga0007795_100672702 | 3300004773 | Freshwater | MTLDLTINEINIILQALGNAPYAQVFELIEKIRTQAQAQVQPAPTPEETH* |
| Ga0007794_101676803 | 3300004774 | Freshwater | NIILQALGNAPYVSVAEVIEKIRTQAQAQVQPTPAPEETH* |
| Ga0007761_111740882 | 3300004792 | Freshwater Lake | MKLELTINEINMILQALGNAPYAQVFELVEKIRTQAQTQVQTTEIENE* |
| Ga0007760_114305743 | 3300004793 | Freshwater Lake | MKLELTINEVNMILQALGNSPYAQVFELVEKIRTQAQAQVQSTEIENE* |
| Ga0007792_102423702 | 3300004805 | Freshwater | MTLDLTINEVNLILQALGNAPYAQVFELVQKIRDQAQSQIQPAPTPEETH* |
| Ga0007809_100747081 | 3300004807 | Freshwater | RLEHKMTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH* |
| Ga0007809_100762282 | 3300004807 | Freshwater | MKFDLTINEINIILQALGNAPYAQVFELIEKIRTQAQAQVQPAPTPEETH* |
| Ga0007809_101676743 | 3300004807 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQLQPAPTPEETH* |
| Ga0079957_100057920 | 3300005805 | Lake | MKLELTINDVNMILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQANG* |
| Ga0079957_10049832 | 3300005805 | Lake | MKLDLTINDVNMILQALGNAPYAQVFELVEKIRTQAQAQEAK* |
| Ga0007876_10966853 | 3300006071 | Freshwater | SKNYPQKSPPLKRRLEHKMTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTSEETH* |
| Ga0007815_10267861 | 3300006114 | Freshwater | KPSIRGRTMTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH* |
| Ga0007859_10975641 | 3300006118 | Freshwater | LTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH* |
| Ga0007866_10530632 | 3300006119 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQLQP |
| Ga0070749_103210801 | 3300006802 | Aqueous | DKMTLDLTINEVNLILQALGNAPYAQVFELVQKIRDQAQSQIQPAPTPEETH* |
| Ga0070749_106961602 | 3300006802 | Aqueous | MINLQLDINEVNTILQALGNAPYAQVASVVDKIRNQAAPQVQQQEGQNTEEK* |
| Ga0108970_108576311 | 3300008055 | Estuary | MKLELTINEVNMILQALGNAPYAQVFELVEKIRTQAQ |
| Ga0114346_10256583 | 3300008113 | Freshwater, Plankton | MKLDLTINDVNVILQALGNAPYAQVFELVEKIRTQAQPQVQTTEQQNG* |
| Ga0114363_10203594 | 3300008266 | Freshwater, Plankton | MKLDLTINDVNVILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQQNG* |
| Ga0114363_10633382 | 3300008266 | Freshwater, Plankton | MKLELTINDVNMILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQQNG* |
| Ga0114876_12475371 | 3300008448 | Freshwater Lake | MKLELTINDVNMILQALGNAPYAQVFELVEKIRTQAQAQVQTTE |
| Ga0114876_12548061 | 3300008448 | Freshwater Lake | LQALGNAPYAQVFELVEKIRTQAQAQVQTTEQQNG* |
| Ga0103851_100004411 | 3300009225 | River Water | MKLDLTINEINLIMQALGAAPYSQVFELVQKIREQAQAQVTQKEEANV* |
| Ga0103857_100837762 | 3300009235 | River Water | MNLELTFNEINTVMQALGNAPYAQVFELVQKIREQAQAQMAAPTEGQTNG* |
| Ga0114951_105114802 | 3300009502 | Freshwater | MTLDLTINEINIILQALGNAPYASVFELIEKIRTQAQA* |
| Ga0136236_10315102 | 3300010230 | Freshwater | MTLDLTINEINIILQALGNAPYASVFELIENIRTQAQAQVQ |
| Ga0129333_101697572 | 3300010354 | Freshwater To Marine Saline Gradient | MKLELTINEINVILQALGNAPYAQVFELVEKICTQAQSQIQPAPTPEETH* |
