


| Basic Information | |
|---|---|
| Family ID | F039260 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 164 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MQYLLILLVALTMACGAAASVTISLAPAYADDSGKGY |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 164 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 65.24 % |
| % of genes near scaffold ends (potentially truncated) | 23.17 % |
| % of genes from short scaffolds (< 2000 bps) | 85.37 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (53.049 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.805 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.049 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (65.244 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 47.69% β-sheet: 0.00% Coil/Unstructured: 52.31% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 164 Family Scaffolds |
|---|---|---|
| PF00248 | Aldo_ket_red | 29.88 |
| PF00034 | Cytochrom_C | 3.66 |
| PF00106 | adh_short | 3.05 |
| PF00083 | Sugar_tr | 1.83 |
| PF00140 | Sigma70_r1_2 | 1.22 |
| PF08220 | HTH_DeoR | 1.22 |
| PF13181 | TPR_8 | 1.22 |
| PF13601 | HTH_34 | 1.22 |
| PF00536 | SAM_1 | 1.22 |
| PF03788 | LrgA | 1.22 |
| PF13191 | AAA_16 | 0.61 |
| PF01329 | Pterin_4a | 0.61 |
| PF13488 | Gly-zipper_Omp | 0.61 |
| PF03050 | DDE_Tnp_IS66 | 0.61 |
| PF00805 | Pentapeptide | 0.61 |
| PF04773 | FecR | 0.61 |
| PF00557 | Peptidase_M24 | 0.61 |
| PF06078 | DUF937 | 0.61 |
| PF00117 | GATase | 0.61 |
| PF02697 | VAPB_antitox | 0.61 |
| PF04972 | BON | 0.61 |
| PF00211 | Guanylate_cyc | 0.61 |
| PF06823 | DUF1236 | 0.61 |
| PF01381 | HTH_3 | 0.61 |
| PF13673 | Acetyltransf_10 | 0.61 |
| PF04116 | FA_hydroxylase | 0.61 |
| PF01391 | Collagen | 0.61 |
| PF02254 | TrkA_N | 0.61 |
| PF03466 | LysR_substrate | 0.61 |
| PF13185 | GAF_2 | 0.61 |
| PF13495 | Phage_int_SAM_4 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.22 |
| COG1380 | Putative effector of murein hydrolase LrgA, UPF0299 family | General function prediction only [R] | 1.22 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.61 |
| COG1753 | Predicted antitoxin, CopG family | Defense mechanisms [V] | 0.61 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.61 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.61 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.61 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.61 |
| COG3753 | Uncharacterized conserved protein YidB, DUF937 family | Function unknown [S] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.05 % |
| Unclassified | root | N/A | 46.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10197551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia insulae → Devosia insulae DS-56 | 1333 | Open in IMG/M |
| 3300001593|JGI12635J15846_10206834 | Not Available | 1293 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100375480 | Not Available | 1302 | Open in IMG/M |
| 3300004082|Ga0062384_100330358 | Not Available | 958 | Open in IMG/M |
| 3300004091|Ga0062387_101611106 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium → unclassified Chryseobacterium → Chryseobacterium sp. | 524 | Open in IMG/M |
| 3300004092|Ga0062389_100341473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1589 | Open in IMG/M |
| 3300005533|Ga0070734_10224212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1081 | Open in IMG/M |
| 3300005534|Ga0070735_10190094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1260 | Open in IMG/M |
| 3300005539|Ga0068853_101528458 | Not Available | 646 | Open in IMG/M |
| 3300005541|Ga0070733_10631149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 719 | Open in IMG/M |
| 3300005602|Ga0070762_11070620 | Not Available | 555 | Open in IMG/M |
| 3300005610|Ga0070763_10144762 | Not Available | 1236 | Open in IMG/M |
| 3300005610|Ga0070763_10631928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisoma → unclassified Acidisoma → Acidisoma sp. L85 | 623 | Open in IMG/M |
| 3300005712|Ga0070764_10121662 | Not Available | 1413 | Open in IMG/M |
| 3300005921|Ga0070766_10759459 | Not Available | 659 | Open in IMG/M |
| 3300006052|Ga0075029_101030264 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
| 3300006059|Ga0075017_100240718 | Not Available | 1321 | Open in IMG/M |
