


| Basic Information | |
|---|---|
| Family ID | F039150 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 164 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MRKKLVYYFAMALLNIGKPFTRIGNWFWKKHRDVLDWNK |
| Number of Associated Samples | 120 |
| Number of Associated Scaffolds | 164 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 73.78 % |
| % of genes near scaffold ends (potentially truncated) | 27.44 % |
| % of genes from short scaffolds (< 2000 bps) | 82.32 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.878 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (28.049 % of family members) |
| Environment Ontology (ENVO) | Unclassified (79.268 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.854 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.75% β-sheet: 0.00% Coil/Unstructured: 49.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 164 Family Scaffolds |
|---|---|---|
| PF13392 | HNH_3 | 9.76 |
| PF00848 | Ring_hydroxyl_A | 6.10 |
| PF03237 | Terminase_6N | 1.22 |
| PF01476 | LysM | 1.22 |
| PF00145 | DNA_methylase | 0.61 |
| PF00959 | Phage_lysozyme | 0.61 |
| PF03819 | MazG | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
|---|---|---|---|
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 12.20 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.88 % |
| All Organisms | root | All Organisms | 45.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10031280 | All Organisms → Viruses → Predicted Viral | 2920 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10082607 | All Organisms → Viruses → Predicted Viral | 1415 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10025965 | All Organisms → Viruses → Predicted Viral | 2676 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10073073 | All Organisms → Viruses → Predicted Viral | 1225 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10091891 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1020 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10031892 | All Organisms → Viruses → Predicted Viral | 2454 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10107102 | Not Available | 1039 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10116944 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 970 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10273236 | Not Available | 505 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10167265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 707 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10182580 | Not Available | 660 | Open in IMG/M |
| 3300001346|JGI20151J14362_10014209 | All Organisms → Viruses → Predicted Viral | 4504 | Open in IMG/M |
| 3300001355|JGI20158J14315_10040801 | All Organisms → Viruses → Predicted Viral | 2061 | Open in IMG/M |
| 3300001355|JGI20158J14315_10041140 | All Organisms → Viruses → Predicted Viral | 2049 | Open in IMG/M |
| 3300001450|JGI24006J15134_10005940 | Not Available | 6301 | Open in IMG/M |
| 3300001450|JGI24006J15134_10006494 | Not Available | 6005 | Open in IMG/M |
| 3300001450|JGI24006J15134_10084567 | Not Available | 1177 | Open in IMG/M |
| 3300001450|JGI24006J15134_10158774 | Not Available | 732 | Open in IMG/M |
| 3300001460|JGI24003J15210_10019852 | All Organisms → Viruses → Predicted Viral | 2572 | Open in IMG/M |
| 3300001460|JGI24003J15210_10028284 | All Organisms → Viruses → Predicted Viral | 2062 | Open in IMG/M |
| 3300001460|JGI24003J15210_10110283 | Not Available | 769 | Open in IMG/M |
| 3300001460|JGI24003J15210_10116206 | Not Available | 738 | Open in IMG/M |
| 3300001589|JGI24005J15628_10175163 | Not Available | 625 | Open in IMG/M |
| 3300003617|JGI26082J51739_10058530 | All Organisms → Viruses | 1148 | Open in IMG/M |
| 3300004279|Ga0066605_10121138 | Not Available | 1064 | Open in IMG/M |
| 3300005082|Ga0072336_10210388 | Not Available | 500 | Open in IMG/M |
| 3300005239|Ga0073579_1068187 | Not Available | 1258 | Open in IMG/M |
| 3300005601|Ga0070722_10216978 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 793 | Open in IMG/M |