| Ga0129333_101858712 | 3300010354 | Freshwater To Marine Saline Gradient | MKLELTINDVNMILQALGNAPYAQVFELVEKIRTQAQAQVQSTEQQNG* |
| Ga0129333_102643484 | 3300010354 | Freshwater To Marine Saline Gradient | MTLDLTINEVNLILQALGNAPYAQVFELVQKIRDQAQSQIQPAPTSEETH* |
| Ga0129333_105054433 | 3300010354 | Freshwater To Marine Saline Gradient | MKLELTINDVNMILQALGNAPYAQVFELVEKIRAQAQAQVQTTEQQNG* |
| Ga0129333_108888321 | 3300010354 | Freshwater To Marine Saline Gradient | VILQALGNAPYAQVFELVEKICTQAQSQIQTAPTPEETH* |
| Ga0129333_111411732 | 3300010354 | Freshwater To Marine Saline Gradient | MKLELTINEINMILQALGNAPYAQVFELVEKIRTQAQAQVQSAETENG* |
| Ga0129336_100818602 | 3300010370 | Freshwater To Marine Saline Gradient | MKLELTINEINMILQALGNAPYAQVFELVEKIRAQAQAQVQTTEQQNG* |
| Ga0129336_103414983 | 3300010370 | Freshwater To Marine Saline Gradient | MTLDLTINEVNLILQALGNAPYASVFELVQKIREQAQSQIQPAPTPEETH* |
| Ga0129336_106273212 | 3300010370 | Freshwater To Marine Saline Gradient | MTLDLTINEVNLILQALGNAPYASVFELVQKIRDQAQSQIQPAPTPEETH* |
| Ga0151620_10328463 | 3300011268 | Freshwater | MKLDLTINEINIILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQENG* |
| Ga0164296_11456732 | 3300013093 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPIPEETH* |
| Ga0164296_12516022 | 3300013093 | Freshwater | MTLDLTINEINIILQALGNAPYASVFELIEKVRNQAQAQVQPAPNPEETH* |
| Ga0164296_12660731 | 3300013093 | Freshwater | MKLDLTIQEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPT |
| Ga0164296_13277662 | 3300013093 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQLQPAPTPEE |
| Ga0164296_13304451 | 3300013093 | Freshwater | LDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQTAPTPEETH* |
| Ga0164296_13473873 | 3300013093 | Freshwater | LTIQEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTSEETH* |
| Ga0164297_100831202 | 3300013094 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQTAPTPEETH* |
| Ga0164297_101231721 | 3300013094 | Freshwater | MTLDLTINEVNLILQTLGNAPYAQVFELVQKIRDQAQSQIQPAPT |
| Ga0181347_10693452 | 3300017722 | Freshwater Lake | MKLELTINEINLILQALGNAPYAQVFELVEKIRTQAQAQAQSTETENG |
| Ga0181352_10158175 | 3300017747 | Freshwater Lake | MKLELTINEINMILQALGNAPYAQVFELVEKIRTQAQAQVQ |
| Ga0181344_10847523 | 3300017754 | Freshwater Lake | MKIELTINEVNMILQALGNAPYAQVFELVEKIRTQAQAQ |
| Ga0181356_11630743 | 3300017761 | Freshwater Lake | MKLELTINEINLILQALGNAPYAQVFELVEKIRTQAQAQAQSTEIENG |
| Ga0181343_11862391 | 3300017766 | Freshwater Lake | MKLELTINDVNMILQALGNAPYAQVFELVEKIRTQAQAQVQT |
| Ga0181358_12882131 | 3300017774 | Freshwater Lake | MKLELTINEINVILQALGNAPYAQVFELVEKIRTQAQAQAQSTETENG |
| Ga0181357_10877162 | 3300017777 | Freshwater Lake | MKLELTINEVNMILQALGNAPYAQVFELVEKIRTQAQAQVQSTEQANG |
| Ga0181357_11780872 | 3300017777 | Freshwater Lake | MKLELTINEINMILQALGNAPYAQVFELVEKIRTQAQAQAQSTEIENG |
