


| Basic Information | |
|---|---|
| Family ID | F039216 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 164 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 164 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.44 % |
| % of genes near scaffold ends (potentially truncated) | 26.22 % |
| % of genes from short scaffolds (< 2000 bps) | 92.07 % |
| Associated GOLD sequencing projects | 143 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.805 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.146 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.146 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.902 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 22.73% Coil/Unstructured: 77.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 164 Family Scaffolds |
|---|---|---|
| PF13463 | HTH_27 | 26.83 |
| PF00490 | ALAD | 9.15 |
| PF12802 | MarR_2 | 3.05 |
| PF06271 | RDD | 1.22 |
| PF03401 | TctC | 0.61 |
| PF03600 | CitMHS | 0.61 |
| PF07007 | LprI | 0.61 |
| PF00528 | BPD_transp_1 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
|---|---|---|---|
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 9.15 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 1.22 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.61 |
| COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.80 % |
| Unclassified | root | N/A | 37.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100590944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300000531|CNBas_1003195 | Not Available | 913 | Open in IMG/M |
| 3300001205|C688J13580_1036962 | Not Available | 634 | Open in IMG/M |
| 3300001305|C688J14111_10034225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1519 | Open in IMG/M |
| 3300001661|JGI12053J15887_10197747 | Not Available | 1024 | Open in IMG/M |
| 3300002092|JGI24218J26658_1000007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 534170 | Open in IMG/M |
| 3300005175|Ga0066673_10230826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1066 | Open in IMG/M |
| 3300005331|Ga0070670_100133377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2146 | Open in IMG/M |
| 3300005468|Ga0070707_102083228 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300005535|Ga0070684_102358727 | Not Available | 501 | Open in IMG/M |
| 3300005540|Ga0066697_10486914 | Not Available | 703 | Open in IMG/M |
| 3300005543|Ga0070672_100900429 | Not Available | 781 | Open in IMG/M |
| 3300005548|Ga0070665_100024314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 6100 | Open in IMG/M |
| 3300005548|Ga0070665_100892954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 901 | Open in IMG/M |
| 3300005552|Ga0066701_10025144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3023 | Open in IMG/M |
| 3300005563|Ga0068855_101824249 | Not Available | 617 | Open in IMG/M |
| 3300005564|Ga0070664_101598132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 617 | Open in IMG/M |
| 3300005577|Ga0068857_100168397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1991 | Open in IMG/M |
| 3300005577|Ga0068857_100343351 | Not Available | 1381 | Open in IMG/M |
| 3300005578|Ga0068854_101056718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300005617|Ga0068859_101045579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 897 | Open in IMG/M |
| 3300005617|Ga0068859_102020279 | Not Available | 636 | Open in IMG/M |
| 3300005844|Ga0068862_100329979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1410 | Open in IMG/M |
| 3300005937|Ga0081455_10002109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 23709 | Open in IMG/M |
| 3300005983|Ga0081540_1018147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 4327 | Open in IMG/M |
| 3300006031|Ga0066651_10406347 | Not Available | 726 | Open in IMG/M |
| 3300006041|Ga0075023_100488648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300006048|Ga0075363_100404592 | Not Available | 802 | Open in IMG/M |
| 3300006048|Ga0075363_100695927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
| 3300006051|Ga0075364_11053594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300006178|Ga0075367_10214705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 1203 | Open in IMG/M |
| 3300006358|Ga0068871_100373295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1265 | Open in IMG/M |
