


| Basic Information | |
|---|---|
| Family ID | F039302 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 164 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLARGI |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 164 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 60.98 % |
| % of genes near scaffold ends (potentially truncated) | 30.49 % |
| % of genes from short scaffolds (< 2000 bps) | 82.32 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.366 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (35.366 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.707 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.049 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.86% β-sheet: 0.00% Coil/Unstructured: 47.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 164 Family Scaffolds |
|---|---|---|
| PF07859 | Abhydrolase_3 | 2.44 |
| PF00378 | ECH_1 | 2.44 |
| PF00106 | adh_short | 1.22 |
| PF07746 | LigA | 1.22 |
| PF00583 | Acetyltransf_1 | 0.61 |
| PF13610 | DDE_Tnp_IS240 | 0.61 |
| PF01636 | APH | 0.61 |
| PF02900 | LigB | 0.61 |
| PF01609 | DDE_Tnp_1 | 0.61 |
| PF00211 | Guanylate_cyc | 0.61 |
| PF00872 | Transposase_mut | 0.61 |
| PF02195 | ParBc | 0.61 |
| PF00589 | Phage_integrase | 0.61 |
| PF05838 | Glyco_hydro_108 | 0.61 |
| PF00528 | BPD_transp_1 | 0.61 |
| PF11748 | DUF3306 | 0.61 |
| PF00144 | Beta-lactamase | 0.61 |
| PF13551 | HTH_29 | 0.61 |
| PF01497 | Peripla_BP_2 | 0.61 |
| PF00239 | Resolvase | 0.61 |
| PF14337 | Abi_alpha | 0.61 |
| PF00871 | Acetate_kinase | 0.61 |
| PF13384 | HTH_23 | 0.61 |
| PF10073 | DUF2312 | 0.61 |
| PF13683 | rve_3 | 0.61 |
| PF07769 | PsiF_repeat | 0.61 |
| PF04955 | HupE_UreJ | 0.61 |
| PF05448 | AXE1 | 0.61 |
| PF02518 | HATPase_c | 0.61 |
| PF08241 | Methyltransf_11 | 0.61 |
| PF03972 | MmgE_PrpD | 0.61 |
| PF11994 | DUF3489 | 0.61 |
| PF07519 | Tannase | 0.61 |
| PF13492 | GAF_3 | 0.61 |
| PF03466 | LysR_substrate | 0.61 |
| PF01844 | HNH | 0.61 |
| PF00924 | MS_channel | 0.61 |
| PF07885 | Ion_trans_2 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
|---|---|---|---|
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 2.44 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.61 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.61 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.61 |
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.61 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.61 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.61 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.61 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.61 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.61 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.61 |
| COG2370 | Hydrogenase/urease accessory protein HupE | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.61 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.61 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.61 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.61 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.61 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.61 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.61 |
| COG3458 | Cephalosporin-C deacetylase or related acetyl esterase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.61 |
| COG3926 | Lysozyme family protein | General function prediction only [R] | 0.61 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.61 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.61 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.61 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.61 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.61 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.61 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.37 % |
| All Organisms | root | All Organisms | 39.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100156996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2150 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100220644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1788 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101480405 | Not Available | 574 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10185611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 843 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10230408 | Not Available | 752 | Open in IMG/M |