| 3300006102|Ga0075015_100225291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1007 | Open in IMG/M |
| 3300006174|Ga0075014_100958256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 516 | Open in IMG/M |
| 3300006854|Ga0075425_100868117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1032 | Open in IMG/M |
| 3300006904|Ga0075424_101828435 | Not Available | 642 | Open in IMG/M |
| 3300006954|Ga0079219_12480048 | Not Available | 504 | Open in IMG/M |
| 3300009093|Ga0105240_10209571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2278 | Open in IMG/M |
| 3300009093|Ga0105240_10228237 | Not Available | 2165 | Open in IMG/M |
| 3300009520|Ga0116214_1078562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1207 | Open in IMG/M |
| 3300009521|Ga0116222_1117076 | Not Available | 1147 | Open in IMG/M |
| 3300009522|Ga0116218_1361074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 649 | Open in IMG/M |
| 3300009522|Ga0116218_1396097 | Not Available | 616 | Open in IMG/M |
| 3300009523|Ga0116221_1406248 | Not Available | 593 | Open in IMG/M |
| 3300009525|Ga0116220_10041757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1901 | Open in IMG/M |
| 3300009545|Ga0105237_10342068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis bryophila | 1500 | Open in IMG/M |
| 3300009545|Ga0105237_12176578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300009672|Ga0116215_1055775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1788 | Open in IMG/M |
| 3300009683|Ga0116224_10638855 | Not Available | 509 | Open in IMG/M |
| 3300009698|Ga0116216_10018173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans | 4417 | Open in IMG/M |
| 3300009700|Ga0116217_10837093 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 566 | Open in IMG/M |
| 3300010049|Ga0123356_11687711 | Not Available | 786 | Open in IMG/M |
| 3300010162|Ga0131853_10507294 | Not Available | 1085 | Open in IMG/M |
| 3300010339|Ga0074046_10081252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2105 | Open in IMG/M |
| 3300010339|Ga0074046_10178912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1341 | Open in IMG/M |
| 3300010339|Ga0074046_10206461 | Not Available | 1234 | Open in IMG/M |
| 3300010339|Ga0074046_10308579 | Not Available | 971 | Open in IMG/M |
| 3300010339|Ga0074046_10322520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 945 | Open in IMG/M |
| 3300010339|Ga0074046_10761231 | Not Available | 567 | Open in IMG/M |
| 3300010341|Ga0074045_10045346 | All Organisms → cellular organisms → Bacteria | 3213 | Open in IMG/M |
| 3300010341|Ga0074045_10715866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300010343|Ga0074044_10476099 | Not Available | 816 | Open in IMG/M |
| 3300010343|Ga0074044_10586830 | Not Available | 727 | Open in IMG/M |
| 3300010343|Ga0074044_10755305 | Not Available | 635 | Open in IMG/M |
| 3300010369|Ga0136643_10893840 | Not Available | 507 | Open in IMG/M |
| 3300010373|Ga0134128_10184045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2357 | Open in IMG/M |
| 3300010373|Ga0134128_12913957 | Not Available | 527 | Open in IMG/M |
| 3300010376|Ga0126381_102184767 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300010376|Ga0126381_104060712 | Not Available | 569 | Open in IMG/M |
| 3300010379|Ga0136449_100050206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9398 | Open in IMG/M |
| 3300010379|Ga0136449_100702697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1695 | Open in IMG/M |
| 3300010379|Ga0136449_101895294 | Not Available | 886 | Open in IMG/M |
| 3300010396|Ga0134126_10769825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1090 | Open in IMG/M |
| 3300010401|Ga0134121_12419850 | Not Available | 566 | Open in IMG/M |
| 3300011418|Ga0153954_1002620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7735 | Open in IMG/M |
| 3300012960|Ga0164301_11846547 | Not Available | 509 | Open in IMG/M |
| 3300012987|Ga0164307_11487298 | Not Available | 572 | Open in IMG/M |
| 3300013296|Ga0157374_11994078 | Not Available | 607 | Open in IMG/M |
| 3300014164|Ga0181532_10464036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 697 | Open in IMG/M |
| 3300014164|Ga0181532_10476181 | Not Available | 686 | Open in IMG/M |