| Ga0181349_11554432 | 3300017778 | Freshwater Lake | MKLELTINDVNMILQALGNAPYAQVFELVEKIRTQAQAQVQSTEQANG |
| Ga0181346_11321562 | 3300017780 | Freshwater Lake | MKLELTINEVNMILQALGNAPYAQVFELVEKIRTQAQAQVQSTEQ |
| Ga0181361_1125322 | 3300019783 | Freshwater Lake | MKLELTINEINMILQALGNAPYAQVFELVEKIRTQAQAQAQSTETENG |
| Ga0181359_10008594 | 3300019784 | Freshwater Lake | MKLELTINEINMILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQQNG |
| Ga0181359_12231872 | 3300019784 | Freshwater Lake | MKLELTINEINMILQALGNAPYAQVFELVEKIRTQAQTQVQTTEIENE |
| Ga0211736_1092552014 | 3300020151 | Freshwater | MKLELTINDVNVILQALGNAPYAQVFELVEKIRTQAQAQVQTTETESG |
| Ga0208235_10178002 | 3300020530 | Freshwater | MKLELTINEINMILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQANG |
| Ga0194129_105851812 | 3300020578 | Freshwater Lake | MRGNMKLELSVNEINAIMAALGQMPYAQVFELVEKI |
| Ga0214194_1061843 | 3300020686 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH |
| Ga0214238_10350202 | 3300020707 | Freshwater | IRGHTMTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH |
| Ga0214198_10007199 | 3300020710 | Freshwater | MTLNLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH |
| Ga0214246_10339441 | 3300020727 | Freshwater | NINDINLILQALGNAPYAQVFELVQKIREQAQVQVQPIPTPEETH |
| Ga0214219_10426422 | 3300020735 | Freshwater | MTLDLTINEVNLILQTLGNAPYAQVFELVQKIRDQAQSQIQPAPTPEETH |
| Ga0214195_10024301 | 3300021122 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQ |
| Ga0214206_100066310 | 3300021131 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPIPEETH |
| Ga0214175_10051985 | 3300021133 | Freshwater | MKLDLTIQEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH |
| Ga0214165_10793131 | 3300021137 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPE |
| Ga0214164_10119556 | 3300021138 | Freshwater | NINDINLILQALGNAPYAQVFELVQKIREQAQAQVQPIPTPEETH |
| Ga0214166_10298292 | 3300021139 | Freshwater | MTLDLTINEINIILQALGNAPYDSVAEVIEKIRTQAQAQLQPAPTPEETH |
| Ga0222714_101953873 | 3300021961 | Estuarine Water | MKIELTINEINVILQALGNAPYAQVFELIEKIRTQAQAQVQSTETENG |
| Ga0181354_10007491 | 3300022190 | Freshwater Lake | KMKLELTINEINMILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQQNG |
| Ga0181354_10520982 | 3300022190 | Freshwater Lake | MKLELTINEVNMILQALGNSPYAQVFELVEKIRTQAQAQVQSTEIENE |
| Ga0248169_10078281 | 3300022602 | Freshwater | MTLDLNINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH |
| Ga0214917_102525192 | 3300022752 | Freshwater | MTLDLTINEVNLILQALGNAPYAQVFELVQKIRDQAQSQIQPAPTPEETH |
| Ga0214923_102006972 | 3300023179 | Freshwater | MTLDLTINEINIILQALGNAPYAQVFELVQKIRDQAQSQIQPAPTPEETH |
| Ga0255147_100011153 | 3300024289 | Freshwater | MTLDLTINEVNLILQALGNAPYATVFELVQKIRDQAQSQIQPAPTPEETH |
| Ga0255148_10799492 | 3300024306 | Freshwater | MTLDLTVNEINLILQALGNAPYAQVFELVQKIREQAQ |
| Ga0255288_11286493 | 3300024561 | Freshwater | LILQALGNAPYAQVFELVQKIRDQAQSQIQPAPTPEETH |