| 3300004092|Ga0062389_100246502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1808 | Open in IMG/M |
| 3300005434|Ga0070709_10037743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2952 | Open in IMG/M |
| 3300005434|Ga0070709_10333403 | Not Available | 1117 | Open in IMG/M |
| 3300005434|Ga0070709_11575596 | Not Available | 534 | Open in IMG/M |
| 3300005435|Ga0070714_100232662 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
| 3300005435|Ga0070714_100497411 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300005435|Ga0070714_100772572 | Not Available | 929 | Open in IMG/M |
| 3300005436|Ga0070713_100077018 | All Organisms → cellular organisms → Bacteria | 2835 | Open in IMG/M |
| 3300005436|Ga0070713_100385551 | Not Available | 1306 | Open in IMG/M |
| 3300005436|Ga0070713_100568609 | Not Available | 1075 | Open in IMG/M |
| 3300005436|Ga0070713_100897035 | Not Available | 853 | Open in IMG/M |
| 3300005437|Ga0070710_11159055 | Not Available | 570 | Open in IMG/M |
| 3300005439|Ga0070711_100030700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3561 | Open in IMG/M |
| 3300005439|Ga0070711_100133720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1850 | Open in IMG/M |
| 3300005439|Ga0070711_100668087 | Not Available | 872 | Open in IMG/M |
| 3300005467|Ga0070706_100273700 | Not Available | 1576 | Open in IMG/M |
| 3300005536|Ga0070697_100474549 | Not Available | 1092 | Open in IMG/M |
| 3300005602|Ga0070762_10903118 | Not Available | 602 | Open in IMG/M |
| 3300005610|Ga0070763_10754713 | Not Available | 573 | Open in IMG/M |
| 3300005764|Ga0066903_100445882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2159 | Open in IMG/M |
| 3300005764|Ga0066903_101743435 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300006028|Ga0070717_10000365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 29148 | Open in IMG/M |
| 3300006028|Ga0070717_10825496 | Not Available | 843 | Open in IMG/M |
| 3300006028|Ga0070717_10980814 | Not Available | 769 | Open in IMG/M |
| 3300006028|Ga0070717_11491926 | Not Available | 613 | Open in IMG/M |
| 3300006050|Ga0075028_100856771 | Not Available | 557 | Open in IMG/M |
| 3300006057|Ga0075026_100711878 | Not Available | 601 | Open in IMG/M |
| 3300006173|Ga0070716_100266406 | Not Available | 1175 | Open in IMG/M |
| 3300006175|Ga0070712_100171177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1685 | Open in IMG/M |
| 3300006175|Ga0070712_101072325 | Not Available | 698 | Open in IMG/M |
| 3300006175|Ga0070712_101234456 | Not Available | 650 | Open in IMG/M |
| 3300006176|Ga0070765_100009749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6642 | Open in IMG/M |
| 3300006176|Ga0070765_100182679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1893 | Open in IMG/M |
| 3300006893|Ga0073928_10881953 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300007258|Ga0099793_10074763 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
| 3300007788|Ga0099795_10235872 | Not Available | 784 | Open in IMG/M |
| 3300010154|Ga0127503_11003491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 612 | Open in IMG/M |
| 3300011120|Ga0150983_11807714 | Not Available | 710 | Open in IMG/M |
| 3300012202|Ga0137363_10762681 | Not Available | 820 | Open in IMG/M |
| 3300012205|Ga0137362_10210191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1676 | Open in IMG/M |
| 3300012361|Ga0137360_10046570 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3102 | Open in IMG/M |
| 3300012362|Ga0137361_10134243 | Not Available | 2195 | Open in IMG/M |
| 3300012362|Ga0137361_10716045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 914 | Open in IMG/M |
| 3300012582|Ga0137358_10238447 | Not Available | 1239 | Open in IMG/M |
| 3300012683|Ga0137398_10014458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4115 | Open in IMG/M |
| 3300012918|Ga0137396_11010263 | Not Available | 602 | Open in IMG/M |
| 3300012923|Ga0137359_10153945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2050 | Open in IMG/M |
| 3300012927|Ga0137416_10912131 | Not Available | 782 | Open in IMG/M |
| 3300012955|Ga0164298_10742363 | Not Available | 694 | Open in IMG/M |
| 3300012986|Ga0164304_11250648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300012987|Ga0164307_10668590 | Not Available | 810 | Open in IMG/M |