| 3300005747|Ga0076924_1050865 | Not Available | 547 | Open in IMG/M |
| 3300006025|Ga0075474_10118848 | Not Available | 844 | Open in IMG/M |
| 3300006025|Ga0075474_10176129 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 663 | Open in IMG/M |
| 3300006025|Ga0075474_10239827 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 547 | Open in IMG/M |
| 3300006025|Ga0075474_10247117 | Not Available | 537 | Open in IMG/M |
| 3300006026|Ga0075478_10079192 | Not Available | 1058 | Open in IMG/M |
| 3300006026|Ga0075478_10100358 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 924 | Open in IMG/M |
| 3300006027|Ga0075462_10104013 | Not Available | 881 | Open in IMG/M |
| 3300006027|Ga0075462_10200727 | Not Available | 600 | Open in IMG/M |
| 3300006403|Ga0075514_1865683 | Not Available | 969 | Open in IMG/M |
| 3300006637|Ga0075461_10086103 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 995 | Open in IMG/M |
| 3300006735|Ga0098038_1122435 | Not Available | 883 | Open in IMG/M |
| 3300006803|Ga0075467_10640040 | Not Available | 542 | Open in IMG/M |
| 3300006810|Ga0070754_10403407 | Not Available | 598 | Open in IMG/M |
| 3300006868|Ga0075481_10336287 | Not Available | 523 | Open in IMG/M |
| 3300006916|Ga0070750_10206524 | Not Available | 867 | Open in IMG/M |
| 3300006916|Ga0070750_10448381 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 534 | Open in IMG/M |
| 3300006919|Ga0070746_10067232 | All Organisms → Viruses → Predicted Viral | 1835 | Open in IMG/M |
| 3300006919|Ga0070746_10268656 | Not Available | 791 | Open in IMG/M |
| 3300006919|Ga0070746_10511087 | Not Available | 526 | Open in IMG/M |
| 3300006922|Ga0098045_1163059 | Not Available | 508 | Open in IMG/M |
| 3300007236|Ga0075463_10205340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 634 | Open in IMG/M |
| 3300007276|Ga0070747_1241773 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 628 | Open in IMG/M |
| 3300007276|Ga0070747_1300164 | Not Available | 552 | Open in IMG/M |
| 3300007345|Ga0070752_1005977 | Not Available | 7004 | Open in IMG/M |
| 3300007346|Ga0070753_1294780 | Not Available | 580 | Open in IMG/M |
| 3300007539|Ga0099849_1064671 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1501 | Open in IMG/M |
| 3300007542|Ga0099846_1348569 | Not Available | 502 | Open in IMG/M |
| 3300007778|Ga0102954_1201098 | Not Available | 584 | Open in IMG/M |
| 3300008012|Ga0075480_10291755 | Not Available | 831 | Open in IMG/M |
| 3300009000|Ga0102960_1337440 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 532 | Open in IMG/M |
| 3300009001|Ga0102963_1185965 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 831 | Open in IMG/M |
| 3300009193|Ga0115551_1456230 | Not Available | 546 | Open in IMG/M |
| 3300009426|Ga0115547_1107521 | Not Available | 915 | Open in IMG/M |
| 3300009433|Ga0115545_1048096 | All Organisms → Viruses → Predicted Viral | 1649 | Open in IMG/M |
| 3300009433|Ga0115545_1133660 | Not Available | 875 | Open in IMG/M |
| 3300009435|Ga0115546_1075961 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
| 3300009472|Ga0115554_1107188 | All Organisms → Viruses → Predicted Viral | 1183 | Open in IMG/M |
| 3300009476|Ga0115555_1084817 | All Organisms → Viruses → Predicted Viral | 1374 | Open in IMG/M |
| 3300009495|Ga0115571_1266888 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 685 | Open in IMG/M |
| 3300009498|Ga0115568_10154814 | All Organisms → Viruses → Predicted Viral | 1088 | Open in IMG/M |
| 3300009507|Ga0115572_10277488 | Not Available | 954 | Open in IMG/M |
| 3300009507|Ga0115572_10313883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 887 | Open in IMG/M |
| 3300009507|Ga0115572_10482427 | Not Available | 688 | Open in IMG/M |
| 3300009703|Ga0114933_10683421 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 658 | Open in IMG/M |
| 3300010150|Ga0098056_1188201 | Not Available | 691 | Open in IMG/M |
| 3300011258|Ga0151677_1010490 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 748 | Open in IMG/M |
| 3300013010|Ga0129327_10336738 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 788 | Open in IMG/M |