| 3300006358|Ga0068871_101575506 | Not Available | 622 | Open in IMG/M |
| 3300006604|Ga0074060_11878419 | Not Available | 632 | Open in IMG/M |
| 3300006791|Ga0066653_10318452 | Not Available | 784 | Open in IMG/M |
| 3300006800|Ga0066660_10132504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1820 | Open in IMG/M |
| 3300006804|Ga0079221_10466044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 808 | Open in IMG/M |
| 3300006844|Ga0075428_100891853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 943 | Open in IMG/M |
| 3300006844|Ga0075428_102414283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300006853|Ga0075420_100484282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1068 | Open in IMG/M |
| 3300007788|Ga0099795_10345477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
| 3300009012|Ga0066710_104455283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300009036|Ga0105244_10235664 | Not Available | 856 | Open in IMG/M |
| 3300009092|Ga0105250_10060559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1521 | Open in IMG/M |
| 3300009094|Ga0111539_12284176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 628 | Open in IMG/M |
| 3300009100|Ga0075418_12177853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 604 | Open in IMG/M |
| 3300009146|Ga0105091_10344872 | Not Available | 734 | Open in IMG/M |
| 3300009148|Ga0105243_11712151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300009157|Ga0105092_10728659 | Not Available | 578 | Open in IMG/M |
| 3300009177|Ga0105248_10383749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1582 | Open in IMG/M |
| 3300009610|Ga0105340_1191974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 857 | Open in IMG/M |
| 3300009795|Ga0105059_1010432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 898 | Open in IMG/M |
| 3300009802|Ga0105073_1019218 | Not Available | 709 | Open in IMG/M |
| 3300009802|Ga0105073_1049302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300009803|Ga0105065_1037794 | Not Available | 644 | Open in IMG/M |
| 3300009805|Ga0105079_1020916 | Not Available | 625 | Open in IMG/M |
| 3300009840|Ga0126313_10530442 | Not Available | 945 | Open in IMG/M |
| 3300010036|Ga0126305_10121462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1596 | Open in IMG/M |
| 3300010037|Ga0126304_10077380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2070 | Open in IMG/M |
| 3300010038|Ga0126315_10634144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 693 | Open in IMG/M |
| 3300010040|Ga0126308_10106672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1724 | Open in IMG/M |
| 3300010041|Ga0126312_10171291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1512 | Open in IMG/M |
| 3300010041|Ga0126312_11015984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
| 3300010042|Ga0126314_10103390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1938 | Open in IMG/M |
| 3300010047|Ga0126382_12257864 | Not Available | 525 | Open in IMG/M |
| 3300010362|Ga0126377_12111177 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
| 3300010373|Ga0134128_11072014 | Not Available | 890 | Open in IMG/M |
| 3300010401|Ga0134121_11905001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300010999|Ga0138505_100052525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 590 | Open in IMG/M |
| 3300011119|Ga0105246_10440971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1092 | Open in IMG/M |
| 3300011398|Ga0137348_1051925 | Not Available | 697 | Open in IMG/M |
| 3300011406|Ga0137454_1085649 | Not Available | 543 | Open in IMG/M |
| 3300011430|Ga0137423_1202900 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
| 3300012198|Ga0137364_10749953 | Not Available | 737 | Open in IMG/M |
| 3300012201|Ga0137365_10324251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1140 | Open in IMG/M |
| 3300012203|Ga0137399_11268434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 620 | Open in IMG/M |
| 3300012204|Ga0137374_10133146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2259 | Open in IMG/M |
| 3300012207|Ga0137381_10364344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1260 | Open in IMG/M |
| 3300012212|Ga0150985_118019821 | Not Available | 650 | Open in IMG/M |
| 3300012358|Ga0137368_10338371 | Not Available | 1005 | Open in IMG/M |