| 3300016319|Ga0182033_10013299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4749 | Open in IMG/M |
| 3300016319|Ga0182033_11020576 | Not Available | 736 | Open in IMG/M |
| 3300016319|Ga0182033_11712421 | Not Available | 570 | Open in IMG/M |
| 3300016341|Ga0182035_10467798 | Not Available | 1072 | Open in IMG/M |
| 3300016387|Ga0182040_10075857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2198 | Open in IMG/M |
| 3300016387|Ga0182040_10206807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1447 | Open in IMG/M |
| 3300016422|Ga0182039_10047648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2895 | Open in IMG/M |
| 3300020579|Ga0210407_10025549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4389 | Open in IMG/M |
| 3300020579|Ga0210407_10142673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1842 | Open in IMG/M |
| 3300020579|Ga0210407_10188097 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300020579|Ga0210407_10307353 | Not Available | 1238 | Open in IMG/M |
| 3300020579|Ga0210407_10733648 | Not Available | 765 | Open in IMG/M |
| 3300020580|Ga0210403_10047164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3445 | Open in IMG/M |
| 3300020580|Ga0210403_10277810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1373 | Open in IMG/M |
| 3300020580|Ga0210403_10395080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1129 | Open in IMG/M |
| 3300020580|Ga0210403_10660381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 840 | Open in IMG/M |
| 3300020580|Ga0210403_10897110 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300020580|Ga0210403_10991838 | Not Available | 658 | Open in IMG/M |
| 3300020580|Ga0210403_11085045 | Not Available | 623 | Open in IMG/M |
| 3300020580|Ga0210403_11340639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300020581|Ga0210399_10046077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3498 | Open in IMG/M |
| 3300020581|Ga0210399_10112788 | All Organisms → cellular organisms → Bacteria | 2229 | Open in IMG/M |
| 3300020581|Ga0210399_10119570 | Not Available | 2164 | Open in IMG/M |
| 3300020581|Ga0210399_10410969 | Not Available | 1128 | Open in IMG/M |
| 3300020581|Ga0210399_11047173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300020581|Ga0210399_11345956 | Not Available | 560 | Open in IMG/M |
| 3300020582|Ga0210395_10862260 | Not Available | 674 | Open in IMG/M |
| 3300020583|Ga0210401_10343332 | Not Available | 1354 | Open in IMG/M |
| 3300020583|Ga0210401_11052351 | Not Available | 672 | Open in IMG/M |
| 3300021168|Ga0210406_10846007 | Not Available | 693 | Open in IMG/M |
| 3300021168|Ga0210406_10992324 | Not Available | 625 | Open in IMG/M |
| 3300021168|Ga0210406_11143540 | Not Available | 570 | Open in IMG/M |
| 3300021171|Ga0210405_10048515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3364 | Open in IMG/M |
| 3300021178|Ga0210408_10059813 | Not Available | 2976 | Open in IMG/M |
| 3300021178|Ga0210408_10561600 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300021178|Ga0210408_10657974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 827 | Open in IMG/M |
| 3300021178|Ga0210408_10683022 | Not Available | 809 | Open in IMG/M |
| 3300021178|Ga0210408_11026412 | Not Available | 637 | Open in IMG/M |
| 3300021401|Ga0210393_11314009 | Not Available | 580 | Open in IMG/M |
| 3300021403|Ga0210397_10165112 | Not Available | 1559 | Open in IMG/M |
| 3300021403|Ga0210397_11234398 | Not Available | 581 | Open in IMG/M |
| 3300021404|Ga0210389_11166040 | Not Available | 594 | Open in IMG/M |
| 3300021405|Ga0210387_10380071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1250 | Open in IMG/M |
| 3300021406|Ga0210386_10219921 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300021477|Ga0210398_11262748 | Not Available | 582 | Open in IMG/M |
| 3300021479|Ga0210410_11227853 | Not Available | 641 | Open in IMG/M |
| 3300021560|Ga0126371_13087220 | Not Available | 564 | Open in IMG/M |
| 3300022533|Ga0242662_10095658 | Not Available | 840 | Open in IMG/M |
| 3300022533|Ga0242662_10273749 | Not Available | 555 | Open in IMG/M |
| 3300025905|Ga0207685_10407831 | Not Available | 698 | Open in IMG/M |
| 3300025910|Ga0207684_10222216 | Not Available | 1630 | Open in IMG/M |
| 3300025915|Ga0207693_10105986 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