| 3300017708|Ga0181369_1056666 | Not Available | 868 | Open in IMG/M |
| 3300017713|Ga0181391_1000041 | Not Available | 32678 | Open in IMG/M |
| 3300017727|Ga0181401_1132200 | Not Available | 618 | Open in IMG/M |
| 3300017734|Ga0187222_1005330 | All Organisms → Viruses → Predicted Viral | 3337 | Open in IMG/M |
| 3300017734|Ga0187222_1141308 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 537 | Open in IMG/M |
| 3300017738|Ga0181428_1121856 | Not Available | 612 | Open in IMG/M |
| 3300017741|Ga0181421_1128195 | Not Available | 657 | Open in IMG/M |
| 3300017742|Ga0181399_1063444 | Not Available | 946 | Open in IMG/M |
| 3300017742|Ga0181399_1140026 | Not Available | 585 | Open in IMG/M |
| 3300017743|Ga0181402_1043112 | All Organisms → Viruses → Predicted Viral | 1230 | Open in IMG/M |
| 3300017751|Ga0187219_1083278 | Not Available | 996 | Open in IMG/M |
| 3300017752|Ga0181400_1027191 | Not Available | 1859 | Open in IMG/M |
| 3300017765|Ga0181413_1232228 | Not Available | 546 | Open in IMG/M |
| 3300017772|Ga0181430_1090665 | Not Available | 916 | Open in IMG/M |
| 3300017776|Ga0181394_1239062 | Not Available | 546 | Open in IMG/M |
| 3300017779|Ga0181395_1125470 | Not Available | 815 | Open in IMG/M |
| 3300018642|Ga0188867_1000016 | All Organisms → Viruses → Predicted Viral | 4762 | Open in IMG/M |
| 3300018642|Ga0188867_1004521 | Not Available | 687 | Open in IMG/M |
| 3300019751|Ga0194029_1021266 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 993 | Open in IMG/M |
| 3300019765|Ga0194024_1022362 | Not Available | 1354 | Open in IMG/M |
| 3300020294|Ga0211520_1002042 | Not Available | 3795 | Open in IMG/M |
| 3300020438|Ga0211576_10296245 | Not Available | 842 | Open in IMG/M |
| 3300021347|Ga0213862_10000032 | Not Available | 48911 | Open in IMG/M |
| 3300021347|Ga0213862_10012637 | All Organisms → Viruses → Predicted Viral | 3244 | Open in IMG/M |
| 3300021365|Ga0206123_10247706 | Not Available | 775 | Open in IMG/M |
| 3300021373|Ga0213865_10138969 | All Organisms → Viruses → Predicted Viral | 1256 | Open in IMG/M |
| 3300021375|Ga0213869_10133282 | All Organisms → Viruses → Predicted Viral | 1176 | Open in IMG/M |
| 3300021378|Ga0213861_10609395 | Not Available | 501 | Open in IMG/M |
| 3300021389|Ga0213868_10059824 | All Organisms → Viruses → Predicted Viral | 2595 | Open in IMG/M |
| 3300021958|Ga0222718_10009928 | Not Available | 7161 | Open in IMG/M |
| 3300021958|Ga0222718_10084425 | All Organisms → Viruses → Predicted Viral | 1907 | Open in IMG/M |
| 3300021958|Ga0222718_10456958 | Not Available | 626 | Open in IMG/M |
| 3300021958|Ga0222718_10458108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 625 | Open in IMG/M |
| 3300021958|Ga0222718_10561789 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 541 | Open in IMG/M |
| 3300021960|Ga0222715_10150338 | All Organisms → Viruses → Predicted Viral | 1443 | Open in IMG/M |
| 3300021964|Ga0222719_10043679 | All Organisms → Viruses → Predicted Viral | 3446 | Open in IMG/M |
| 3300021964|Ga0222719_10175527 | All Organisms → Viruses → Predicted Viral | 1488 | Open in IMG/M |
| 3300021964|Ga0222719_10202147 | Not Available | 1357 | Open in IMG/M |
| 3300021964|Ga0222719_10428310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 815 | Open in IMG/M |
| 3300022050|Ga0196883_1008201 | All Organisms → Viruses → Predicted Viral | 1224 | Open in IMG/M |
| 3300022053|Ga0212030_1027153 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 787 | Open in IMG/M |
| 3300022057|Ga0212025_1046164 | Not Available | 750 | Open in IMG/M |
| 3300022065|Ga0212024_1093206 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 536 | Open in IMG/M |
| 3300022067|Ga0196895_1044545 | Not Available | 512 | Open in IMG/M |
| 3300022072|Ga0196889_1079968 | Not Available | 610 | Open in IMG/M |
| 3300022074|Ga0224906_1003467 | Not Available | 6951 | Open in IMG/M |
| 3300022167|Ga0212020_1017640 | All Organisms → Viruses → Predicted Viral | 1132 | Open in IMG/M |
| 3300022187|Ga0196899_1059053 | All Organisms → Viruses → Predicted Viral | 1229 | Open in IMG/M |