| 3300014165|Ga0181523_10090499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans | 1845 | Open in IMG/M |
| 3300014199|Ga0181535_10798066 | Not Available | 535 | Open in IMG/M |
| 3300014200|Ga0181526_10380392 | Not Available | 897 | Open in IMG/M |
| 3300016341|Ga0182035_10971548 | Not Available | 752 | Open in IMG/M |
| 3300017823|Ga0187818_10502001 | Not Available | 544 | Open in IMG/M |
| 3300017946|Ga0187879_10014179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4998 | Open in IMG/M |
| 3300017946|Ga0187879_10608643 | Not Available | 607 | Open in IMG/M |
| 3300017946|Ga0187879_10721789 | Not Available | 555 | Open in IMG/M |
| 3300017955|Ga0187817_10277767 | Not Available | 1067 | Open in IMG/M |
| 3300017970|Ga0187783_10122844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 1913 | Open in IMG/M |
| 3300017970|Ga0187783_11222910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300017994|Ga0187822_10085324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis bryophila | 943 | Open in IMG/M |
| 3300017994|Ga0187822_10261315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. XM-1 | 598 | Open in IMG/M |
| 3300018042|Ga0187871_10006607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8334 | Open in IMG/M |
| 3300018042|Ga0187871_10423355 | Not Available | 736 | Open in IMG/M |
| 3300018060|Ga0187765_11047285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 563 | Open in IMG/M |
| 3300020070|Ga0206356_11131738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1656 | Open in IMG/M |
| 3300020582|Ga0210395_10083603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Ancalomicrobiaceae → Siculibacillus → Siculibacillus lacustris | 2353 | Open in IMG/M |
| 3300020583|Ga0210401_10841140 | Not Available | 777 | Open in IMG/M |
| 3300020583|Ga0210401_11538079 | Not Available | 523 | Open in IMG/M |
| 3300021168|Ga0210406_11136454 | Not Available | 572 | Open in IMG/M |
| 3300021178|Ga0210408_10849226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300021180|Ga0210396_11405833 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300021181|Ga0210388_10245114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis | 1573 | Open in IMG/M |
| 3300021361|Ga0213872_10059355 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1731 | Open in IMG/M |
| 3300021401|Ga0210393_10153834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1849 | Open in IMG/M |
| 3300021401|Ga0210393_10174919 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1731 | Open in IMG/M |
| 3300021401|Ga0210393_10218623 | Not Available | 1543 | Open in IMG/M |
| 3300021402|Ga0210385_10136605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1744 | Open in IMG/M |
| 3300021402|Ga0210385_11197327 | Not Available | 583 | Open in IMG/M |
| 3300021405|Ga0210387_10467084 | Not Available | 1121 | Open in IMG/M |
| 3300021406|Ga0210386_10089764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2503 | Open in IMG/M |
| 3300021406|Ga0210386_11061183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 689 | Open in IMG/M |
| 3300021407|Ga0210383_10973565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300021474|Ga0210390_10077443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2753 | Open in IMG/M |
| 3300021475|Ga0210392_10674108 | Not Available | 769 | Open in IMG/M |
| 3300021477|Ga0210398_10091262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2473 | Open in IMG/M |
| 3300021861|Ga0213853_10472478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 569 | Open in IMG/M |
| 3300024288|Ga0179589_10569812 | Not Available | 529 | Open in IMG/M |
| 3300025913|Ga0207695_11712468 | Not Available | 510 | Open in IMG/M |
| 3300027370|Ga0209010_1041483 | Not Available | 785 | Open in IMG/M |
| 3300027568|Ga0208042_1058295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans | 984 | Open in IMG/M |
| 3300027568|Ga0208042_1174439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 535 | Open in IMG/M |
| 3300027625|Ga0208044_1036437 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
| 3300027676|Ga0209333_1172741 | Not Available | 577 | Open in IMG/M |
| 3300027692|Ga0209530_1001977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8153 | Open in IMG/M |