| 3300025916|Ga0207663_10084728 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
| 3300025922|Ga0207646_10840277 | Not Available | 816 | Open in IMG/M |
| 3300025928|Ga0207700_11767243 | Not Available | 544 | Open in IMG/M |
| 3300025929|Ga0207664_10396974 | Not Available | 1226 | Open in IMG/M |
| 3300025929|Ga0207664_10809629 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300026555|Ga0179593_1115936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3259 | Open in IMG/M |
| 3300026998|Ga0208369_1021261 | Not Available | 629 | Open in IMG/M |
| 3300027074|Ga0208092_106969 | Not Available | 684 | Open in IMG/M |
| 3300027076|Ga0208860_1006954 | Not Available | 998 | Open in IMG/M |
| 3300027104|Ga0208095_1016460 | Not Available | 532 | Open in IMG/M |
| 3300027173|Ga0208097_1004840 | Not Available | 1376 | Open in IMG/M |
| 3300027583|Ga0209527_1089245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella aerogenes | 692 | Open in IMG/M |
| 3300027583|Ga0209527_1093634 | Not Available | 674 | Open in IMG/M |
| 3300027635|Ga0209625_1036536 | Not Available | 1096 | Open in IMG/M |
| 3300027651|Ga0209217_1017161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2340 | Open in IMG/M |
| 3300027910|Ga0209583_10024956 | Not Available | 1933 | Open in IMG/M |
| 3300028047|Ga0209526_10027167 | Not Available | 4015 | Open in IMG/M |
| 3300028047|Ga0209526_10070279 | Not Available | 2462 | Open in IMG/M |
| 3300028536|Ga0137415_10249620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1583 | Open in IMG/M |
| 3300029636|Ga0222749_10518680 | Not Available | 647 | Open in IMG/M |
| 3300029636|Ga0222749_10563260 | Not Available | 621 | Open in IMG/M |
| 3300031057|Ga0170834_112987964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 670 | Open in IMG/M |
| 3300031122|Ga0170822_13020660 | Not Available | 515 | Open in IMG/M |
| 3300031231|Ga0170824_103801008 | Not Available | 924 | Open in IMG/M |
| 3300031231|Ga0170824_127254100 | Not Available | 586 | Open in IMG/M |
| 3300031446|Ga0170820_16529303 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium | 666 | Open in IMG/M |
| 3300031474|Ga0170818_103756771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1265 | Open in IMG/M |
| 3300031543|Ga0318516_10008722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 4808 | Open in IMG/M |
| 3300031543|Ga0318516_10246937 | Not Available | 1032 | Open in IMG/M |
| 3300031561|Ga0318528_10529461 | Not Available | 633 | Open in IMG/M |
| 3300031561|Ga0318528_10576665 | Not Available | 604 | Open in IMG/M |
| 3300031679|Ga0318561_10545055 | Not Available | 639 | Open in IMG/M |
| 3300031708|Ga0310686_115496617 | Not Available | 778 | Open in IMG/M |
| 3300031719|Ga0306917_10600378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 865 | Open in IMG/M |
| 3300031720|Ga0307469_10574805 | Not Available | 1003 | Open in IMG/M |
| 3300031736|Ga0318501_10164292 | Not Available | 1149 | Open in IMG/M |
| 3300031753|Ga0307477_10477960 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 848 | Open in IMG/M |
| 3300031754|Ga0307475_10417994 | Not Available | 1078 | Open in IMG/M |
| 3300031754|Ga0307475_10750226 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 776 | Open in IMG/M |
| 3300031754|Ga0307475_11588747 | Not Available | 500 | Open in IMG/M |
| 3300031777|Ga0318543_10203587 | Not Available | 879 | Open in IMG/M |
| 3300031781|Ga0318547_10107871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1599 | Open in IMG/M |
| 3300031782|Ga0318552_10703359 | Not Available | 515 | Open in IMG/M |
| 3300031797|Ga0318550_10070663 | Not Available | 1606 | Open in IMG/M |
| 3300031797|Ga0318550_10493719 | Not Available | 591 | Open in IMG/M |
| 3300031798|Ga0318523_10324084 | Not Available | 768 | Open in IMG/M |
| 3300031879|Ga0306919_10469695 | Not Available | 969 | Open in IMG/M |
| 3300031879|Ga0306919_11297371 | Not Available | 551 | Open in IMG/M |
| 3300031880|Ga0318544_10044388 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1588 | Open in IMG/M |
| 3300031890|Ga0306925_11216152 | Not Available | 754 | Open in IMG/M |
| 3300031912|Ga0306921_10481047 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
| 3300031945|Ga0310913_10256847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1228 | Open in IMG/M |
| 3300031962|Ga0307479_11375721 | Not Available | 665 | Open in IMG/M |