| 3300022187|Ga0196899_1168389 | Not Available | 598 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10353358 | Not Available | 632 | Open in IMG/M |
| 3300025048|Ga0207905_1000560 | Not Available | 8442 | Open in IMG/M |
| 3300025120|Ga0209535_1000670 | Not Available | 23989 | Open in IMG/M |
| 3300025120|Ga0209535_1004885 | All Organisms → Viruses | 8308 | Open in IMG/M |
| 3300025120|Ga0209535_1023378 | All Organisms → Viruses → Predicted Viral | 3071 | Open in IMG/M |
| 3300025120|Ga0209535_1143625 | Not Available | 766 | Open in IMG/M |
| 3300025127|Ga0209348_1082879 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
| 3300025128|Ga0208919_1139077 | Not Available | 759 | Open in IMG/M |
| 3300025132|Ga0209232_1045026 | All Organisms → Viruses → Predicted Viral | 1635 | Open in IMG/M |
| 3300025137|Ga0209336_10077129 | Not Available | 978 | Open in IMG/M |
| 3300025608|Ga0209654_1020231 | All Organisms → Viruses → Predicted Viral | 2487 | Open in IMG/M |
| 3300025610|Ga0208149_1124701 | Not Available | 603 | Open in IMG/M |
| 3300025630|Ga0208004_1039856 | All Organisms → Viruses → Predicted Viral | 1319 | Open in IMG/M |
| 3300025632|Ga0209194_1167124 | Not Available | 508 | Open in IMG/M |
| 3300025646|Ga0208161_1175669 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 511 | Open in IMG/M |
| 3300025653|Ga0208428_1037139 | All Organisms → Viruses → Predicted Viral | 1528 | Open in IMG/M |
| 3300025653|Ga0208428_1094752 | Not Available | 847 | Open in IMG/M |
| 3300025671|Ga0208898_1056092 | All Organisms → Viruses → Predicted Viral | 1396 | Open in IMG/M |
| 3300025759|Ga0208899_1006166 | Not Available | 7211 | Open in IMG/M |
| 3300025767|Ga0209137_1018640 | All Organisms → Viruses → Predicted Viral | 4108 | Open in IMG/M |
| 3300025769|Ga0208767_1230366 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 596 | Open in IMG/M |
| 3300025818|Ga0208542_1144312 | Not Available | 652 | Open in IMG/M |
| 3300025818|Ga0208542_1196672 | Not Available | 522 | Open in IMG/M |
| 3300025828|Ga0208547_1159043 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 639 | Open in IMG/M |
| 3300025869|Ga0209308_10174235 | Not Available | 971 | Open in IMG/M |
| 3300025870|Ga0209666_1072041 | All Organisms → Viruses → Predicted Viral | 1771 | Open in IMG/M |
| 3300025881|Ga0209309_10036731 | All Organisms → Viruses → Predicted Viral | 3078 | Open in IMG/M |
| 3300025890|Ga0209631_10132030 | All Organisms → Viruses → Predicted Viral | 1377 | Open in IMG/M |
| 3300025894|Ga0209335_10094100 | All Organisms → Viruses → Predicted Viral | 1596 | Open in IMG/M |
| 3300027612|Ga0209037_1144614 | Not Available | 575 | Open in IMG/M |
| 3300028137|Ga0256412_1382059 | Not Available | 516 | Open in IMG/M |
| 3300028335|Ga0247566_1079879 | Not Available | 552 | Open in IMG/M |
| 3300031519|Ga0307488_10337485 | Not Available | 955 | Open in IMG/M |
| 3300031519|Ga0307488_10830568 | Not Available | 508 | Open in IMG/M |
| 3300031539|Ga0307380_10523940 | Not Available | 1037 | Open in IMG/M |
| 3300031851|Ga0315320_10588779 | Not Available | 733 | Open in IMG/M |
| 3300032274|Ga0316203_1216038 | Not Available | 527 | Open in IMG/M |
| 3300032277|Ga0316202_10248217 | Not Available | 827 | Open in IMG/M |
| 3300032373|Ga0316204_10390241 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1058 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 28.05% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.41% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 10.37% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 9.15% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 