| 3300027698|Ga0209446_1028130 | Not Available | 1406 | Open in IMG/M |
| 3300027729|Ga0209248_10010593 | Not Available | 2905 | Open in IMG/M |
| 3300027737|Ga0209038_10273917 | Not Available | 504 | Open in IMG/M |
| 3300027767|Ga0209655_10230954 | Not Available | 605 | Open in IMG/M |
| 3300027812|Ga0209656_10091895 | Not Available | 1609 | Open in IMG/M |
| 3300027812|Ga0209656_10215887 | Not Available | 922 | Open in IMG/M |
| 3300027812|Ga0209656_10498712 | Not Available | 532 | Open in IMG/M |
| 3300027824|Ga0209040_10020867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4284 | Open in IMG/M |
| 3300027824|Ga0209040_10044152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2727 | Open in IMG/M |
| 3300027824|Ga0209040_10099412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1650 | Open in IMG/M |
| 3300027824|Ga0209040_10109176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1553 | Open in IMG/M |
| 3300027824|Ga0209040_10397537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans | 641 | Open in IMG/M |
| 3300027826|Ga0209060_10107462 | Not Available | 1304 | Open in IMG/M |
| 3300027829|Ga0209773_10043278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1807 | Open in IMG/M |
| 3300027855|Ga0209693_10269386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 833 | Open in IMG/M |
| 3300027867|Ga0209167_10197161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 1071 | Open in IMG/M |
| 3300027867|Ga0209167_10382562 | Not Available | 766 | Open in IMG/M |
| 3300027889|Ga0209380_10563762 | Not Available | 661 | Open in IMG/M |
| 3300027894|Ga0209068_10366209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans | 818 | Open in IMG/M |
| 3300027895|Ga0209624_10939501 | Not Available | 563 | Open in IMG/M |
| 3300027908|Ga0209006_10213360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 1672 | Open in IMG/M |
| 3300027908|Ga0209006_10597589 | Not Available | 912 | Open in IMG/M |
| 3300028742|Ga0302220_10380344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300029944|Ga0311352_10135736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2139 | Open in IMG/M |
| 3300029999|Ga0311339_10482493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1266 | Open in IMG/M |
| 3300030007|Ga0311338_10054953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5265 | Open in IMG/M |
| 3300030007|Ga0311338_10398474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 1478 | Open in IMG/M |
| 3300030524|Ga0311357_10748197 | Not Available | 883 | Open in IMG/M |
| 3300031231|Ga0170824_114061999 | Not Available | 548 | Open in IMG/M |
| 3300031231|Ga0170824_118752299 | Not Available | 588 | Open in IMG/M |
| 3300031525|Ga0302326_10720962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1453 | Open in IMG/M |
| 3300031708|Ga0310686_111691069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
| 3300031708|Ga0310686_111962673 | Not Available | 640 | Open in IMG/M |
| 3300031708|Ga0310686_112490401 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
| 3300031708|Ga0310686_113223061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1441 | Open in IMG/M |
| 3300031718|Ga0307474_11308874 | Not Available | 572 | Open in IMG/M |
| 3300031781|Ga0318547_10692676 | Not Available | 633 | Open in IMG/M |
| 3300031941|Ga0310912_11461845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → unclassified Phyllobacteriaceae → Phyllobacteriaceae bacterium | 515 | Open in IMG/M |
| 3300032160|Ga0311301_10462348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1904 | Open in IMG/M |
| 3300032160|Ga0311301_11028698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1084 | Open in IMG/M |
| 3300032261|Ga0306920_103809115 | Not Available | 551 | Open in IMG/M |
| 3300032805|Ga0335078_12693488 | Not Available | 507 | Open in IMG/M |
| 3300032893|Ga0335069_10242609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2172 | Open in IMG/M |
| 3300032893|Ga0335069_11906899 | Not Available | 628 | Open in IMG/M |
| 3300032895|Ga0335074_10577457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 1132 | Open in IMG/M |
| 3300032895|Ga0335074_11239780 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300032896|Ga0335075_10171603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2657 | Open in IMG/M |