| 3300012918|Ga0137396_10108924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1986 | Open in IMG/M |
| 3300012922|Ga0137394_10759631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 814 | Open in IMG/M |
| 3300012941|Ga0162652_100021425 | Not Available | 907 | Open in IMG/M |
| 3300012943|Ga0164241_10730222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 719 | Open in IMG/M |
| 3300012951|Ga0164300_10085654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1348 | Open in IMG/M |
| 3300012955|Ga0164298_10203668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1159 | Open in IMG/M |
| 3300012961|Ga0164302_10167425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1314 | Open in IMG/M |
| 3300014745|Ga0157377_10489036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 858 | Open in IMG/M |
| 3300014968|Ga0157379_10894966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 842 | Open in IMG/M |
| 3300015371|Ga0132258_12870776 | Not Available | 1198 | Open in IMG/M |
| 3300017792|Ga0163161_11347186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300018000|Ga0184604_10042370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1220 | Open in IMG/M |
| 3300018027|Ga0184605_10417348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 597 | Open in IMG/M |
| 3300018028|Ga0184608_10331627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 668 | Open in IMG/M |
| 3300018052|Ga0184638_1190018 | Not Available | 726 | Open in IMG/M |
| 3300018054|Ga0184621_10151504 | Not Available | 835 | Open in IMG/M |
| 3300018061|Ga0184619_10443645 | Not Available | 580 | Open in IMG/M |
| 3300018066|Ga0184617_1058374 | Not Available | 999 | Open in IMG/M |
| 3300018066|Ga0184617_1206322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 586 | Open in IMG/M |
| 3300018068|Ga0184636_1298526 | Not Available | 567 | Open in IMG/M |
| 3300018072|Ga0184635_10032586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1964 | Open in IMG/M |
| 3300018073|Ga0184624_10156980 | Not Available | 1002 | Open in IMG/M |
| 3300018076|Ga0184609_10103614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1280 | Open in IMG/M |
| 3300018082|Ga0184639_10122443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1378 | Open in IMG/M |
| 3300018082|Ga0184639_10172431 | Not Available | 1149 | Open in IMG/M |
| 3300018429|Ga0190272_10867958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 842 | Open in IMG/M |
| 3300018433|Ga0066667_11178386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 665 | Open in IMG/M |
| 3300018433|Ga0066667_11439943 | Not Available | 606 | Open in IMG/M |
| 3300018465|Ga0190269_10134117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1259 | Open in IMG/M |
| 3300018466|Ga0190268_12303707 | Not Available | 508 | Open in IMG/M |
| 3300018468|Ga0066662_11118779 | Not Available | 789 | Open in IMG/M |
| 3300018476|Ga0190274_10075495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2567 | Open in IMG/M |
| 3300018920|Ga0190273_10231024 | Not Available | 1184 | Open in IMG/M |
| 3300019789|Ga0137408_1378886 | Not Available | 1016 | Open in IMG/M |
| 3300019875|Ga0193701_1095058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 560 | Open in IMG/M |
| 3300020016|Ga0193696_1092216 | Not Available | 781 | Open in IMG/M |
| 3300021082|Ga0210380_10049310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1817 | Open in IMG/M |
| 3300022534|Ga0224452_1177640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 655 | Open in IMG/M |
| 3300022694|Ga0222623_10010499 | All Organisms → cellular organisms → Bacteria | 3362 | Open in IMG/M |
| 3300022756|Ga0222622_10824302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 678 | Open in IMG/M |
| 3300022886|Ga0247746_1068812 | Not Available | 835 | Open in IMG/M |
| 3300025711|Ga0207696_1059129 | Not Available | 1081 | Open in IMG/M |
| 3300025728|Ga0207655_1241703 | Not Available | 516 | Open in IMG/M |
| 3300025899|Ga0207642_10421758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 803 | Open in IMG/M |
| 3300025900|Ga0207710_10160207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 1096 | Open in IMG/M |
| 3300025901|Ga0207688_10870106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 571 | Open in IMG/M |