6.71% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.10% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.88% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.05% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.05% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.83% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.22% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.22% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.22% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.22% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.61% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.61% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.61% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.61% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.61% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.61% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.61% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.61% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.61% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300003617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300005082 | Microbial Community from Halfdan Field MHDA9 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006403 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300018642 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p1 | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020294 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556124-ERR599153) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300027612 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300028137 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028335 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100312806 | 3300000101 | Marine | MKKQIVYYFALALLNTGKPFTRIGNWFWKKHRTVLNWINK* |
| DelMOSum2010_100826074 | 3300000101 | Marine | MRKQIVYYFAMALLNTGKPFTRIGNWFWKKHRDVLDWNQ* |
| DelMOSum2011_100259656 | 3300000115 | Marine | MKKKLVYYIAIALLNIGKPFTCVGNWFWKLHRKLLDWTK* |
| DelMOSum2011_100730733 | 3300000115 | Marine | MRKKLVYRFAIALLNIGKPFTSIGNWFWKKHRDVLDWND* |
| DelMOSum2011_100918913 | 3300000115 | Marine | MRKQVVYYFAMALLNTGKPFTRIGNWFWKKHRDVLDWNQ* |
| DelMOSpr2010_100318921 | 3300000116 | Marine | MKKKLVYYIAIALLNIGKPFTCVGNWFWKLHRKLLDWIK* |
| DelMOSpr2010_101071021 | 3300000116 | Marine | MRKKLVYYFAIALLNIGKPFTCIGNWFWKKHRDVLDWTK* |
| DelMOSpr2010_101169443 | 3300000116 | Marine | MRKRIVYYFGMALLNIGKPFTCIGNWFWKKHRDVLDWNQ* |
| DelMOSpr2010_102732362 | 3300000116 | Marine | MRKQVIYYFALALLNTGKPFTRIGNWFWKKHRDVLDWNXK* |
| DelMOWin2010_101672653 | 3300000117 | Marine | MRKKLVYYFALALLNTGKPFTRIGNWFWKKHRNVLDWNK* |
| DelMOWin2010_101825802 | 3300000117 | Marine | MRKQIVYYFAMALLNIGKPFTCIGNWFWKKHRDVLDWNK* |
| JGI20151J14362_100142094 | 3300001346 | Pelagic Marine | MRKKLVYYIAIALLNIGKPFTCVGNWFWKLHRKILDWNK* |
| JGI20158J14315_100408015 | 3300001355 | Pelagic Marine | MKKQIVYYFALTLLNMGKPFTCVGNWFWKKHRDVLDWNK* |
| JGI20158J14315_100411403 | 3300001355 | Pelagic Marine | MRKKLVYYIAIALLNIGKPFTCVGNWFWKLHRKVLDWNK* |
| JGI24006J15134_100059405 | 3300001450 | Marine | MRKKLVYYVAIALLNIGKPFTCVGNWFWKLHRKLLDWIK* |
| JGI24006J15134_100064943 | 3300001450 | Marine | MRKKLVYYFAVALLNIGKPFTYIGNWFWKKHRDLLDWIK* |
| JGI24006J15134_100845673 | 3300001450 | Marine | MRKKAIYYIALALLNIGKPFTYVGNWFWKLHRDLLDWIK* |
| JGI24006J15134_101587743 | 3300001450 | Marine | MRKQVVYYFAMALLNIGKPFTCIGNWFWKKHKDVLDWNK* |
| JGI24003J15210_100198522 | 3300001460 | Marine | MRKKLVYYFAMALLNIGKPFTCIGNWFWKKHREVLDWNK* |
| JGI24003J15210_100282841 | 3300001460 | Marine | MKKKLVYYCAIALLNIGKPFTCVGNWFWKLHRKLLDWIK* |
| JGI24003J15210_101102831 | 3300001460 | Marine | MRKQAIYYFAMALLNIGKPFTCIGNWFWKKHREVLDWNK |
| JGI24003J15210_101162063 | 3300001460 | Marine | MRKQVVYYFAMALLNIDKLFTCIGNWFWKKHRDVLDWNK* |
| JGI24005J15628_101751633 | 3300001589 | Marine | GSKKEMRKQVVYYFAMALLNIDKLFTCIGNWFWKKHRDVLDWNK* |
| JGI26082J51739_100585304 | 3300003617 | Marine | ANVIPMRKTCVYYLGMTLLNIGKPFTRIGNWFWKKHRTVLNWDK* |
| Ga0066605_101211382 | 3300004279 | Marine | MKKKLVYYFALALLNMGKPFTRIGNWFWKKHRDVLDWNE* |
| Ga0072336_102103881 | 3300005082 | Water | MRKQAVYYFAMVLLNIGKPFTRIGNWFWKKHRDVLDWNQ* |
| Ga0073579_10681872 | 3300005239 | Marine | MRKKILYYFAMVLLNIGKPFTRIGNWFWKKHRDVLDWNQ* |
| Ga0070722_102169782 | 3300005601 | Marine Sediment | MRKQVVYYFAMALLNTGKPFTRIGNWFWKKHRDVLDWNDK* |
| Ga0076924_10508651 | 3300005747 | Marine | MRKQAVYYFAMVLLNIGKPFTRIGNWFWKKHRDVLDWN |
| Ga0075474_101188482 | 3300006025 | Aqueous | MRKQVVYYFALALLNIGKPFTRIGNWFWKKHRDVLDWNDK* |