| 3300032896|Ga0335075_11436336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300032955|Ga0335076_11246312 | Not Available | 628 | Open in IMG/M |
| 3300032955|Ga0335076_11774449 | Not Available | 506 | Open in IMG/M |
| 3300033134|Ga0335073_10230562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2273 | Open in IMG/M |
| 3300033134|Ga0335073_10369494 | Not Available | 1691 | Open in IMG/M |
| 3300033134|Ga0335073_10589469 | Not Available | 1245 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.80% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.98% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 9.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.32% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 6.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.27% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.66% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.66% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.05% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.05% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.05% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.44% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.44% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.83% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.22% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.22% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.22% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010369 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 3) | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011418 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaG | Host-Associated | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_101975512 | 3300001593 | Forest Soil | MRYVLVLLVAVTMACGAAASVTISLAPAYAVDNAKGY* |
| JGI12635J15846_102068343 | 3300001593 | Forest Soil | MRYLLILLVAVTMACGAAASVTISLAPAHVAYNGEGY* |
| JGIcombinedJ26739_1003754803 | 3300002245 | Forest Soil | MQYLLLLLVAVTMACGAAATVTIELAPAYADASATGY* |
| Ga0062384_1003303581 | 3300004082 | Bog Forest Soil | AWVAGGTMQYLLILLVVITMACGAAASVTISLAPAYADDSGKGY* |
| Ga0062387_1016111062 | 3300004091 | Bog Forest Soil | RERTMRGLLVLLVALTMACGTAASVTIAHAPAYADDVGKGY* |
| Ga0062389_1003414732 | 3300004092 | Bog Forest Soil | MVAEGTMQYLLILLVVITMACGAAASVTISLAPAYADDSGKGY* |
| Ga0070734_102242122 | 3300005533 | Surface Soil | MQYLLILMLAITMACGAAAGVTISMAPAYADDSGKGY* |
| Ga0070735_101900943 | 3300005534 | Surface Soil | MQYLLILLVAVTMACGAAAGVTIAFAPAYADAANTNGY* |
| Ga0068853_1015284581 | 3300005539 | Corn Rhizosphere | LGTMHYLLILLVALTLACGAAATATIAFAPAYADAGAKGYDSEASP* |
| Ga0070733_106311491 | 3300005541 | Surface Soil | RHSMRSLLVLLIALTIACGAGASVSISLASAHTDHASRGY* |
| Ga0070762_110706201 | 3300005602 | Soil | LGTMHYLLLLLVAVTMACGAAATVTIELAPAYADASATGY* |
| Ga0070763_101447622 | 3300005610 | Soil | MHYLLLLLVAVTMACGAAATVTIELAPAYADASATGY* |
| Ga0070763_106319282 | 3300005610 | Soil | MQYLLILLVVVTMACGAAATVTIELAPAYADASATGY* |
| Ga0070764_101216623 | 3300005712 | Soil | MQYLLILLVAVTLACGAAATATIVLAPAYADAGAQGYSSETNP* |
| Ga0070766_107594592 | 3300005921 | Soil | YLLILLVAITMACGAAAGVTIALAPAYADDSGKGY* |
| Ga0075029_1010302641 | 3300006052 | Watersheds | MQYLLILMLAITMACGAAAGVTISLAPAYADDSSKGY* |
| Ga0075017_1002407183 | 3300006059 | Watersheds | ALDSAMQYLLILLVAVTMACGAAASVTISLAPTYVADNGEGY* |
| Ga0075015_1002252912 | 3300006102 | Watersheds | MKRAGRVAEGTMQYLLILLVAITMACGAAASVTISLAPAYADNSAKGY* |
| Ga0075014_1009582561 | 3300006174 | Watersheds | MRSLLVLLVALTMACGAAASVTISLAPAYADDAGKGY* |
| Ga0075425_1008681173 | 3300006854 | Populus Rhizosphere | MQYLLILLVALTMACGAAASVTIAFAPAYADAGVNG |
| Ga0075424_1018284352 | 3300006904 | Populus Rhizosphere | MQYLLILLVALTMACGAAASVTIAFAPAYADAGVNGY* |
| Ga0079219_124800482 | 3300006954 | Agricultural Soil | GAMQYLLILLVALTMACGAAASVTIALAPAYADLSGAGY* |
| Ga0105240_102095711 | 3300009093 | Corn Rhizosphere | MQYLLILLVALTMACGAAAGVTIAFAPAYADASTNGY* |
| Ga0105240_102282373 | 3300009093 | Corn Rhizosphere | MHYLLILLVALTLACGAAATATIAFAPAYADAGAKGYDSEASP* |
| Ga0116214_10785622 | 3300009520 | Peatlands Soil | MRSLLILLIALTMACGAAACVTGSLLPAYADDPGKGY* |
| Ga0116222_11170762 | 3300009521 | Peatlands Soil | MQYLLILLVVLTMACGAAAGVTIALAPAYADNSSKGY* |