| 3300025904|Ga0207647_10607799 | Not Available | 603 | Open in IMG/M |
| 3300025918|Ga0207662_10277238 | Not Available | 1108 | Open in IMG/M |
| 3300025920|Ga0207649_10043693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2741 | Open in IMG/M |
| 3300025922|Ga0207646_10435136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1184 | Open in IMG/M |
| 3300025925|Ga0207650_11206716 | Not Available | 644 | Open in IMG/M |
| 3300025942|Ga0207689_10184573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1720 | Open in IMG/M |
| 3300025949|Ga0207667_11960561 | Not Available | 546 | Open in IMG/M |
| 3300025972|Ga0207668_11915287 | Not Available | 534 | Open in IMG/M |
| 3300026023|Ga0207677_12216087 | Not Available | 511 | Open in IMG/M |
| 3300026035|Ga0207703_12110080 | Not Available | 540 | Open in IMG/M |
| 3300026067|Ga0207678_11389644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 621 | Open in IMG/M |
| 3300026315|Ga0209686_1211352 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300026317|Ga0209154_1123534 | Not Available | 1093 | Open in IMG/M |
| 3300026322|Ga0209687_1231505 | Not Available | 570 | Open in IMG/M |
| 3300026529|Ga0209806_1101995 | Not Available | 1221 | Open in IMG/M |
| 3300026537|Ga0209157_1127655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1169 | Open in IMG/M |
| 3300027775|Ga0209177_10469439 | Not Available | 519 | Open in IMG/M |
| 3300028379|Ga0268266_10059288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3297 | Open in IMG/M |
| 3300028379|Ga0268266_10613379 | Not Available | 1045 | Open in IMG/M |
| 3300028380|Ga0268265_10498867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1146 | Open in IMG/M |
| 3300028704|Ga0307321_1139401 | Not Available | 511 | Open in IMG/M |
| 3300028778|Ga0307288_10058144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1345 | Open in IMG/M |
| 3300028880|Ga0307300_10206284 | Not Available | 638 | Open in IMG/M |
| 3300030114|Ga0311333_10255811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 1380 | Open in IMG/M |
| 3300030521|Ga0307511_10363153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 615 | Open in IMG/M |
| 3300031226|Ga0307497_10427439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 639 | Open in IMG/M |
| 3300031232|Ga0302323_101076852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 895 | Open in IMG/M |
| 3300031507|Ga0307509_10302920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1345 | Open in IMG/M |
| 3300031521|Ga0311364_11020970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 825 | Open in IMG/M |
| 3300031938|Ga0308175_100027952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4617 | Open in IMG/M |
| 3300031938|Ga0308175_101866310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 673 | Open in IMG/M |
| 3300031938|Ga0308175_102062241 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
| 3300032012|Ga0310902_11134488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris → Rhodopseudomonas palustris BisA53 | 548 | Open in IMG/M |
| 3300032074|Ga0308173_10535539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1053 | Open in IMG/M |
| 3300033179|Ga0307507_10563622 | Not Available | 597 | Open in IMG/M |
| 3300033551|Ga0247830_11568605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 527 | Open in IMG/M |
| 3300034156|Ga0370502_0082561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1018 | Open in IMG/M |
| 3300034176|Ga0364931_0067377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1104 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.15% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 8.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.10% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.27% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.66% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.66% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.05% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.05% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.44% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.44% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.83% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.83% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 1.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.22% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.22% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.22% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.22% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.22% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.61% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.61% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.61% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.61% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.61% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