| 3300032001|Ga0306922_10047333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4440 | Open in IMG/M |
| 3300032041|Ga0318549_10174278 | Not Available | 962 | Open in IMG/M |
| 3300032261|Ga0306920_103237829 | Not Available | 609 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 35.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 16.46% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.37% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.66% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.22% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.61% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.61% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027074 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027076 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024 (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1001569966 | 3300002245 | Forest Soil | MINWPEMLHHAEDWAAGFWAGAGAASLIVIVGAVMVLLIRSI* |
| JGIcombinedJ26739_1002206441 | 3300002245 | Forest Soil | MINWPEMLHYAEAWAAGXWAGAGAASLMVIAGGAMVLLARGI* |
| JGIcombinedJ26739_1014804052 | 3300002245 | Forest Soil | MINWPEVLHHAEDWAAGFWAGAGAASLIMIAGVGMVLLARAI* |
| JGIcombinedJ51221_101856112 | 3300003505 | Forest Soil | MINWPEMLRHAEGWAGGFWAGAGAASLMVIAGVAMVLLVRAI* |
| JGIcombinedJ51221_102304082 | 3300003505 | Forest Soil | MEPTMINWPEMLRHAEGWAAGFWAGAGAASLMVIAGVAVALLVRAI* |
| Ga0062389_1002465022 | 3300004092 | Bog Forest Soil | MINWPEMLHDTEDWAHGFWAGAATTSLIVIVGAAVALLSHAI* |
| Ga0070709_100377435 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDWPEVLHHAEDWAAGFWAGAGAASLIMLAGAGMVLLARAI* |
| Ga0070709_103334031 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPTMINWPEMLRHAEGWAAGFWAGAGAASLTVIAGVAVVLLVRAI* |
| Ga0070709_115755962 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MVNWPEMLRHAEDWANGFWAGAGAASLIVIVGAVMVLLARGI* |
| Ga0070714_1002326623 | 3300005435 | Agricultural Soil | MINWPEMLHHAEDWAAGFWAGAGAASLIMIAGAGMVLLARGI* |
| Ga0070714_1004974112 | 3300005435 | Agricultural Soil | MINWPEMLRHAEGWAAGFWAGAGAASLTVIAGVAVVLLVRAI* |
| Ga0070714_1007725721 | 3300005435 | Agricultural Soil | ASTLVIMEPAMINWPEMLHHAEEWAAGFWAGAGAASLIVIVGAVMVLFARGI* |
| Ga0070713_1000770182 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VINWPEMLHHTEDWAAGFWAGAGAASLMVIAGGAMVLLARRI* |
| Ga0070713_1003855511 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VIREPAMIDWPEVLHHAEDWAAGFWAGAGAASLIMLAGAGMVLLARGI* |
| Ga0070713_1005686091 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLNWPEMLHHAEDWAAGFWAGAGAVSLMMIVGAGIVLLIRGI* |
| Ga0070713_1008970352 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPAMINWPEMLRHAEGWAAGFWAGAGAASLTVIAGVAVVLLVRAI* |
| Ga0070710_111590551 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MEPAMINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLIRGI* |
| Ga0070711_1000307005 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SVIREPAMIDWPEVLHHAEDWAAGFWAGAGAASLIMLAGAGMVLLARGI* |
| Ga0070711_1001337203 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MINWPEMLHHAEEWAAGFWAGAGAASLIVIVGAVMVLFARGI* |
| Ga0070711_1006680871 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MINWPEMLHHAEDCAAGFWAGAGAASLMVIAGAGMVLLIRGI* |
| Ga0070706_1002737002 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAAMVLLARGI* |
| Ga0070697_1004745492 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MINWPETLRHAEDWAAGFWAGAGAASLMVIAGGAMVLLARRI* |
| Ga0070762_109031181 | 3300005602 | Soil | MISWPEMLQHAEDWAAGFWAGAGAALLLVIAGGAMVLLVS* |
| Ga0070763_107547132 | 3300005610 | Soil | MLNWPEMLHHAEDWADGFWAGAGAVSLMMIVGAGIMLLIRGI* |
| Ga0066903_1004458823 | 3300005764 | Tropical Forest Soil | MINWPEVLHHAEDWAAGFWAGAGAASLIMIAGAGVVLLARGI* |
| Ga0066903_1017434353 | 3300005764 | Tropical Forest Soil | MINWPEMLHHADGWADGFWAGTATTSLIAIAGAALVLFGHAI* |
| Ga0070717_1000036529 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MINWPETLRHAEDWAAGFWAGAGAASLMVIAGGAMVLLARGI* |
| Ga0070717_108254963 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDWPEVLHHAEDWAAGFWAGAGAASLIMLAGAGMVLLAR |
| Ga0070717_109808141 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IDWPEVLHHAEDWAAGFWAGAGAASLIMLAGAGMVLLARGI* |
| Ga0070717_114919263 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IDWPEVLHHAEDWAAGFWAGAGAASLIMLAGAGMVLLARAI* |
| Ga0075028_1008567712 | 3300006050 | Watersheds | MINWPEMLHHAEDWAAGFWAGAGAASLIVIVGAVMVLLARGI* |