| Ga0116218_13610742 | 3300009522 | Peatlands Soil | LLALLVALTMACGAAASVTIALAPAYADDASKGY* |
| Ga0116218_13960972 | 3300009522 | Peatlands Soil | MQQDTEAIMRKLLVLLVALTVGCGAAASTTISLAPAYADDSASGY* |
| Ga0116221_14062481 | 3300009523 | Peatlands Soil | MQYLLILLVVLTMACGPAAGVTIALAPAYADNSSKGY* |
| Ga0116220_100417572 | 3300009525 | Peatlands Soil | MRSLLVLLVALTMACGAAASVTIALAPAYADDASKGY* |
| Ga0105237_103420683 | 3300009545 | Corn Rhizosphere | MQYLLVLLVALTMACGAAAGVIIAFASAYADASTNGY* |
| Ga0105237_121765782 | 3300009545 | Corn Rhizosphere | VALTLACGAAATATIAFAPAYADAGAKGYDSEASP* |
| Ga0116215_10557751 | 3300009672 | Peatlands Soil | RSRETKMRSLLILLIALTMACGAAACVTGSLLPAYADDPGKGY* |
| Ga0116224_106388551 | 3300009683 | Peatlands Soil | MRSLLVLLVALTMACGAAASLTVSLAPAYADDAGKGYYSGLR* |
| Ga0116216_100181736 | 3300009698 | Peatlands Soil | MRSLLILLIALTMACGAAACLTGSLLPAYADDPGKGY* |
| Ga0116217_108370931 | 3300009700 | Peatlands Soil | MRSLLILLVALTMACGAAASLTVSLAPAYADDAGKGYYSGLR* |
| Ga0123356_116877112 | 3300010049 | Termite Gut | MQYLLILLVAVTMACGAAATVTIALAPAYADGGAKGYYSEANP* |
| Ga0131853_105072942 | 3300010162 | Termite Gut | MQYLLILLVVLTMACAAAASVTIAFAPAYADDSGKGY* |
| Ga0074046_100812523 | 3300010339 | Bog Forest Soil | MQQDTEPIMRKLLALLVALTVGCGAAASITISLAPAYADDSASGY* |
| Ga0074046_101789122 | 3300010339 | Bog Forest Soil | METTMRSLLVLLVVLTMACGAAAGLTVSLAHAYADDAGKGY* |
| Ga0074046_102064613 | 3300010339 | Bog Forest Soil | QRRQVAEGAMRSLLALLVVLTLACGAAAGVTVALAPAYADAGRGY* |
| Ga0074046_103085792 | 3300010339 | Bog Forest Soil | MRKVLVLLVALTIACGAAATVSIMELPAYADDSALGY* |
| Ga0074046_103225202 | 3300010339 | Bog Forest Soil | MRKVLVLLVALTFACGAAATVSIMELPAYADDSALGY* |
| Ga0074046_107612312 | 3300010339 | Bog Forest Soil | MRYLLIMLIGLTMACGAAAGVTITLAPAFADDAAGY* |
| Ga0074045_100453463 | 3300010341 | Bog Forest Soil | MQQDTEAIMRKLLALLVALTVGCGAAASITISLAPAYADDSASGY* |
| Ga0074045_107158662 | 3300010341 | Bog Forest Soil | MRSLLVVLVALTMACGAAATLTVSFAPAYADAAAKGY* |
| Ga0074044_104760992 | 3300010343 | Bog Forest Soil | MRNLLILLLTLTMACGTAAAVTIILAPAYADDGERGY* |
| Ga0074044_105868303 | 3300010343 | Bog Forest Soil | MQYLLILLVAVTMACGAAASVTISLAPAYVGDIAEGY* |
| Ga0074044_107553052 | 3300010343 | Bog Forest Soil | MQYLLILLMVITMACGAAASVTISLAPAYADDSGKGY* |
| Ga0136643_108938401 | 3300010369 | Termite Gut | MQYLLILLVAVTMACGAAATVTIALAPAYADVGAKGFYSEANP* |
| Ga0134128_101840453 | 3300010373 | Terrestrial Soil | MQYLLVLLVALTMACGAAAGVTIAFAPAYADASTNGY* |
| Ga0134128_129139571 | 3300010373 | Terrestrial Soil | MQYLLILLMALTMACGAAAGVTIAFAPAYADAGGGY* |
| Ga0126381_1021847671 | 3300010376 | Tropical Forest Soil | MQYLLILLVAVTVACGAAATVTIALAPAYADGGAKGYYSEANP* |
| Ga0126381_1040607121 | 3300010376 | Tropical Forest Soil | MQYLLILLVLLTMACGAAASVTIAFAPAYADASGNGY* |
| Ga0136449_1000502062 | 3300010379 | Peatlands Soil | MRSLLVLLVALTLACGAAVCLTISLPPAYADGAGKGY* |
| Ga0136449_1007026971 | 3300010379 | Peatlands Soil | TETTMRSLLVLLVALTMACGAAASVTISLAPAYADDAGKGY* |
| Ga0136449_1018952942 | 3300010379 | Peatlands Soil | RSLLILLVALTMACGAAASLTVSLAPAYADDAGKGYYSGLR* |
| Ga0134126_107698252 | 3300010396 | Terrestrial Soil | MQYLLILLVALTMACGAAASVTIAFAPAYADAANTNGY* |
| Ga0134121_124198502 | 3300010401 | Terrestrial Soil | MQYLLILLVALTVACGAAAGVTIALAPAYADNSGKGY* |
| Ga0153954_10026204 | 3300011418 | Attine Ant Fungus Gardens | MHYLLILLVALTVACGAAASVTIAFAPAYADNSANGY* |
| Ga0164301_118465471 | 3300012960 | Soil | MQYLLILLVAVTMACGAAATVTIELAPAYADASATGY* |
| Ga0164307_114872981 | 3300012987 | Soil | MHYLLILLVAVTMACGAAATVTIELAPAYADASATGY* |
| Ga0157374_119940782 | 3300013296 | Miscanthus Rhizosphere | MQYLLILLVALTVACGAAAGVTIALAPAYADNSSKGY* |
| Ga0181532_104640362 | 3300014164 | Bog | MQSLLVLLVALTMACGAAASVTISLAPAYADDAGKGY* |
| Ga0181532_104761811 | 3300014164 | Bog | LLVLLVALTMACGAAASLTISLAPAYADDAGKGY* |
| Ga0181523_100904994 | 3300014165 | Bog | MRSLLVLLVALTMACGSAAGLTVSLAPAYADDAGKGY* |
| Ga0181535_107980661 | 3300014199 | Bog | ADTETTMRSLLVLLVALTMACGAAASLTISLAPAYADDAGKGY* |
| Ga0181526_103803921 | 3300014200 | Bog | MRSLLVLLVALTMACGAAASLTISLAPAYADDAGKGY* |
| Ga0182035_109715483 | 3300016341 | Soil | MRKLLVLLIVLTVACGMAAGVTITLAPAYADDGGSEG |
| Ga0187818_105020011 | 3300017823 | Freshwater Sediment | QQQQGRETTMRSLFVLLVALTLACGAAAGVTISLAPAHADDVAKGY |