| 3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300009805 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
| 3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Host-Associated | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Host-Associated | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034156 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1005909442 | 3300000364 | Soil | MDQGFSQHFIDAGSALFTLRLRTLSHSETGPPEFETLA* |
| CNBas_10031951 | 3300000531 | Quercus Rhizosphere | VDQGFLQYFIDGERALFTLRLQALSHSETGASEIETLA* |
| C688J13580_10369621 | 3300001205 | Soil | MDQGFLQYFIDGERALFTLRLQALSHSKTGASEIATLA* |
| C688J14111_100342253 | 3300001305 | Soil | VDQGFLQYFIDGERPMFTLRLQALSHSETGPPEIETLA* |
| JGI12053J15887_101977471 | 3300001661 | Forest Soil | MDQGFLQYFIDGESLMFTLRLHPLSHSETGASEIETLA* |
| JGI24218J26658_1000007507 | 3300002092 | Lentic | VDQGFLQYFIDGERAMFTLRLQALSHSETGAAEIETLA* |
| Ga0066673_102308262 | 3300005175 | Soil | VNCRLSPADQGFLQYFIDGESTLFTLRLQALSHSETGAAEIETLA* |
| Ga0070670_1001333773 | 3300005331 | Switchgrass Rhizosphere | ESLIKPMDKGFLQHFIDREKPLFTLRLRILSHSETASPEIETVP* |
| Ga0070707_1020832281 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RLSPMDQGLLQYFIDGESALFTLRLQALSHSETGAPEIETLA* |
| Ga0070684_1023587272 | 3300005535 | Corn Rhizosphere | VDQGFLQYFIDGERAMFTLRLHPLSHSETGPPEIETLAKVCGGT |
| Ga0066697_104869141 | 3300005540 | Soil | VDQGFLQYFIDGESAMFTLRLHALSHSETGASEIETLA* |
| Ga0070672_1009004291 | 3300005543 | Miscanthus Rhizosphere | MNQGFLQYFIDGEGAMFTLRLRALSHSETGASEIETPA* |
| Ga0070665_1000243144 | 3300005548 | Switchgrass Rhizosphere | MDQGFLQYSVDGERLMFTLRLVPLSHSKTGPPEIETLA* |
| Ga0070665_1008929542 | 3300005548 | Switchgrass Rhizosphere | VDQGFLQYFIDGECAMFTLRLQALSHSETGASEIETLA* |
| Ga0066701_100251443 | 3300005552 | Soil | VDQGFLQYFIDGESALFTLRLHVLSHSETGASEIETLA* |
| Ga0068855_1018242492 | 3300005563 | Corn Rhizosphere | VDQGFLQYFIDGESALFTLRLQALSHSGTGASEIETLA* |
| Ga0070664_1015981322 | 3300005564 | Corn Rhizosphere | VDQGFLQYFIDGERAMFTLRLHPLSHSETGPPEIETLA* |
| Ga0068857_1001683973 | 3300005577 | Corn Rhizosphere | FLQYFIDGERAMFTLRLHPLSHSETGPPEIETLA* |
| Ga0068857_1003433513 | 3300005577 | Corn Rhizosphere | VDQGFLQYFIDGERAMFTLRLRALSHSETGASEIETPA* |
| Ga0068854_1010567181 | 3300005578 | Corn Rhizosphere | MDQGFLQYFIDGESALFTLRLQALSHSKTGASEIETLA* |
| Ga0068859_1010455791 | 3300005617 | Switchgrass Rhizosphere | VNQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA* |
| Ga0068859_1020202792 | 3300005617 | Switchgrass Rhizosphere | MDKGFSQRFIDGGSRVFTLRLPALSHSETGRPEIETLA* |
| Ga0068862_1003299791 | 3300005844 | Switchgrass Rhizosphere | DHEFNRVNCRLSPMDQGFLQYFIDGESALFTLRLQALSHSGTGASEIETLA* |
| Ga0081455_100021098 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDQGFLQHFIEAGSALFTLRLHPLSHSETGASEIETLA* |
| Ga0081540_10181475 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MDQGLSQHFIEVGRALFTLRLRLLSHSETGAAESETLA* |
| Ga0066651_104063471 | 3300006031 | Soil | VDQGFLQYFIDGESALFTLRLQALSHSETGASEIETLA* |
| Ga0075023_1004886483 | 3300006041 | Watersheds | KPVDQGLLQYFIDAGKAMFTLRLRPLSHSGTGPPEIETLA* |
| Ga0075363_1004045922 | 3300006048 | Populus Endosphere | MDQGLLQYFIDGESALFTLRLQALSHSKTGAPEIETPA* |
| Ga0075363_1006959271 | 3300006048 | Populus Endosphere | VDQGFLQLFIDGERTLFTLRLRTLSHSETGASEIETPA* |
| Ga0075364_110535941 | 3300006051 | Populus Endosphere | VNQGLLQYFIDGERLMFTLRLGALSHSETGAPEIETLA* |
| Ga0075367_102147053 | 3300006178 | Populus Endosphere | MDQGFLQCFIDGESALFTLRLQALSHSKTGAPEIETPA* |
| Ga0068871_1003732951 | 3300006358 | Miscanthus Rhizosphere | MDKDFLQHFIDREKPLFTLRLRILSHSETASPEIETVP* |
| Ga0068871_1015755062 | 3300006358 | Miscanthus Rhizosphere | MDKGVFATFIDGGGSLFTLRLGGLSHSETGASEIETLA* |