| Ga0075474_101761292 | 3300006025 | Aqueous | MRKKLVYYFALALLNTGKPFTRIGNWFWKKHRKVLDWNK* |
| Ga0075474_102398272 | 3300006025 | Aqueous | MRKQVIYYFALALLNTGKPFTRIGNWFWKKHRDVLDWNDK* |
| Ga0075474_102471171 | 3300006025 | Aqueous | MRKKLVYYFALALLNTGKPFTRIGNWFWKKHRDVLDWNK* |
| Ga0075478_100791923 | 3300006026 | Aqueous | MKKKLVYHFAIALLNIGKPFTSIGNWFWKKHRDVLDWNG* |
| Ga0075478_101003582 | 3300006026 | Aqueous | MRKQVIYYFALALLNAGKPFTRIGNWFWKKHRKVLDWNK* |
| Ga0075462_101040133 | 3300006027 | Aqueous | MRKQALYYFAMALLNIGKPFTCIGNWFWKKHRDVLDWNK* |
| Ga0075462_102007271 | 3300006027 | Aqueous | MRKQVIYYFALALLNTGKPFTRIGNWFWKKHRDVLDW |
| Ga0075514_18656833 | 3300006403 | Aqueous | MRKQVVYYFALALLKIGKPFTRIGNWFWKKHRDVLDWNDK* |
| Ga0075461_100861032 | 3300006637 | Aqueous | MRKKLVYYFALALLNTGKPFTRIGNWFWKKHRDVLDWNDK* |
| Ga0098038_11224352 | 3300006735 | Marine | MRKQAIYYFALALLYTGRPFTKIGDWFWKKHRDVLDWNK* |
| Ga0075467_106400402 | 3300006803 | Aqueous | MRKRIVYYFGMALLNIGKPFTCIGNWFWKKHRDVLDWNK* |
| Ga0070754_104034073 | 3300006810 | Aqueous | MRKQVIYYFALALLNAGKPFTRIGNWFWKKHRDVLDWNDK |
| Ga0075481_103362872 | 3300006868 | Aqueous | MKKKLVYHFAIALLNIGKPFTSIGNWFWKKHRDVLDWNE* |
| Ga0070750_102065243 | 3300006916 | Aqueous | MRKKLVHRFAIALLNIGKPFNRIGNWFWKKHRDVLDWNQ* |
| Ga0070750_104483811 | 3300006916 | Aqueous | LIHRFAIALLNIGKPFTRIGNWFWKKHRDVLDWNNK* |
| Ga0070746_100672325 | 3300006919 | Aqueous | MRKKLVYYVAIALLNIGKPFTSIGNWFWKLHRKVLDWND* |
| Ga0070746_102686563 | 3300006919 | Aqueous | MRKKLVHRFAIALLNIGKPFNRIGNWFWKKHRDVLDWNQQW* |
| Ga0070746_105110871 | 3300006919 | Aqueous | EMRKQVVYYFALALLNIGKPFTRIGNWFWKKHRDVLDWNDK* |
| Ga0098045_11630591 | 3300006922 | Marine | KLVHRFAIVLLNIGKPFNRIGNWFWKKHRDVLDWNE* |
| Ga0075463_102053403 | 3300007236 | Aqueous | KQVIYYFALALLNTGKPFTRIGNWFWKKHRDVLDWNK* |
| Ga0070747_12417733 | 3300007276 | Aqueous | RKQVVYYFAMALLNTGKPFTRIGNWFWKKHRDVLDWNQ* |
| Ga0070747_13001643 | 3300007276 | Aqueous | MRKKAVRYFGWALLYMGKPFTRIGNWFWKKHRDVLDWNK* |
| Ga0070752_10059771 | 3300007345 | Aqueous | EMRKKILYYFAMVLLNIGKPITRIGNWFWKKHRDVLDWNQ* |
| Ga0070753_12947801 | 3300007346 | Aqueous | KEMRKKLVYRFAIALLNIGKPFTSIGNWFWKKHRDVLDWND* |
| Ga0099849_10646713 | 3300007539 | Aqueous | MRKQVVYYFALALLNTGKPFTRIGNWFWKKHRDVLDWNDK* |
| Ga0099846_13485691 | 3300007542 | Aqueous | LYYFAMALLNIGKPFTCIGNWFWKKHRDVLDWNK* |
| Ga0102954_12010981 | 3300007778 | Water | MRKKLVYYFGIALLNIGKPFTCIGNWFWKKHRDVLDWND* |
| Ga0075480_102917551 | 3300008012 | Aqueous | KKLVYHFAIALLNIGKPFTSIGNWFWKKHRDVLDWNE* |
| Ga0102960_13374402 | 3300009000 | Pond Water | MRKKLVHRFAIALLNIGKPFTRIGNWFWKKHRDVLDWNDK* |
| Ga0102963_11859653 | 3300009001 | Pond Water | WRNGKKEMRKKLVHHFAIVLLNIGKPFTRIGNWFWKKHRDVLDWNE* |
| Ga0115551_14562302 | 3300009193 | Pelagic Marine | MRKKLVYRFAIALLNTGKPFTCIGNWFWKKHREVLDWNK* |
| Ga0115547_11075213 | 3300009426 | Pelagic Marine | MRKQVVYYFAMALLNTGKPFTRIGNWFWKKHRDVLDWNE* |
| Ga0115545_10480964 | 3300009433 | Pelagic Marine | MRKKILYYFAMVLLNIGKPFTSIGNWFWKKHRDVLDWNQ* |
| Ga0115545_11336603 | 3300009433 | Pelagic Marine | MRKQVVYYFALTLLNIGKPFTCVGNWFWKKHRDVLDWNK* |
| Ga0115546_10759612 | 3300009435 | Pelagic Marine | MRKRIVYYFGMALLNIGKPFTCIGNWFWKKHRDVLDWNE* |
| Ga0115554_11071881 | 3300009472 | Pelagic Marine | KEMRKKLVYYIAMALLNIGKPFTRIGNWFWKKHRDVLDWNQ* |
| Ga0115555_10848174 | 3300009476 | Pelagic Marine | MRKRIIYYFGMALLNIGKPFTCIGNWFWKKHRDVLDWNQ* |
| Ga0115571_12668882 | 3300009495 | Pelagic Marine | HRFAIALLNIGKPFTRIGNWFWKKHRDVLDWNDK* |
| Ga0115568_101548142 | 3300009498 | Pelagic Marine | MRKKLVYYFAMALLNIGKPFTRIGNWFWKKHRDVLDWNK* |
| Ga0115572_102774884 | 3300009507 | Pelagic Marine | MKNLRRTLIKYLGLVLLNIGKPFTRIGNWFWKLHR |
| Ga0115572_103138831 | 3300009507 | Pelagic Marine | EMRKKILYYFAMALLNIGKPFTCIGNWFWKKHRDVLDWNQ* |
| Ga0115572_104824273 | 3300009507 | Pelagic Marine | MRKKLVYYFAMALLNIGKPFTRIGNWFWKKHRDVLDWNE* |
| Ga0114933_106834211 | 3300009703 | Deep Subsurface | KLITKFGYLLLYMGKPFTKIGNWFWKRHRDVLDWGNK* |
| Ga0098056_11882012 | 3300010150 | Marine | MRKKLVHRFAIALLNIGKPFNRIGNWFWKKHRDVLDWNE* |