| Ga0255276_10193216 | 3300024570 | Freshwater | LQALGNAPYATVFELVQKIRDQAQSQIQPAPTPEETH |
| Ga0255271_10244925 | 3300024864 | Freshwater | GDKMTLYLTINEVNLILQALGNAPYAQVFELVQKIRDQAQSQIQPAPTPEETH |
| Ga0255267_10316354 | 3300024867 | Freshwater | MTLDLTINEVNLILQALGNAPYAQVFELVQKIRDQAQSQIQTAPTPEETH |
| Ga0208502_10018351 | 3300025339 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTSEETH |
| Ga0208383_10007291 | 3300025357 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQ |
| Ga0208383_10066661 | 3300025357 | Freshwater | NIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH |
| Ga0208500_10011137 | 3300025429 | Freshwater | MKFDLTINEINIILQALGNAPYAQVFELIEKIRTQAQAQVQPAPTPEETH |
| Ga0208249_10961573 | 3300025532 | Freshwater | MTLDLTINEINIILQALGNAPYAQVFELIEKIRTQAQAQVQPAPTPEETH |
| Ga0208379_100204912 | 3300025598 | Freshwater | NEINIILQALGNAPYVSVAEVIEKIRTQAQAQLQPAPTPEETH |
| Ga0208379_10895762 | 3300025598 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQ |
| Ga0208388_10315452 | 3300025778 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTSEE |
| Ga0208388_10514221 | 3300025778 | Freshwater | TINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTSEETH |
| Ga0208869_10458321 | 3300025779 | Freshwater | IRGRTMTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH |
| Ga0255088_10978262 | 3300027597 | Freshwater | MKLELTINEVNMILQALGNAPYAQVFELVEKIRTQAQEAK |
| Ga0209777_103815102 | 3300027896 | Freshwater Lake Sediment | MTLDLTINEINIILQALGNAPYVSVAEIIEKIRTQAQAQIQPAPTSEETH |
| Ga0209777_106412171 | 3300027896 | Freshwater Lake Sediment | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPA |
| Ga0209777_108511851 | 3300027896 | Freshwater Lake Sediment | MTLDLTINEINIILQALGNAPYAQVFELIEKIRTQ |
| Ga0209777_108750622 | 3300027896 | Freshwater Lake Sediment | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPI |
| Ga0209777_109043331 | 3300027896 | Freshwater Lake Sediment | MTIDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQ |
| Ga0209048_107485212 | 3300027902 | Freshwater Lake Sediment | MTLDLTINEVNLILQALGNAPYVSVAEVIEKIRTQAQAQVQPAPTPEETH |
| Ga0307377_108475132 | 3300031673 | Soil | MKLDLTIAEVNTIMQALGNAPYVQVAELIQKIREQAQPQVAAPAPEETVQ |
| Ga0315907_106497792 | 3300031758 | Freshwater | MKLDLTINDVNVILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQQNG |
| Ga0315899_101055183 | 3300031784 | Freshwater | MKLDLTINDVNVILQALGNAPYAQVFELVEKIRTQAQPQVQTTEQQNG |
| Ga0315900_103231901 | 3300031787 | Freshwater | MKLELTINDVNMILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQQNG |
| Ga0315900_106023931 | 3300031787 | Freshwater | VNMILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQQNG |
| Ga0315909_109841362 | 3300031857 | Freshwater | MKLELTINDVNMILQALGNAPYAQVFELVEKIRTQAQAQ |
| Ga0316220_10443142 | 3300031884 | Freshwater | MTLDLTINEVNLILQTLGNAPYAQVFELVQKIRDQAQS |