| Ga0074060_118784192 | 3300006604 | Soil | MDKGVFATFIDGGEPLFTLRLGGLSHSETGASEIETLANGCGE |
| Ga0066653_103184521 | 3300006791 | Soil | MDQGFLQYFIDGESALFTLRLQALSHSETGASEIETLA* |
| Ga0066660_101325042 | 3300006800 | Soil | VDQGFLQYFIDAESAMFTLRLHALSHSETGASEIETLA* |
| Ga0079221_104660442 | 3300006804 | Agricultural Soil | DSESSIKPMDKGLFARFIDGGSRVFTLRLPALSHSETGRPEIETLA* |
| Ga0075428_1008918532 | 3300006844 | Populus Rhizosphere | MDQGLLQYFIDGESALFTLRLQALSHSKTGAPEIATLA* |
| Ga0075428_1024142832 | 3300006844 | Populus Rhizosphere | MDQGFLQYFIDCESALFTLRLQALSHSGTGASEIETLA* |
| Ga0075420_1004842822 | 3300006853 | Populus Rhizosphere | MDQGFLQYFIDGERALFTLRLRPLSHSETGASEIETLA* |
| Ga0099795_103454772 | 3300007788 | Vadose Zone Soil | MDQGFLQYFIDGERALFTLRLQPLSHSETGASEIETLA* |
| Ga0066710_1044552831 | 3300009012 | Grasslands Soil | GFLQYFIDGEGAMLTLRLHALSHSETGASEIETLA |
| Ga0105244_102356642 | 3300009036 | Miscanthus Rhizosphere | MDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA* |
| Ga0105250_100605591 | 3300009092 | Switchgrass Rhizosphere | FNRVNCRLSPVDQGFLQYFIDGESALFTLRLQALSHSKTGASEIETLA* |
| Ga0111539_122841761 | 3300009094 | Populus Rhizosphere | MDQGLLQYFIDGESALFTLRLQALSHSKTGASEIETLA* |
| Ga0075418_121778531 | 3300009100 | Populus Rhizosphere | MDQGFLQYFIDGESAMFTLRLHALSHSETGASEIETLA* |
| Ga0105091_103448722 | 3300009146 | Freshwater Sediment | VDQGFLQYFIDGEGALFTLRLQALSHSETGASEIETLA* |
| Ga0105243_117121511 | 3300009148 | Miscanthus Rhizosphere | MNQGFLQYFIDGEGVMFTLRLWALSHSETGASEIETPA* |
| Ga0105092_107286592 | 3300009157 | Freshwater Sediment | MDQGFLQYFIDGEGALFTLRLQALSHSETGASEIETLA* |
| Ga0105248_103837493 | 3300009177 | Switchgrass Rhizosphere | VNFRLSSVDQVFLQYFIDGERAMFTLRLRALSHSETGASEIETLA* |
| Ga0105340_11919742 | 3300009610 | Soil | MDQGFLQYFIDGESVMFTLRLQALSHSETGASEIETLA* |
| Ga0105059_10104322 | 3300009795 | Groundwater Sand | MDQGFLQYFIDGDSVMFTLRLQALSHSETGASEIETPA* |
| Ga0105073_10192182 | 3300009802 | Groundwater Sand | MNQGFLQYFIDGERLMFTLRLRVLSHSETGASEIETP |
| Ga0105073_10493022 | 3300009802 | Groundwater Sand | VDQGFLQYFIDGDSVMFTLRLQALSHSETGASEIETLA* |
| Ga0105065_10377941 | 3300009803 | Groundwater Sand | MDQGFLQYFIDGEGAMFTLRLHPLSHSETGASEIATLA* |
| Ga0105079_10209162 | 3300009805 | Groundwater Sand | MDQGFLQHFIDGESALFTLRLQALSHSETGASEIETLA* |
| Ga0126313_105304422 | 3300009840 | Serpentine Soil | VNQGFLQYFIDGERVMFTLRLPPLSHSETGASEIETLA* |
| Ga0126305_101214622 | 3300010036 | Serpentine Soil | MNQGFLQYFVDGERLMFTLRLRALSHSETGASEIETPA* |
| Ga0126304_100773803 | 3300010037 | Serpentine Soil | VNQGFLQYFIDGDRVMFTLRLWALSHSETGASEIETLA* |
| Ga0126315_106341442 | 3300010038 | Serpentine Soil | NQGFLQYFIDGERVMFTLRLRSLSHSETGASEIETLA* |
| Ga0126308_101066722 | 3300010040 | Serpentine Soil | MNQGFLQYFIDGERLMFTLRLWALSHSETGASEIETPA* |
| Ga0126312_101712912 | 3300010041 | Serpentine Soil | MNQGFLQYFIDGERLMFTLRLRALSHSETGASEIETLA* |
| Ga0126312_110159841 | 3300010041 | Serpentine Soil | RDHEFNRVNCRLSPVDQGFLQYFIDGDSAMFTLRLQALSHSETGTSEIETPA* |
| Ga0126314_101033902 | 3300010042 | Serpentine Soil | VNQGFLQYFIDGERVMFTLRLPPLSHSETGASEIETPA* |
| Ga0126382_122578642 | 3300010047 | Tropical Forest Soil | LDQGLLQYFIDGERAMFTLRLQPLSHSKTGSPEIETL |
| Ga0126377_121111772 | 3300010362 | Tropical Forest Soil | VDQGFLQYFIDGERAMFTLRLHGLSHSETGGPEIETLA* |
| Ga0134128_110720141 | 3300010373 | Terrestrial Soil | MDQGFLQYFIDGESALFTLRLQALSHSGTGASEIETLA* |
| Ga0134121_119050012 | 3300010401 | Terrestrial Soil | MDQGFLQLFIDGERALFTLRLRPLSHSKTGAFEIATLA* |
| Ga0138505_1000525251 | 3300010999 | Soil | DQGFLQYFIDGESALFTLRLQALSHSETGASEIETLA* |
| Ga0105246_104409711 | 3300011119 | Miscanthus Rhizosphere | VDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA* |
| Ga0137348_10519251 | 3300011398 | Soil | VDQGFLQYFIDAESALFTLRLQALSHSETGAPEIETLA* |
| Ga0137454_10856491 | 3300011406 | Soil | MDQGLLQYFIDGESALFTLRLQALSHSETGTTEIETLA* |
| Ga0137423_12029001 | 3300011430 | Soil | HEFNRVNCRLSPVDQGFLQYFIDAESALFTLRLQALSHSETGASEIETLA* |
| Ga0137364_107499531 | 3300012198 | Vadose Zone Soil | VNQGFLQYFIEGERAMFTLRLQALSHSETGASEIETLT* |
| Ga0137365_103242512 | 3300012201 | Vadose Zone Soil | VDQGFLQYFIDGESVLFTLRLHALSHSETGASEIETLA* |
| Ga0137399_112684341 | 3300012203 | Vadose Zone Soil | VDQGFLQYFIDGERAMFTLRLHPLSHSETGASEIETLA* |
| Ga0137374_101331462 | 3300012204 | Vadose Zone Soil | VDQGFLQYFIDGESALFTLRLHALSHSETGASEIETLA* |