| Ga0151677_10104901 | 3300011258 | Marine | DYYFALALLNIGKPFTCIGNWFWKKHRDVLDWNQ* |
| Ga0129327_103367381 | 3300013010 | Freshwater To Marine Saline Gradient | MKKQIVYYFALALLNTGKPFTRIGNWFWKKHRDVLDWNNK* |
| Ga0181369_10566663 | 3300017708 | Marine | MRKQAIYYFALALLYMGRPFTKIGDWFWKRHRNVLDWNK |
| Ga0181391_100004147 | 3300017713 | Seawater | MRKKLVHRFAMALLNIGKPFTRIGNWFWKKHRDVLDWNE |
| Ga0181401_11322002 | 3300017727 | Seawater | MRKKLVYYFAIALLNLGKPFTRIGNWFWKKHRDVLDWNK |
| Ga0187222_10053303 | 3300017734 | Seawater | MRKKLVHRFAIALLNIGKPFTRIGNWFWKKHRDVLDWNE |
| Ga0187222_11413082 | 3300017734 | Seawater | MRKQAVKYFGWALLYMGKPFTRIGNWFWKKHRDVLDWNN |
| Ga0181428_11218561 | 3300017738 | Seawater | MRKKLVYYFAMVLLNIGKPFTCIGNWFWKKHRDVLD |
| Ga0181421_11281952 | 3300017741 | Seawater | MRKKLVYYFALALLNMGKPFTRIGNWFWKKHRDVLDWNE |
| Ga0181399_10634441 | 3300017742 | Seawater | EMRKKLVYYFALALLNVGKPFTRIGNWFWKKHRDVLDWNE |
| Ga0181399_11400261 | 3300017742 | Seawater | MRKKLVYYFALALLNVGKPFTRIGNWFWKKHRDVLD |
| Ga0181402_10431123 | 3300017743 | Seawater | MRKQAIYYFAMALLNIGKPFTCIGNWFWKKHRDVLDWNE |
| Ga0187219_10832781 | 3300017751 | Seawater | MRKKLVHRFAMALLNIGKPFTRIGNWFWKKHRDVLDWNK |
| Ga0181400_10271913 | 3300017752 | Seawater | MRKKLVYYFALALLNVGKPFTRIGNWFWKKHRDVLDWNE |
| Ga0181413_12322283 | 3300017765 | Seawater | MRKKLVYYFAMVLLNIGKPFTRIGNWFWKKHRDVLDWNE |
| Ga0181430_10906653 | 3300017772 | Seawater | MRKQAIYYFALALLNTGKPFTCIGNWFWKKHREVLDWNK |
| Ga0181394_12390622 | 3300017776 | Seawater | MRKQAIYYFAMALLNIGKPFTCIGNWIWKKLRDVVDWKK |
| Ga0181395_11254704 | 3300017779 | Seawater | RKKAIYYIALALLNIGKPFTCIGNWFWKKHRDLLDWIK |
| Ga0188867_10000166 | 3300018642 | Freshwater Lake | MRKQVVYYFAMALLNTGKPFTRIGNWFWKKHRDVLDWNE |
| Ga0188867_10045213 | 3300018642 | Freshwater Lake | MKKKLVYYFALALLNIGKPFTRIGNWFWKKHRDVLDWNE |
| Ga0194029_10212663 | 3300019751 | Freshwater | MRKKLVYYFALALLNIGKPFTRIGNWFWKKHRDVLDWNDK |
| Ga0194024_10223625 | 3300019765 | Freshwater | MRKQVIYYFALALLNIGKPFTRIGNWFWKKHRDVLDWNN |
| Ga0211520_10020424 | 3300020294 | Marine | MKKKLVYYFAIALLNIGKPFTCIGNWFWKKHRDVLDWTK |
| Ga0211576_102962452 | 3300020438 | Marine | MRKKTIYYIALALLNIGKPFTCVGNWFWKKHRDLLDWTK |
| Ga0213862_1000003213 | 3300021347 | Seawater | MRKQALYYFAMALLNIGKPFTCIGNWFWKKHRDVLDWNK |
| Ga0213862_100126375 | 3300021347 | Seawater | MRKQIVYYFAMALLNIGKPFTCIGNWFWKKHRDVLDWNK |
| Ga0206123_102477063 | 3300021365 | Seawater | MRKKLVYYIAIALLNIGKPFTCVGNWFWKLHRKVLDWNK |
| Ga0213865_101389693 | 3300021373 | Seawater | MRKKLVHRFAIALLNIGKPFNRIGNWFWKRHRDVLDWNE |
| Ga0213869_101332824 | 3300021375 | Seawater | MRKKLVYRFAIALLNIGKPFTSIGNWFWKRHRDVLD |
| Ga0213861_106093951 | 3300021378 | Seawater | MRKKLVYRFAIALLNIGKPFTSIGNWFWKKHRDVLDWND |
| Ga0213868_100598243 | 3300021389 | Seawater | MRKQVVYYFAMALLNTGKPFTRIGNWFWKKHRDVLDWNQ |
| Ga0222718_1000992816 | 3300021958 | Estuarine Water | MRKKLVHHFAIVLLNIGKPFTRIGNWFWKKHRDVLDWNE |
| Ga0222718_100844251 | 3300021958 | Estuarine Water | MRKKIIYYFALALLNIGKPFTRIGNWFWKKHRDVLDWND |
| Ga0222718_104569582 | 3300021958 | Estuarine Water | MRKKLVYYFGIALLNIGKPFTCIGNWFWKKHRDVLDWND |
| Ga0222718_104581081 | 3300021958 | Estuarine Water | KLVYYFALALLNTGKPFTRIGNWFWKKHRTVLNWNK |
| Ga0222718_105617892 | 3300021958 | Estuarine Water | MRKKLVHRFAIALLNIGKPFTRIGNWFWKKHRDVLDWNDK |
| Ga0222715_101503385 | 3300021960 | Estuarine Water | MKKQVVYYFALALLNTGKPFTRIGNWFWKKHRTVLNWNK |
| Ga0222719_100436793 | 3300021964 | Estuarine Water | MRKQLIHRFAIALLNIGKPFTRIGNWFWKKHRDVLDWNDK |
| Ga0222719_101755275 | 3300021964 | Estuarine Water | MRKKLVHRFAIALLNIGKPFTRIGNWFWKKHRDVL |
| Ga0222719_102021473 | 3300021964 | Estuarine Water | MRKKLVYYFGIVLLNIGKPFTRIGNWFWKKHRDVLDWND |
| Ga0222719_104283102 | 3300021964 | Estuarine Water | MRKKLVYYFALALLNIGKPFTRIGNWFWKKHRTVLNWDK |
| Ga0196883_10082012 | 3300022050 | Aqueous | MRKQVIYYFALALLNTGKPFTRIGNWFWKKHRDVLDWNDK |
| Ga0212030_10271533 | 3300022053 | Aqueous | ALYYFAMALLNIGKPFTCIGNWFWKKHRDVLDWNK |
| Ga0212025_10461643 | 3300022057 | Aqueous | MRKKLVYYFALALLNTGKPFTRIGNWFWKKHRNVLDWNK |
| Ga0212024_10932062 | 3300022065 | Aqueous | EIYYFALALLNTGKPFTRIGNWFWKKHRKVLDWNK |