| Ga0187879_100141793 | 3300017946 | Peatland | MQYLLILLVVITMACGAAASVTISLAPAYADDSGKGY |
| Ga0187879_106086432 | 3300017946 | Peatland | TETTMRSLLILLIALTMACGAAACVTGSLLPAYADDPGKGY |
| Ga0187879_107217891 | 3300017946 | Peatland | MQYLLILLVVITMACGAAASVTISLAPAHADDSAKGY |
| Ga0187817_102777671 | 3300017955 | Freshwater Sediment | MRKLLALLVVLTVAFGVAASFTVAHAPAYADAGADGY |
| Ga0187783_101228442 | 3300017970 | Tropical Peatland | MQYLLILLVVLTMACGAAAGVTIAFAPAHADNSGKGY |
| Ga0187783_112229101 | 3300017970 | Tropical Peatland | MQYLLILLVVLTMACGAAASVTIAFAPAYADASGKGY |
| Ga0187822_100853242 | 3300017994 | Freshwater Sediment | MQYLLVLLVALTMACGAAASVTIAFAPAYADASTNGY |
| Ga0187822_102613151 | 3300017994 | Freshwater Sediment | MQYLLILLVLLTVACGAAASVTIAFAPAYADASGKGY |
| Ga0187871_100066078 | 3300018042 | Peatland | MRYLLILLVAVTMACGAAASVTISLAPAHVAYNGEGY |
| Ga0187871_104233551 | 3300018042 | Peatland | MQYVFILLVAVTMTFGAAAKVTISLAPAYAEDSGKGY |
| Ga0187765_110472852 | 3300018060 | Tropical Peatland | MQYLLILMVAITMACGAAASVTISLAPAYADDSGKGY |
| Ga0206356_111317383 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MQYLLILLVALTMACGAAAGVTIAFAPAYADASTNGY |
| Ga0210395_100836032 | 3300020582 | Soil | MQYLLLLLVAVTMACGAAATVTIELAPAYADASATGY |
| Ga0210401_108411401 | 3300020583 | Soil | RGTAGLGTMHYLLLLLVAVTMACGAAATVTIELAPAYADASATGY |
| Ga0210401_115380792 | 3300020583 | Soil | LGTMHYLLLLLVAVTMACGAAATVTIELAPAYADASA |
| Ga0210406_111364541 | 3300021168 | Soil | LGTMHYLLLLLVAVTMACGAAATVTIELAPAYADASATGY |
| Ga0210408_108492261 | 3300021178 | Soil | LGTMHYLLLLLVAVTMACGAAATVTIELAPAYADASATG |
| Ga0210396_114058332 | 3300021180 | Soil | VGWGTMQYLLILLVILTVACGAAAGVTIALAPAYADDSGKGY |
| Ga0210388_102451141 | 3300021181 | Soil | MQYLLILLVAITMACGAAAGVTIALAPAYADDSAKGY |
| Ga0213872_100593552 | 3300021361 | Rhizosphere | VAARERMMRGLLVLLVALTMACGAAASVTIALAPALADDAGSRGY |
| Ga0210393_101538341 | 3300021401 | Soil | LGTMQYLLILLVAITMACGAAAGVTIALAPAYADDSAKGY |
| Ga0210393_101749192 | 3300021401 | Soil | MHYLLLLLVAVTMACGAAATVTIELAPAYADASATGY |
| Ga0210393_102186233 | 3300021401 | Soil | YLLILLVALTMACGAAATVTIELAPAYADASAKGY |
| Ga0210385_101366053 | 3300021402 | Soil | MQYMLILLVVITMACGAAASVTISLVPAYADDSAKGY |
| Ga0210385_111973271 | 3300021402 | Soil | LGTMQYLLILLVAITMACGAAAGVTIALAPAYADDSAK |
| Ga0210387_104670842 | 3300021405 | Soil | MQYLLILLVAVTMACGAAATVTIELAPAYADASATGY |
| Ga0210386_100897642 | 3300021406 | Soil | MQYLLMLLVAVTMACGVAATVTIELAPAYADASAKGY |
| Ga0210386_110611832 | 3300021406 | Soil | MQYLLILLVAVTMACGAAATVTIELVPAYADASAPGY |
| Ga0210383_109735652 | 3300021407 | Soil | MQYLLILMVAITMACGAAASVTISLAPAYADGGKGY |
| Ga0210390_100774431 | 3300021474 | Soil | GTMQYLLLLLVAVTMACGAAATVTIELAPAYADASATGY |
| Ga0210392_106741082 | 3300021475 | Soil | TAGLGTMHYLLLLLVAVTMACGAAATVTIELAPAYADASATGY |
| Ga0210398_100912621 | 3300021477 | Soil | LQYLLMLLVAVTMACGVAATVTIELAPAYADASATGY |
| Ga0213853_104724782 | 3300021861 | Watersheds | MRSLLVLLVALTMACGAAASVTISLAPAYAVDAGKGY |
| Ga0179589_105698121 | 3300024288 | Vadose Zone Soil | MQYLLILLVALTVACGAAAGVTIALAPAYADNSSKGY |
| Ga0207695_117124681 | 3300025913 | Corn Rhizosphere | LGTMHYLLILLVALTLACGAAATATIAFAPAYADAGAKGYDSEASP |
| Ga0209010_10414831 | 3300027370 | Forest Soil | LGTMQYLLMLLVAVTMACGVAATVTIELAPAYADASAKGY |
| Ga0208042_10582952 | 3300027568 | Peatlands Soil | MQYLLILLVVLTMACGAAAGVTIALAPAYADNSSKGY |
| Ga0208042_11744391 | 3300027568 | Peatlands Soil | MRSLLVLLVALTMACGAAASVTIALAPAYADDASKGY |
| Ga0208044_10364373 | 3300027625 | Peatlands Soil | MRSLLILLIALTMACGAAACVTGSLLPAYADDPGKGY |
| Ga0209333_11727413 | 3300027676 | Forest Soil | MRYLLILLVAVTMACGAAASVTISLAPAHVAYNGE |
| Ga0209530_10019775 | 3300027692 | Forest Soil | LGTLQYLLMLLVAVTMACGVAATVTIELAPAYADASAAGY |
| Ga0209446_10281302 | 3300027698 | Bog Forest Soil | MQYLLILLVAVTMACGAAASVTISLAPAYVGDIAEGY |
| Ga0209248_100105933 | 3300027729 | Bog Forest Soil | VGLAEGTMQYLLILLVVITMACGAAASVTISLVPAYADDSAKGY |
| Ga0209038_102739171 | 3300027737 | Bog Forest Soil | MQYLLILLVVVTMACGAAASVTISLAPAYADDSGKGY |
| Ga0209655_102309542 | 3300027767 | Bog Forest Soil | MQYLLILLVVITMACGAAASVTISLVPAYADDSAKGY |
| Ga0209656_100918954 | 3300027812 | Bog Forest Soil | QDTEPIMRKLLALLVALTVGCGAAASITISLAPAYADDSASGY |
| Ga0209656_102158872 | 3300027812 | Bog Forest Soil | METTMRSLLVLLVALTIACGAAAGLTVSLAPAYADDAGKGY |