| Ga0137381_103643442 | 3300012207 | Vadose Zone Soil | VDQGLLQYFIDGERVMFTLRLQALSHSETGASEIETLA* |
| Ga0150985_1180198211 | 3300012212 | Avena Fatua Rhizosphere | VDQGFLQYFIDGERALFTLRLQALSHSKTGASEIATLA* |
| Ga0137368_103383712 | 3300012358 | Vadose Zone Soil | MNQGFLQYFIDGERAMFTLRLQALSHSETGASGIETLA* |
| Ga0137396_101089242 | 3300012918 | Vadose Zone Soil | VDQGFLQYFIDGERAMFTLRLPPLSHSETGASEIETLA* |
| Ga0137394_107596312 | 3300012922 | Vadose Zone Soil | VDQGFLQYFIDGVGAMFTLRLHPLSHSETGPSEIETLA* |
| Ga0162652_1000214252 | 3300012941 | Soil | MDQGLLQYFIDGESALFTLRLQALSHSETGASEIETLA* |
| Ga0164241_107302221 | 3300012943 | Soil | MDQGFLQYFIDGESVMFTLRLHALSHSETGGPEIETLA* |
| Ga0164300_100856542 | 3300012951 | Soil | VDQGFLQYFIDAERAMFTLRLQALSHSETGAAEIETLA* |
| Ga0164298_102036682 | 3300012955 | Soil | VDQGFLQYFIDGERAMFTLRLQTLSHSETGASEIETLA* |
| Ga0164302_101674252 | 3300012961 | Soil | VDQGFLQYFIDGERAMFTLRLQALSHSETGAAKIETLA* |
| Ga0157377_104890361 | 3300014745 | Miscanthus Rhizosphere | MDQGFLQYFIDGERALFTLRLQALSHSKTGASEIETLA* |
| Ga0157379_108949662 | 3300014968 | Switchgrass Rhizosphere | KGFSQRFIDGGSRVFTLRLPALSHSETGRPEIETLA* |
| Ga0132258_128707761 | 3300015371 | Arabidopsis Rhizosphere | VDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLGQGVWWNPL |
| Ga0163161_113471861 | 3300017792 | Switchgrass Rhizosphere | MDQGFLQYFIDGESALFTLRLQALSHSKTGASEIETLA |
| Ga0184604_100423702 | 3300018000 | Groundwater Sediment | MDQGLLQYFIDGESALFTLRLQALSHSETGAPEIETLA |
| Ga0184605_104173481 | 3300018027 | Groundwater Sediment | VDQGFLQYFIDGDSAMFTLRLHPLSHSETGASEIETLA |
| Ga0184608_103316271 | 3300018028 | Groundwater Sediment | NCRLSPVDQGFLQLFIDGESVMFTLRLQGLSHSETGASEIETLA |
| Ga0184638_11900181 | 3300018052 | Groundwater Sediment | MDQGFLQYFIDGESVMFTLRLQALSHSETGASEIETLA |
| Ga0184621_101515042 | 3300018054 | Groundwater Sediment | MDQGLLQYFIDGESVMFTLRLQALSHSETGAPEIETLA |
| Ga0184619_104436452 | 3300018061 | Groundwater Sediment | MDQGFLQYFIDGERALFTLRLQPLSHSETGASEIETLA |
| Ga0184617_10583742 | 3300018066 | Groundwater Sediment | MHQGFLQLFIDGEGTLFTLRLQALSHSKTGASEIETLA |
| Ga0184617_12063222 | 3300018066 | Groundwater Sediment | FNRVNCRLSPVNQGFLQYFIDGERSMFTLRLRALSHSETGASEIETPA |
| Ga0184636_12985262 | 3300018068 | Groundwater Sediment | VDQGLLQYFIDGESALFTLRLQALSHSETGASEIETLA |
| Ga0184635_100325862 | 3300018072 | Groundwater Sediment | VDQGFLQYFIDGDSALFTLRLHALSHSETGASEIETLA |
| Ga0184624_101569802 | 3300018073 | Groundwater Sediment | VDQGFLQYFIDGESALFTLRLQALSHSETGAPEIETLA |
| Ga0184609_101036141 | 3300018076 | Groundwater Sediment | MDQGFLQYFIDGESVLFTLRLQALSHSETGAPEIETLA |
| Ga0184639_101224431 | 3300018082 | Groundwater Sediment | VDQGLLQYFIDGERAMFTLRLQALSHSETGGPEIETLA |
| Ga0184639_101724313 | 3300018082 | Groundwater Sediment | VDQGFLQYFIDGESPLFTLRLQALSHSETGAPEIETLA |
| Ga0190272_108679582 | 3300018429 | Soil | VNCRLSPANQGFLQYFIDGERVMFTLRLQALSHSETGASEIETLA |
| Ga0066667_111783862 | 3300018433 | Grasslands Soil | MDQGFLQYFIDGESALFTLRLQALSHSETGASEIETLA |
| Ga0066667_114399432 | 3300018433 | Grasslands Soil | VDQGFLQYFIDGESAMFTLRLHALSHSETGASEIETLA |
| Ga0190269_101341172 | 3300018465 | Soil | VDQGFLQYFIDGERALFTLRLQPLSHSETGASEIETLA |
| Ga0190268_123037071 | 3300018466 | Soil | MDQGFLQYFIDGESPLFTLRLQALSHSETGASEIETLA |
| Ga0066662_111187792 | 3300018468 | Grasslands Soil | VDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLGQGVWWNPLRPLTVTETL |
| Ga0190274_100754952 | 3300018476 | Soil | VDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA |
| Ga0190273_102310242 | 3300018920 | Soil | VNQGFLQYFIDGEGVMFTLRLWALSHSETGASEIETPA |
| Ga0137408_13788862 | 3300019789 | Vadose Zone Soil | VDQGFLQYFIDGERALFTLRLQALSHSETGASEIETLA |
| Ga0193701_10950581 | 3300019875 | Soil | VDQGFLQLFIDGEGALFTLRLQALSHSETGAPEIETLA |
| Ga0193696_10922162 | 3300020016 | Soil | VDQGFLQLFIDGERALFTLRLHPLSHSETGAPEIETLA |
| Ga0210380_100493103 | 3300021082 | Groundwater Sediment | VDQGLLQYFIDGERAMFTLRLQALSHSGTGASEIETLA |
| Ga0224452_11776402 | 3300022534 | Groundwater Sediment | MNQGFLQCFIDGEGAMFTLRLQPLSHSETGASEIETLA |
| Ga0222623_100104992 | 3300022694 | Groundwater Sediment | MNQGFLQCFIDGERAMFTLRLQPLSHSETGASEIETLA |
| Ga0222622_108243021 | 3300022756 | Groundwater Sediment | RVNCRLRPVDQGFLQLFIDGERALFTLRLQALSHSKTGASEIATLA |
| Ga0247746_10688122 | 3300022886 | Soil | VNQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA |
| Ga0207696_10591292 | 3300025711 | Switchgrass Rhizosphere | VDQGFLQYFIDGESALFTLRLQALSHSKTGASEIETLA |
| Ga0207655_12417031 | 3300025728 | Miscanthus Rhizosphere | MDQGFLQLFIDGERALFTLRLRPLSHSKTGASKIATLGQGVWWNPLRP |
| Ga0207642_104217582 | 3300025899 | Miscanthus Rhizosphere | MNQGFLQYFIDGEGVMFTLRLWALSHSETGASEIETPA |
| Ga0207710_101602072 | 3300025900 | Switchgrass Rhizosphere | VDQGFLQYFIDGECAMFTLRLQALSHSETGASEIETLA |
| Ga0207688_108701062 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | RVNCRLSPVDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA |
| Ga0207647_106077991 | 3300025904 | Corn Rhizosphere | VDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLGQG |
| Ga0207662_102772382 | 3300025918 | Switchgrass Rhizosphere | VDQGFLQYFIDGESALFTLRLQALSHSKTGAPEIETLA |
| Ga0207649_100436935 | 3300025920 | Corn Rhizosphere | VDQGFLQYFIDGERAMFTLRLHPLSHSETGPPEIETLA |
| Ga0207646_104351363 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDQGFLQYFIDGERTLFTLRLQPLSHSETGASEIETLA |
| Ga0207650_112067161 | 3300025925 | Switchgrass Rhizosphere | VDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLGQGVW |
| Ga0207689_101845731 | 3300025942 | Miscanthus Rhizosphere | EFNRVNCRLSPVDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA |
| Ga0207667_119605612 | 3300025949 | Corn Rhizosphere | VDQGFLQYFIDGESALFTLRLQALSHSGTGASEIETLA |
| Ga0207668_119152871 | 3300025972 | Switchgrass Rhizosphere | VDQGFLQYFIDGERAMFTLRLQALSHSETGASEIET |
| Ga0207677_122160872 | 3300026023 | Miscanthus Rhizosphere | VDQGFLQYFIDGERAMFTLRLRALSHSETGASEIETLGQ |
| Ga0207703_121100801 | 3300026035 | Switchgrass Rhizosphere | HEFNRVNCRLSPMDQGFLQLFIDGERALFTLRLRPLSHSKTGAFEIATLA |
| Ga0207678_113896441 | 3300026067 | Corn Rhizosphere | EFNRVNCRLSPVDQGFLQYFIDGERAMFTLRLHPLSHSETGPPEIETLA |
| Ga0209686_12113522 | 3300026315 | Soil | VDQGFLQYFIDGESALFTLRLQALSHSETGASEIETLA |
| Ga0209154_11235341 | 3300026317 | Soil | VDQGFLQYFIDAESAMFTLRLHALSHSETGASEIETLA |
| Ga0209687_12315051 | 3300026322 | Soil | VDQGFLQYFIDGESALFTLRLHALSHSETGASEIETLA |
| Ga0209806_11019952 | 3300026529 | Soil | VNQGFLQYFIDAESAMFTLRLHALSHSETGASEIETLA |
| Ga0209157_11276553 | 3300026537 | Soil | VDQGFLQYFIDGESALFTLRLHVLSHSETGASEIETLA |
| Ga0209177_104694391 | 3300027775 | Agricultural Soil | VDQGFLQYFIDGERAMFTLRLRALSHSETGASEIETLGQRVWW |
| Ga0268266_100592883 | 3300028379 | Switchgrass Rhizosphere | MDQGFLQYSVDGERLMFTLRLVPLSHSKTGPPEIETLA |
| Ga0268266_106133793 | 3300028379 | Switchgrass Rhizosphere | VDQGFLQYFIDGERAMFTLRLRALSHSETGASEIETLGQRVWWNPLRPLTVTETLP |
| Ga0268265_104988671 | 3300028380 | Switchgrass Rhizosphere | NCRLSPMDQGFLQYFIDGESALFTLRLQALSSHSKTGASEIETLA |
| Ga0307321_11394012 | 3300028704 | Soil | MDQGLLQYFIDGECVMFTLRLQALSHSETGAPEIETLA |
| Ga0307288_100581442 | 3300028778 | Soil | VDQGFLQLFIDGERALFTLRLQALSHSKTGASEIATLA |
| Ga0307300_102062842 | 3300028880 | Soil | VNQGFLQYFIDGERVMFTLRLPALSHSETGASEIETLA |
| Ga0311333_102558113 | 3300030114 | Fen | VDQGFLQYFIDGERAMFTLRLRPLSHSETGAAEIETLA |
| Ga0307511_103631531 | 3300030521 | Ectomycorrhiza | MDQGFLQYFIDGERALFTLRLQALSHSETGASEIETLA |
| Ga0307497_104274392 | 3300031226 | Soil | VDQGFLQYFIDGESAMFTLRLHTLSHSETGAPEIETLA |
| Ga0302323_1010768522 | 3300031232 | Fen | VDQGFLQYFIDGKRAMFTLRLRPLSHSETGAAEIETLA |
| Ga0307509_103029203 | 3300031507 | Ectomycorrhiza | MDQGFLQYFIDGERALFTLRLHALSHSETGASEIETLA |
| Ga0311364_110209701 | 3300031521 | Fen | PVDQGFLQYFIDGERAMFTLRLRPLSHSETGAAEIETLA |
| Ga0308175_1000279526 | 3300031938 | Soil | VDQGFLQYFIDGERAMFTLRLQGLSHSETGPPEMETLA |
| Ga0308175_1018663101 | 3300031938 | Soil | PVDQGFLQYFIDGERAMFSFRLRPLSHSETGPPEIETLA |
| Ga0308175_1020622412 | 3300031938 | Soil | RDHEFNRVNCRLSPVDQGFLQYFIDGERAMFTLRLHPLSHSETGPPEIETLA |
| Ga0310902_111344881 | 3300032012 | Soil | FNRVNCRLSPVDQGFLQYFIDGERAMFTLRLQALSHSETGASEIETLA |
| Ga0308173_105355393 | 3300032074 | Soil | GFLQYFIDGERAMFPFRLRPLSHSETGPPEIETLA |
| Ga0307507_105636222 | 3300033179 | Ectomycorrhiza | VDQGFLQYFIDGERAMFSFRLRPLSHSETGPPEIETLA |
| Ga0247830_115686051 | 3300033551 | Soil | VDQGFLQYFIDGESALFTLRPHALSHSETGASEIETLA |
| Ga0370502_0082561_458_574 | 3300034156 | Untreated Peat Soil | MYQGLLQYFIDGERAMFPLRLPRLSHSGTGPFEIETLA |
| Ga0364931_0067377_299_415 | 3300034176 | Sediment | MDQGLLQYFIDGESVMFTLRLQALSHSETGASEIETLA |
| ⦗Top⦘ |