| Ga0316220_10722061 | 3300031884 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQP |
| Ga0315902_101491051 | 3300032093 | Freshwater | MKLDLTINDVNVILQALGNAPYAQVFELVEKIRTQAQ |
| Ga0315902_105225722 | 3300032093 | Freshwater | MKLELTINDVNMILQALGNAPYAQVFELVEKIRTQAQ |
| Ga0316223_11535613 | 3300032560 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIDKIRTQAQAQVQPIPTPEETH |
| Ga0316223_12283993 | 3300032560 | Freshwater | DLTINEINIILQALGNAPYVSVAEVIEKIRTQAQAQVQTAPTPEETH |
| Ga0316232_10157831 | 3300032605 | Freshwater | MTLDLTINEVNLILQTLGNAPYAQVFELVQKIRDQAQSQIQPAP |
| Ga0316232_12652262 | 3300032605 | Freshwater | MTLDLNINEINLILQALGNAPYVSVAEVIEKIRTQ |
| Ga0316232_13595892 | 3300032605 | Freshwater | RTMTLDLTINEINIILQALGNAPYVSVAEVIDKIRTQAQAQVQPIPTPEETH |
| Ga0316231_10681112 | 3300032722 | Freshwater | MTLDLTINEINIILQALGNAPYVSVAEVIEKIRTQAQA |
| Ga0316231_11455101 | 3300032722 | Freshwater | IILQALGNAPYVSVAEVIDKIRTQAQAQVQPIPTPEETH |
| Ga0316224_11073661 | 3300032753 | Freshwater | MTLDLTINEVNLILQTLGNAPYAQVFELVQKIRDQAQSQI |
| Ga0334980_0108157_611_757 | 3300033816 | Freshwater | MKLDLSLNEINVIMQALGNAPYAQVFELVEKIRTQAQAQVQTTEQENG |
| Ga0334994_0020004_2688_2834 | 3300033993 | Freshwater | MKLELTINDVNTILQALGNAPYAQVFELVEKIRTQAQAQVQSTEQQNG |
| Ga0334994_0045112_2591_2737 | 3300033993 | Freshwater | MKLELTINEINVILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQANG |
| Ga0334994_0381141_104_250 | 3300033993 | Freshwater | MKIELTINEVNMILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQENG |
| Ga0334987_0001694_2559_2705 | 3300034061 | Freshwater | MKLELTINEINMILQALGNAPYAQVFELVEKIRTQAQAQMQSTEQQNG |
| Ga0334987_0011830_397_543 | 3300034061 | Freshwater | MKLDLTINEINVILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQQNG |
| Ga0334995_0016594_1403_1549 | 3300034062 | Freshwater | MKLELTINDVNVILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQENG |
| Ga0334995_0203747_994_1140 | 3300034062 | Freshwater | MKLELTINDVNMILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQENG |
| Ga0335027_0610852_1_126 | 3300034101 | Freshwater | MKLELTINEINVILQALGNAPYAQVFELVEKIRTQAQAQVQT |
| Ga0335027_0677899_64_210 | 3300034101 | Freshwater | MKLDLSLNEINVIMQALGQMPYASVFELVEKIRTQAQAQVQTTEQANG |
| Ga0335027_0685603_402_548 | 3300034101 | Freshwater | MKLELTINEINVILQALGNAPYAQVFELVEKIRTQAQAQVQTTEQQNG |
| Ga0335029_0017924_5032_5178 | 3300034102 | Freshwater | MKLELTINEINMILQALGNAPYAQVFELVEKIRTQAQAQMQSTEQANG |
| Ga0335029_0111849_2_121 | 3300034102 | Freshwater | MKIELTINEVNMILQALGNAPYAQVFELVEKIRTQAQAQV |
| Ga0335031_0259468_387_533 | 3300034104 | Freshwater | MKLELTINEINVILQALGNAPYAQVFELVEKIRTQAQAQVQTTETENG |
| Ga0335007_0134352_1_129 | 3300034283 | Freshwater | INEINMILQALGNAPYAQVFELVEKIRTQAQAQMQSTEQANG |
| Ga0335007_0312493_462_608 | 3300034283 | Freshwater | MKIELTINEVNMILQALGNAPYAQVFELVEKIRTQAQAQVQPTEQEND |
| ⦗Top⦘ |