| Ga0075026_1007118782 | 3300006057 | Watersheds | MINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLIRSI* |
| Ga0070716_1002664062 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MINWPEMLHRAEDWADGFWTGAAAGSLIVIATGALVVLVHAL* |
| Ga0070712_1001711775 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDWPEVLHHAEDWAAGFWAGAGAASLIMLAGAGMVLLARGI* |
| Ga0070712_1010723252 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LVIMEPAMINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAAMVLLARGI* |
| Ga0070712_1012344561 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLNWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGM |
| Ga0070765_10000974911 | 3300006176 | Soil | INWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLIRGI* |
| Ga0070765_1001826795 | 3300006176 | Soil | MINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLIR |
| Ga0073928_108819532 | 3300006893 | Iron-Sulfur Acid Spring | MLNWPEMLHHAEDWAAGFWAGAGAASLIVIAGTGMVLLIRGI* |
| Ga0099793_100747633 | 3300007258 | Vadose Zone Soil | VIMEPAMINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLIRGI* |
| Ga0099795_102358722 | 3300007788 | Vadose Zone Soil | MEPAMINWPEMPHHAEDWAAGFWAGGGAALLIVIVGAVMVLLARGI* |
| Ga0127503_110034912 | 3300010154 | Soil | MINWPEMLHQAEDWAAGSWAGVGAASLMVIVGVGIVLLARGI* |
| Ga0150983_118077141 | 3300011120 | Forest Soil | MINWPEMLRHAEGWAAGFWAGAGAASLMVIAGVAVVLLVRAI* |
| Ga0137363_107626811 | 3300012202 | Vadose Zone Soil | MISWPEMLQHAEDWAAGFWAGAGAALLLVIAGGAMVLLVSAV* |
| Ga0137362_102101914 | 3300012205 | Vadose Zone Soil | MELAMISWPEMLQHAEDWAAGFWAGAGAALLLVIAGGAMVLLVSAV* |
| Ga0137360_100465706 | 3300012361 | Vadose Zone Soil | HHAEDWAAGFWAGAGAASLMVIAGAGMVLLIRGI* |
| Ga0137361_101342433 | 3300012362 | Vadose Zone Soil | MINWPEMLHHAEDWAAGFWAGAGAASLIVIVGAVIVLLARGI* |
| Ga0137361_107160451 | 3300012362 | Vadose Zone Soil | MINWPEMLHHAEDWAAGFWAGVGAASLIVIAGVGMVVLARGI* |
| Ga0137358_102384471 | 3300012582 | Vadose Zone Soil | MINWPEMLHHAEDWAAGFWAGAGAASLMVIAGGAMVLLARGI* |
| Ga0137398_100144582 | 3300012683 | Vadose Zone Soil | MEPAMINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMLLLIRGI* |
| Ga0137396_110102631 | 3300012918 | Vadose Zone Soil | MEPAMINWPEVLHHAEDWAAGFWVGAGAASLVVIAGAGMVLLIRGI* |
| Ga0137359_101539454 | 3300012923 | Vadose Zone Soil | MINWPEMLHHAEDWAAGFWAGVGAASLIVIAGVGMVLLARGI* |
| Ga0137416_109121311 | 3300012927 | Vadose Zone Soil | MEPAMINWPEMLHHAEDWAAGFWAGAGAASLVVIVGAVMVLLARGI* |
| Ga0164298_107423632 | 3300012955 | Soil | MINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLIRGIRSR* |
| Ga0164304_112506481 | 3300012986 | Soil | MEPAMINWPEMLHHSEDWAAGFWAGAGAASLMVIAGAGMVLLIRGI* |
| Ga0164307_106685902 | 3300012987 | Soil | MINWPEMLRHAEGWAAGFWAGAGAASLMLIAGVAVVLLVRAI* |
| Ga0182033_100132991 | 3300016319 | Soil | MINWPEMLRHAEDWAAGFWAGAGADSLTMTAGAVMALLTRGI |
| Ga0182033_110205761 | 3300016319 | Soil | MEVAMMNWPEMLHHAEEWAAGFWAGAGAASLIVIAGAGMVLLIDGI |
| Ga0182033_117124211 | 3300016319 | Soil | MINWPEMLRHAEEWAAGFWAGAGTASLMVIAGAGMVLLIGGI |
| Ga0182035_104677984 | 3300016341 | Soil | MEPAMINWPEMLHHAEDWAAGFWAGAGAASLMVIAGLGMALLARGF |
| Ga0182040_100758571 | 3300016387 | Soil | VIMEPPMINWPEVLHHAEDWAAGFWAGAGAASLIMIAGAGVVLLARGI |
| Ga0182040_102068071 | 3300016387 | Soil | MINWPEILHHAEDWAAGFWAGAGAASLIVIAGGAVVLLARGI |
| Ga0182039_100476486 | 3300016422 | Soil | MINWPEMLHRAEDWAAGFWAGAGAASLIMIAGAGVVLLARGI |
| Ga0210407_100255495 | 3300020579 | Soil | MINWPEMLHHAEDWAAGFWAGAGAASLIVIVGAVMVLLARGI |
| Ga0210407_101426734 | 3300020579 | Soil | MINWPEMLHRAEDWADGFWTGAAAGSLIVIATGALVVLVHAL |
| Ga0210407_101880973 | 3300020579 | Soil | MINWPEMLHHTEDWAAGFWAGAGAASLMVIAGVGMVLLARGI |
| Ga0210407_103073531 | 3300020579 | Soil | MEPAMINWPEMLHHAEEWAAGFWAGAGAASLIVIVGAVMVLFARGI |
| Ga0210407_107336482 | 3300020579 | Soil | MLNWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLIRGI |
| Ga0210403_100471644 | 3300020580 | Soil | MINWPEMLHHAEDWAAGFWAGAGAASLIVIVGAGMVLLARGI |
| Ga0210403_102778103 | 3300020580 | Soil | MEPAMINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLIRGI |
| Ga0210403_103950802 | 3300020580 | Soil | MINWPEMLRHAEGWAAGFWAGAGAASLMVIAGVAVALLVRAI |
| Ga0210403_106603812 | 3300020580 | Soil | MINWPEMLRHAEGWAGGFWAGAGAASLMVIAGVAMVLLVRAI |
| Ga0210403_108971102 | 3300020580 | Soil | MEPAMINWPEMPHHAEDWAAGFWAGGGAALLIVIVGAVMVLLARGI |
| Ga0210403_109918382 | 3300020580 | Soil | MLNWPEMLRHAEDWAAGFWAGAGAASLMVIAGAGMVLLIRGI |