| Ga0209656_104987122 | 3300027812 | Bog Forest Soil | MRKVLVLLVALTIACGAAATVSIMELPAYADDSALGY |
| Ga0209040_100208673 | 3300027824 | Bog Forest Soil | MRGLLVLLVALTMACGAAASVTIALAPALADDAGKGY |
| Ga0209040_100441522 | 3300027824 | Bog Forest Soil | MRKVLVLLVALTFACGAAATVSIMELPAYADDSALGY |
| Ga0209040_100994122 | 3300027824 | Bog Forest Soil | MRSLLVVLVALTMACGAAATLTVSFAPAYADAAAKGY |
| Ga0209040_101091762 | 3300027824 | Bog Forest Soil | MRKLLVLLVALTMACGAAAGITINLAPAFADDAIKGY |
| Ga0209040_103975372 | 3300027824 | Bog Forest Soil | MRSLLVVLVALTMACGAAATLTVSFAPAYADAAGKGY |
| Ga0209060_101074622 | 3300027826 | Surface Soil | MQYLLILMLAITMACGAAAGVTISMAPAYADDSGKGY |
| Ga0209773_100432782 | 3300027829 | Bog Forest Soil | MQCLLILLVVITMACGAAASITISLAPAYADASNKGY |
| Ga0209693_102693862 | 3300027855 | Soil | MQYLLILLVILTVACGAAAGVTIALAPAYADDSGKGY |
| Ga0209167_101971611 | 3300027867 | Surface Soil | MQYLLILLVAVTMACGAAAGVTIAFAPAYADAANTNGY |
| Ga0209167_103825621 | 3300027867 | Surface Soil | MQYLLILLVALTMACGAAASVTIAFAPAYADAANTNGY |
| Ga0209380_105637622 | 3300027889 | Soil | QYLLILLVAITMACGAAAGVTIALAPAYADDSGKGY |
| Ga0209068_103662092 | 3300027894 | Watersheds | MRYLLILLVAVTMACGAAASVTISLAPTFVADNGEGY |
| Ga0209624_109395011 | 3300027895 | Forest Soil | LGTMQYLLILLVAVTMACGAAATVTIELAPAYADASAPGY |
| Ga0209006_102133601 | 3300027908 | Forest Soil | MHYLLILLVAVTMACGAAATVTIELAPAYADASATGY |
| Ga0209006_105975891 | 3300027908 | Forest Soil | LGTMQYLLILLVALTMACGAAATVTIELAPAYADASAKGY |
| Ga0302220_103803441 | 3300028742 | Palsa | GTMQYLLILLVVITMACGAAASVTISLAPAYADDSGKGY |
| Ga0311352_101357363 | 3300029944 | Palsa | EGTMQYMLILLVVITMACGAAASVTISLAPAYADDSGKGY |
| Ga0311339_104824932 | 3300029999 | Palsa | MQYLLILLVVITMACGAAASVTISLAPAYADASDEGY |
| Ga0311338_100549536 | 3300030007 | Palsa | MQYMLILLVVITMACGAAASVTISLAPAYADDSGKGY |
| Ga0311338_103984742 | 3300030007 | Palsa | MQYLLILLVAVTLACGAAATVTIALAPAYADASANGYSSETNP |
| Ga0311357_107481971 | 3300030524 | Palsa | LGTMQYLLILLVAVTLACGAAATVTIALAPAYADASANGYSSETNP |
| Ga0170824_1140619991 | 3300031231 | Forest Soil | MQYLLILLVLVTMAFGAAASVTISLAPAYADDSGKGY |
| Ga0170824_1187522992 | 3300031231 | Forest Soil | MQYLLILLVAITMACGAAASVTISLAPAYADNSAKGY |
| Ga0302326_107209623 | 3300031525 | Palsa | MQYLLILLVVITMACGAAASVTISLAPAYADASDKGY |
| Ga0310686_1116910692 | 3300031708 | Soil | LQYLLMLLVAVTMACGVAATVTIELAPAYADASASGY |
| Ga0310686_1119626731 | 3300031708 | Soil | MHYLLLLLVAVTMACGAAATVTIELAPAFADASASGY |
| Ga0310686_1124904013 | 3300031708 | Soil | MQNLLILLVVLTMACGAAASVTISLAPAYADDSGGY |
| Ga0310686_1132230612 | 3300031708 | Soil | MQYLLILLVAVTVACGAAATATIVLAPAYADAGANGYYSETNP |
| Ga0307474_113088741 | 3300031718 | Hardwood Forest Soil | LGTMQYLLILLVAVTMACGAAATVTIELAPAYADANATGY |
| Ga0318547_106926762 | 3300031781 | Soil | MRSLLVLLVALTMACGAAASVTISLAPAYADNAGKGY |
| Ga0310912_114618452 | 3300031941 | Soil | MQYLLILLVALTMACGAAAGVTIAFAPAYADNSGKGY |
| Ga0311301_104623482 | 3300032160 | Peatlands Soil | MRSLLVLLVALTMACGAAASVTISLAPAYADDAGKGY |
| Ga0311301_110286981 | 3300032160 | Peatlands Soil | MRSLLILLVALTMACGAAASLTVSLAPAYADDAGKGYYSGLR |
| Ga0306920_1038091151 | 3300032261 | Soil | MQYLLILLVALTMACGAAASVTISLAPAYADDSGKGY |
| Ga0335078_126934882 | 3300032805 | Soil | MQYLLILLVVLTMACGAAASLTIAFAPAYADASGKGY |
| Ga0335069_102426093 | 3300032893 | Soil | KLQYLLIVLVLLTLACGAAASVTVSLAPAYADNAGQGY |
| Ga0335069_119068992 | 3300032893 | Soil | LQYLLIVLVLLTLACGAAASVTVSLAPAYADNAGQGY |
| Ga0335074_105774571 | 3300032895 | Soil | WGTMQYLLILLVLLTVACGAAASVTIAFAPAYADASGKGY |
| Ga0335074_112397802 | 3300032895 | Soil | MQYLLILLVLLTIACGAAASVTIAFAPAYADASGNGY |
| Ga0335075_101716032 | 3300032896 | Soil | MQYLLILLVLLTMACGAAASFTIAFAPAYADASGKGY |
| Ga0335075_114363361 | 3300032896 | Soil | MQYLLILLVAVTVACGAAATVTIALAPAYADGGAKGYYSEANP |
| Ga0335076_112463121 | 3300032955 | Soil | MQYLLILLLAVTVACGAAASLTISLTPAYVRDNGKGY |
| Ga0335076_117744492 | 3300032955 | Soil | VQYLLILLMLVTLACGAAASVTISLAPAYADASVKGY |
| Ga0335073_102305624 | 3300033134 | Soil | GWGTMQYLLILLVLLTVACGAAASVTIAFAPAYADASGKGY |
| Ga0335073_103694942 | 3300033134 | Soil | MRYVFVLLVAVALACGAAASVTISLAPAYAVDNAKGY |
| Ga0335073_105894691 | 3300033134 | Soil | MQYLLILLLAVTVACGAAASVTISLTPAYVRDNGEGY |
| ⦗Top⦘ |