| Ga0196895_10445452 | 3300022067 | Aqueous | MRKQVVYYFALALLNIGKPFTRIGNWFWKKHRDVLDWNDK |
| Ga0196889_10799683 | 3300022072 | Aqueous | MKKKLVYHFAIALLNIGKPFTSIGNWFWKKHRDVLDWNE |
| Ga0224906_10034679 | 3300022074 | Seawater | MRKKLVYYFAMALLNIGKPFTRIGNWFWKKHRDVLDWNE |
| Ga0212020_10176403 | 3300022167 | Aqueous | MRKQVVYYFALALLKIGKPFTRIGNWFWKKHRDVLDWNDK |
| Ga0196899_10590531 | 3300022187 | Aqueous | MRKRIVYYFGMALLNIGKPFTCIGNWFWKKHRDVLDW |
| Ga0196899_11683893 | 3300022187 | Aqueous | MRKKILYYFAMVLLNIGKPFTRIGNWFWKKHRDVLDWNQ |
| (restricted) Ga0255039_103533581 | 3300024062 | Seawater | MKKKLVYYFALALLNMGKPFTRIGNWFWKKHRDVLDWNE |
| Ga0207905_10005607 | 3300025048 | Marine | MRKKLVYYFAVALLNIGKPFTYIGNWFWKKHRDLLDWIK |
| Ga0209535_100067012 | 3300025120 | Marine | MRKKLVYYFAMVLLNIGKPFTCIGNWFWKKHRDVLDWTK |
| Ga0209535_100488511 | 3300025120 | Marine | MRKKLVYYVAIALLNIGKPFTCVGNWFWKLHRKLLDWIK |
| Ga0209535_10233783 | 3300025120 | Marine | MKKKLVYYCAIALLNIGKPFTCVGNWFWKLHRKLLDWIK |
| Ga0209535_11436253 | 3300025120 | Marine | MRKKLVYYFAMALLNIGKPFTCIGNWFWKKHREVLDWNK |
| Ga0209348_10828792 | 3300025127 | Marine | MRKQAIYYFAMALLNIGKPFTCIGNWFWKKHRDVLDWNK |
| Ga0208919_11390773 | 3300025128 | Marine | MRKQAIYYFALALLYTGRPFTKIGDWFWKKHRDVLDWNK |
| Ga0209232_10450265 | 3300025132 | Marine | KEMRKQALYYFAMALLNIGKPFTCIGNWFWKKHRDVLDWNK |
| Ga0209336_100771293 | 3300025137 | Marine | MRKKAIYYIALALLNIGKPFTYVGNWFWKLHRDLLDWIK |
| Ga0209654_10202315 | 3300025608 | Marine | MKKKIIYYFALALLNIGKPFSRIGNWFWKKHRDVLNWNK |
| Ga0208149_11247011 | 3300025610 | Aqueous | MRKKLVYYFALALLNTGKPFTRIGNWFWKKHRDVLD |
| Ga0208004_10398563 | 3300025630 | Aqueous | MRKKLVYYFALALLNTGKPFTRIGNWFWKKHRDVLDWNDK |
| Ga0209194_11671242 | 3300025632 | Pelagic Marine | MRKQVVYYFAMALLNIGKPFTCIGNWFWKKHRDVLDWNK |
| Ga0208161_11756692 | 3300025646 | Aqueous | MRKQVVYYFALALLNTGKPFTRIGNWFWKKHRDVLDWNDK |
| Ga0208428_10371392 | 3300025653 | Aqueous | MRKQVVYYFALALLNTGKPFTRIGNWFWKKHRDALDWNDK |
| Ga0208428_10947523 | 3300025653 | Aqueous | MRKQVVYYFAMALLNTGKPFTRIGNWFWKKHRDVLDW |
| Ga0208898_10560923 | 3300025671 | Aqueous | MRKRIVYYFGMALLNIGKPFTCIGNWFWKKHRDVLDWNQ |
| Ga0208899_100616610 | 3300025759 | Aqueous | MRKQVVYYFAMALLNIGKPFTRIGNWFWKKHRDVLDWNQ |
| Ga0209137_10186405 | 3300025767 | Marine | MRKTCVYYLGMTLLNIGKPFTRIGNWFWKKHRTVLNWDK |
| Ga0208767_12303662 | 3300025769 | Aqueous | DGKEEMRKQVIYYFALALLNTGKPFTRIGNWFWKKHRDVLDWNDK |
| Ga0208542_11443121 | 3300025818 | Aqueous | WWNGKEEMRKQVVYYFALALLNIGKPFTRIGNWFWKKHRDVLDWNDK |
| Ga0208542_11966722 | 3300025818 | Aqueous | VVYYFAMALLNTGKPFTRIGNWFWKKHRDVLDWNQ |
| Ga0208547_11590432 | 3300025828 | Aqueous | WNGKEEMRKQVIYYFALALLNTGKPFTRIGNWFWKKHRDVLDWNDK |
| Ga0209308_101742353 | 3300025869 | Pelagic Marine | MRKQVVYYFALTLLNIGKPFTCVGNWFWKKHRDVLDWNK |
| Ga0209666_10720412 | 3300025870 | Marine | MRKKLIYYFGMALLNIGKPFSRVGNWFWKKHRDVLNWNK |
| Ga0209309_100367318 | 3300025881 | Pelagic Marine | MRKKLVYYIAIALLNIGKPFTCVGNWFWKLHRKILDWNK |
| Ga0209631_101320305 | 3300025890 | Pelagic Marine | MKKQIVYYFALTLLNMGKPFTCVGNWFWKKHRDVLDWNK |
| Ga0209335_100941003 | 3300025894 | Pelagic Marine | MRKQVVYYFAMALLNMGKPFTCIGNWFWKKHRDVLDWNK |
| Ga0209037_11446141 | 3300027612 | Marine | KKIIYYFALALLNIGKPFSRIGNWFWKKHRDVLNWNK |
| Ga0256412_13820591 | 3300028137 | Seawater | KEMRRKLVYYCAIALLNIGKPFTCVGNWFWKLHRNLLDWIK |
| Ga0247566_10798792 | 3300028335 | Seawater | QALYYFAMALLNIGKPFTCIGNWFWKKHRDVLDWNK |
| Ga0307488_103374853 | 3300031519 | Sackhole Brine | MRKQALYYFALALLNIGKPFTCIGNWFWKKHRDVLDWDK |
| Ga0307488_108305682 | 3300031519 | Sackhole Brine | MRKQALYYFAMALLNIGKPFTCVGNWFWKKHRDVLDWDK |
| Ga0307380_105239403 | 3300031539 | Soil | MRKKILYYFAMALLNIGKPFTCIGNWFWKKHRDVLDWNQ |
| Ga0315320_105887791 | 3300031851 | Seawater | KKLVYYFAMALLNIGKPFTRIGNWFWKKHRDVLDWNE |
| Ga0316203_12160382 | 3300032274 | Microbial Mat | MRKKAIYYIALALLNIGKPFTCVGNWFWKKHRDLLDWTK |
| Ga0316202_102482172 | 3300032277 | Microbial Mat | MRKQAVYYFALALLNTGKPFTRIGNWFWKKHRDVLDWNDK |
| Ga0316204_103902413 | 3300032373 | Microbial Mat | MRKKLVYRLAIALLNIGKPFTSIGNWFWKKHRDVLDWND |
| ⦗Top⦘ |