| Ga0210403_110850451 | 3300020580 | Soil | MELAMISWPEMLQHTEDWAAGFWAGAGAALLLVIAGGAMVLLVTAV |
| Ga0210403_113406391 | 3300020580 | Soil | MLRHAEGWAAGFWAGAGAASLMVIVGVAVVLLVRPI |
| Ga0210399_100460778 | 3300020581 | Soil | MINWPEMLHHAEDWAAGFWAGAGAASLIVIVGAVMVLLIRSI |
| Ga0210399_101127884 | 3300020581 | Soil | MINWPEMLHHAEEWAAGFWAGAGAASLIVIVGAVMVLFARGI |
| Ga0210399_101195706 | 3300020581 | Soil | WPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLIRGI |
| Ga0210399_104109691 | 3300020581 | Soil | MEPAMINWPEMLHHAEDWAAGFWAGAGAASLIVIVGAVMVLLARGI |
| Ga0210399_110471731 | 3300020581 | Soil | MISWPEMLQHTEDWAAGFWAGAGAALLLVIAGGAMVLLVTAV |
| Ga0210399_113459562 | 3300020581 | Soil | MINWPEMLRHTEGWANGFWAGVGAASLMVIAGVAVVLLVRAI |
| Ga0210395_108622602 | 3300020582 | Soil | WPEMLHHAEDWAAGFWAGAGAASLIMIAGAGMVLLARGI |
| Ga0210401_103433322 | 3300020583 | Soil | MLNWPAMLRHAEDWAAGFWAGAGAALLMVIAGAGMVLLIRGI |
| Ga0210401_110523511 | 3300020583 | Soil | MLNWPEMLHHAEDWAAGFWAGAGAVSLMIIVGAGIVLLIRGI |
| Ga0210406_108460071 | 3300021168 | Soil | MEPIMINWPEMLHYAEAWAAGFWAGAGAASLMVIAGGAMVLLARGI |
| Ga0210406_109923241 | 3300021168 | Soil | MINWPVMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLIRGI |
| Ga0210406_111435402 | 3300021168 | Soil | MINWPEMLRHAEGWANGFWAGVGAASLMVIAGVAVVLLVRA |
| Ga0210405_100485153 | 3300021171 | Soil | MINWPEMLHHAEDWAAGFWAGAGAASLIMIAGAGMMLLARCI |
| Ga0210408_100598133 | 3300021178 | Soil | MINWPEMLHHAEDWAAGFWAGVGAASIMVIVGVGMVLLARGI |
| Ga0210408_105616001 | 3300021178 | Soil | MINWPEMPHHAEDWAAGFWAGGGAALLIVIVGAVMVLLARGI |
| Ga0210408_106579742 | 3300021178 | Soil | MINWPEMIHHADDWAAGFWAGAGAASLMVIAGAATALLARGI |
| Ga0210408_106830221 | 3300021178 | Soil | MEPAMINWPEMLHHAEEWAAGFWAGAGAASLIVIVGAVMVLFARG |
| Ga0210408_110264121 | 3300021178 | Soil | EMLHHAEDWAAGFWAGAGAASLILIAGAGMVLLARGI |
| Ga0210393_113140091 | 3300021401 | Soil | INWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLIRGI |
| Ga0210397_101651121 | 3300021403 | Soil | MLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLIRGI |
| Ga0210397_112343982 | 3300021403 | Soil | MMNWPEMLHHAEGWAAGFWAGAGAASLIMVAGAGVVLLARLI |
| Ga0210389_111660401 | 3300021404 | Soil | MLNWPEMLHHVEDWAAGFWAGAGAASLIVIAGAGMVLLIRGI |
| Ga0210387_103800711 | 3300021405 | Soil | MELAMINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLIRGI |
| Ga0210386_102199212 | 3300021406 | Soil | MINWPEMLHHAEDWAAGFWAGAGATSLMVIAGAGMVLLIRGI |
| Ga0210398_112627481 | 3300021477 | Soil | MINWPEMLHHAEDWAAGFWAGAGAVSLMMIVGAGIVLLIRGI |
| Ga0210410_112278531 | 3300021479 | Soil | TLVIMGPAMINWPEMLHHAEDWAAGFWAGAGAASLIVIVGAVMVLLIRSI |
| Ga0126371_130872202 | 3300021560 | Tropical Forest Soil | MINWPEMLHHAEDWAAGFWAGAGAASLMVIAGLGMVLLARGF |
| Ga0242662_100956581 | 3300022533 | Soil | TLVILEPAMINWPEMLHHAEDWAAGFWAGAGAASLIMIAGAGMVLLARGI |
| Ga0242662_102737492 | 3300022533 | Soil | MELAMINWPEMLHHAEDWAAGFWAGVGAAALMVIVGVGIVLLARGI |
| Ga0207685_104078311 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MINWPEMLHHAEDWAAGFWAGAGAASLVVIVGAVMVLLARGI |
| Ga0207684_102222162 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAAMVLLARGI |
| Ga0207693_101059863 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MINWPEMLHHAEDCAAGFWAGAGAASLMVIAGAGMVLLIRGL |
| Ga0207663_100847284 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | EVLHHAEDWAAGFWAGAGAASLIMLAGAGMVLLARAI |
| Ga0207646_108402773 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MINWPETLRHAEDWAAGFWAGAGAASLMVIAGGAMVLLARGI |
| Ga0207700_117672433 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LHHAEDWAAGFWAGAGAASLIMLAGAGMVLLARGI |
| Ga0207664_103969741 | 3300025929 | Agricultural Soil | WRLQMINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLIRGI |
| Ga0207664_108096291 | 3300025929 | Agricultural Soil | MINWPEMLHHAEDWAAGFWAGAGAASLIMIAGAGMVLLARGI |
| Ga0179593_11159365 | 3300026555 | Vadose Zone Soil | MEPAMINWPEVLHHAEDWAAGFWAGAGAASLIMIAGAGMVLLARGI |
| Ga0208369_10212611 | 3300026998 | Forest Soil | MLNWPEMLHHAEDWADGFWAGAGAVSLMMIVGAGIMLLIRGI |
| Ga0208092_1069692 | 3300027074 | Forest Soil | MINWPEMLRHAEGWANGFWAGVGAASLMVIAGVAVVLLVRAI |
| Ga0208860_10069542 | 3300027076 | Forest Soil | MEPAVINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLIRGI |
| Ga0208095_10164602 | 3300027104 | Forest Soil | MEPAMINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLARGI |
| Ga0208097_10048402 | 3300027173 | Forest Soil | MLNWPEMLHHAEDWAAGFWAGAGAVSLMMIVGAGIMLLIRGI |
| Ga0209527_10892451 | 3300027583 | Forest Soil | MELAMINWPEMLHHAEDWAAGFWAGVGAASLMVIVGVGMVLLARGI |
| Ga0209527_10936341 | 3300027583 | Forest Soil | MLHHAEDWAAGFWAGAGAASLMVIAGVGMVLLARG |
| Ga0209625_10365362 | 3300027635 | Forest Soil | MLNWPEMLHHAEDWAAGFWVGAGAASLMVIAGAGMVLLIRGI |
| Ga0209217_10171611 | 3300027651 | Forest Soil | MINWPEMLHHAEDWAAGFWAGVGAASLMVIVGVGMVLLARGI |
| Ga0209583_100249561 | 3300027910 | Watersheds | MINWPEILHHAEDWAAGFWAGAGAASLMVIAGGAVVLLARGI |
| Ga0209526_100271671 | 3300028047 | Forest Soil | MISWPEMLQHAEDWAAGFWAGAGAALLLVIAGGAMVLLVS |
| Ga0209526_100702794 | 3300028047 | Forest Soil | MINWPEMLHYAEAWAAGFWAGAGAASLMVIAGGAMVLLARGI |
| Ga0137415_102496201 | 3300028536 | Vadose Zone Soil | MINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMLLLIRGI |
| Ga0222749_105186801 | 3300029636 | Soil | MLNWPAMLRHAEDWAAGFWAGAGAALLMVIAGAGMV |
| Ga0222749_105632602 | 3300029636 | Soil | MISWPEMLQHAEDWAAGFWAGAGAALLLVIAGGAMVLLVSAV |
| Ga0170834_1129879641 | 3300031057 | Forest Soil | MINWPEMLRHAEGWAAGFWVGAGAASLMVIAGVAVVLLVRAI |
| Ga0170822_130206601 | 3300031122 | Forest Soil | MINWPEMLHHAEDWAAGFWAGSGAASLIMIAGAGMVLL |
| Ga0170824_1038010082 | 3300031231 | Forest Soil | MINWPEMLHHTEDWAAGFWAGARAASLMVIAGVGMVLLARGI |
| Ga0170824_1272541002 | 3300031231 | Forest Soil | MINWPEMLHHTEDWAAGFWAGAGAASLMVIAGVGMV |
| Ga0170820_165293031 | 3300031446 | Forest Soil | MINWPEMLHHAEDWAAGFWAGAGAASLIMIAGAGMVLLACGI |
| Ga0170818_1037567712 | 3300031474 | Forest Soil | MINWPEMLHHAEDWAAGFWAGVAAASLMVIVGVGMVLLARGI |
| Ga0318516_100087224 | 3300031543 | Soil | MINWPEMLRHAEDWAAGFWAGAAAASLMVIAGAGMVLLIRGI |
| Ga0318516_102469373 | 3300031543 | Soil | MINWPEVLHHAEDWAAGFWAGAGAASLIMIAGAGVVLLARGI |
| Ga0318528_105294612 | 3300031561 | Soil | MMNWPEMLHHAEDWAAGFWAGAGAASLMVIAGLGMVLLIRGF |
| Ga0318528_105766651 | 3300031561 | Soil | IMEPAMINWPEMLRHAEDWAAGFWAGAAAASLMVIAGAGMVLLIRGI |
| Ga0318561_105450553 | 3300031679 | Soil | MINWPEMLHHAEDWAAGFWAGAGAASLIMIAGAGVVLLARGI |
| Ga0310686_1154966171 | 3300031708 | Soil | MINWPEMLHNAEDWAAGFWAGAGAASLMVIAGVGMVLLIRGI |
| Ga0306917_106003783 | 3300031719 | Soil | LVIMEPPMINWTEVLHHAEDWAAGFWAGAGAASLIMIAGAGVVLLARGI |
| Ga0307469_105748051 | 3300031720 | Hardwood Forest Soil | SVIMEPAMINWPEMLHHTEDWAAGFWAGAGAASLMVIAGVGTVLLASGI |
| Ga0318501_101642921 | 3300031736 | Soil | MINWPEMLHHAEDWAAGFWAGAGAASLMVIAGLGMALLARGF |
| Ga0307477_104779601 | 3300031753 | Hardwood Forest Soil | MLNWPEMLHHAEDWAAGFWAGAGTVSLMMIVGAGIVLLIRGI |
| Ga0307475_104179941 | 3300031754 | Hardwood Forest Soil | PIAAMNRVTMEPAMINWPEMLRHAEDWADGFWAGAATALLVVIAGGTMVLFVRGI |
| Ga0307475_107502261 | 3300031754 | Hardwood Forest Soil | RSKMLNWPEMLHHAEDWAAGFWAGAGAVSLMMIVGAGIVLLIRGI |
| Ga0307475_115887471 | 3300031754 | Hardwood Forest Soil | MINWPEMLRHAEGWTAGFWAGVGAASLMVIAGVAVVLLVRAI |
| Ga0318543_102035873 | 3300031777 | Soil | MLRHAEDWAAGFWAGAAAASLMVIAGAGMVLLIRGI |
| Ga0318547_101078715 | 3300031781 | Soil | VLTLVIMEPAMINWPEMLRHAEDWAAGFWAGAAAASLMVIAGAGMVLLIRGI |
| Ga0318552_107033591 | 3300031782 | Soil | SSHALTLVIMEPAMINWPEMLRHAEDWAAGFWAGAAAASLMVIAGAGMVLLIRGI |
| Ga0318550_100706632 | 3300031797 | Soil | MMNWPEILHHAEEWAAGFWAGAGAASLIVIAGAGMVLLIGGI |
| Ga0318550_104937191 | 3300031797 | Soil | MINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAVMALLARGI |
| Ga0318523_103240841 | 3300031798 | Soil | MINWPEMLRHAEDWAAGFWAGAAAASLMVIAGAGMVLLI |
| Ga0306919_104696951 | 3300031879 | Soil | VAMMNWPEMLHHAEEWAAGFWAGAGAASLIVIAGAGMVLLIGGI |
| Ga0306919_112973712 | 3300031879 | Soil | MNWPEMLHHAEEWAAGFWAGAGAASLIVIAGAGMVLLIDGI |
| Ga0318544_100443883 | 3300031880 | Soil | MMNWPEMLHHAEEWAAGFWAGAGAASLIVIAGAGMVLLIGGI |
| Ga0306925_112161522 | 3300031890 | Soil | MINWPEMLHHAEDWAAGFWAGAGAASLMVIAGAGMVLLARGI |
| Ga0306921_104810471 | 3300031912 | Soil | MINWPEMLHHAEDWAAGFWAGAGAASLMVIAGLGMVLLIRGF |
| Ga0310913_102568471 | 3300031945 | Soil | MINWPEVLHHAEDWAAGFWAGAGATSLIMIAGAGVVLLARGI |
| Ga0307479_113757211 | 3300031962 | Hardwood Forest Soil | SVSTLVIMGPAMINWPEMLHHAEDWAAGFWAGAGAASLIVIVGAVMVLLIRSI |
| Ga0306922_100473331 | 3300032001 | Soil | WPEVLHHAEDWAAGFWAGAGAASLIMIAGAGVVLLARGI |
| Ga0318549_101742781 | 3300032041 | Soil | TLVIMEPAMINWPEMLRHAEDWAAGFWAGAAAASLMVIAGAGMVLLIRGI |
| Ga0306920_1032378291 | 3300032261 | Soil | MINWPQMLHHAEDWAAGFWAGAGAASLMVIAGLGMALLARGF |
| ⦗Top⦘ |