


| Basic Information | |
|---|---|
| Family ID | F039029 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 164 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKMQILVMPAWIAGIQVRKDASGNVHVNLDSSTPCWNDAIEG |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 164 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 16.25 % |
| % of genes near scaffold ends (potentially truncated) | 50.61 % |
| % of genes from short scaffolds (< 2000 bps) | 72.56 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.317 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment (28.658 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.659 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) (28.659 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 14.29% β-sheet: 0.00% Coil/Unstructured: 85.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 164 Family Scaffolds |
|---|---|---|
| PF09084 | NMT1 | 4.88 |
| PF01977 | UbiD | 3.66 |
| PF00892 | EamA | 2.44 |
| PF00501 | AMP-binding | 1.83 |
| PF01738 | DLH | 1.83 |
| PF16868 | NMT1_3 | 1.83 |
| PF12367 | PFO_beta_C | 1.83 |
| PF04909 | Amidohydro_2 | 1.83 |
| PF01374 | Glyco_hydro_46 | 1.83 |
| PF07690 | MFS_1 | 1.83 |
| PF00689 | Cation_ATPase_C | 1.83 |
| PF06240 | COXG | 1.83 |
| PF00072 | Response_reg | 1.22 |
| PF13030 | DUF3891 | 1.22 |
| PF03976 | PPK2 | 1.22 |
| PF02627 | CMD | 1.22 |
| PF00206 | Lyase_1 | 1.22 |
| PF01321 | Creatinase_N | 1.22 |
| PF13379 | NMT1_2 | 1.22 |
| PF13602 | ADH_zinc_N_2 | 1.22 |
| PF00903 | Glyoxalase | 1.22 |
| PF03176 | MMPL | 1.22 |
| PF08402 | TOBE_2 | 1.22 |
| PF00694 | Aconitase_C | 1.22 |
| PF03972 | MmgE_PrpD | 1.22 |
| PF01568 | Molydop_binding | 1.22 |
| PF07355 | GRDB | 1.22 |
| PF13343 | SBP_bac_6 | 1.22 |
| PF03401 | TctC | 0.61 |
| PF00106 | adh_short | 0.61 |
| PF00496 | SBP_bac_5 | 0.61 |
| PF00994 | MoCF_biosynth | 0.61 |
| PF13458 | Peripla_BP_6 | 0.61 |
| PF08281 | Sigma70_r4_2 | 0.61 |
| PF02775 | TPP_enzyme_C | 0.61 |
| PF01596 | Methyltransf_3 | 0.61 |
| PF01042 | Ribonuc_L-PSP | 0.61 |
| PF13472 | Lipase_GDSL_2 | 0.61 |
| PF04452 | Methyltrans_RNA | 0.61 |
| PF00255 | GSHPx | 0.61 |
| PF02615 | Ldh_2 | 0.61 |
| PF13247 | Fer4_11 | 0.61 |
| PF13549 | ATP-grasp_5 | 0.61 |
| PF07007 | LprI | 0.61 |
| PF07992 | Pyr_redox_2 | 0.61 |
| PF00596 | Aldolase_II | 0.61 |
| PF01717 | Meth_synt_2 | 0.61 |
| PF13714 | PEP_mutase | 0.61 |
| PF01300 | Sua5_yciO_yrdC | 0.61 |
| PF00005 | ABC_tran | 0.61 |
| PF00355 | Rieske | 0.61 |
| PF01850 | PIN | 0.61 |
| PF00528 | BPD_transp_1 | 0.61 |
| PF00248 | Aldo_ket_red | 0.61 |
| PF13671 | AAA_33 | 0.61 |
| PF02776 | TPP_enzyme_N | 0.61 |
| PF13416 | SBP_bac_8 | 0.61 |
| PF00296 | Bac_luciferase | 0.61 |
| PF09619 | YscW | 0.61 |
| PF10099 | RskA | 0.61 |
| PF00701 | DHDPS | 0.61 |
| PF13673 | Acetyltransf_10 | 0.61 |
| PF00529 | CusB_dom_1 | 0.61 |
| PF13649 | Methyltransf_25 | 0.61 |
| PF00768 | Peptidase_S11 | 0.61 |
| PF02738 | MoCoBD_1 | 0.61 |
| PF09865 | DUF2092 | 0.61 |
| PF07883 | Cupin_2 | 0.61 |
| PF00881 | Nitroreductase | 0.61 |
| PF12697 | Abhydrolase_6 | 0.61 |
| PF00254 | FKBP_C | 0.61 |
| PF01244 | Peptidase_M19 | 0.61 |
| PF00171 | Aldedh | 0.61 |
| PF00510 | COX3 | 0.61 |
| PF01425 | Amidase | 0.61 |
| PF12833 | HTH_18 | 0.61 |
| COG ID | Name | Functional Category | % Frequency in 164 Family Scaffolds |
|---|---|---|---|
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.88 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 4.88 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 3.66 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 1.83 |
| COG3427 | Carbon monoxide dehydrogenase subunit CoxG | Energy production and conversion [C] | 1.83 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 1.22 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.22 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.22 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 1.22 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 1.22 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.22 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 1.22 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 1.22 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.61 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.61 |
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.61 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.61 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.61 |
| COG1385 | 16S rRNA U1498 N3-methylase RsmE | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.61 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 0.61 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.61 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.61 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.61 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.61 |
| COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 0.61 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.93 % |
| Unclassified | root | N/A | 17.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000579|AP72_2010_repI_A01DRAFT_1075078 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1002897 | All Organisms → cellular organisms → Bacteria | 2770 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1005407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2069 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1062549 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10002924 | All Organisms → cellular organisms → Bacteria | 4581 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1015386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1455 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10070962 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10132743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1009497 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300000955|JGI1027J12803_101248173 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300003987|Ga0055471_10233949 | Not Available | 580 | Open in IMG/M |
| 3300004145|Ga0055489_10205099 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300004268|Ga0066398_10003061 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300004268|Ga0066398_10188933 | Not Available | 538 | Open in IMG/M |
| 3300004633|Ga0066395_10002766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6056 | Open in IMG/M |
| 3300004633|Ga0066395_10290629 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300005093|Ga0062594_100352682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1157 | Open in IMG/M |
| 3300005289|Ga0065704_10498596 | Not Available | 622 | Open in IMG/M |
| 3300005295|Ga0065707_10802214 | Not Available | 599 | Open in IMG/M |
| 3300005332|Ga0066388_104572567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300005332|Ga0066388_105199042 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005332|Ga0066388_107813146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300005332|Ga0066388_108229072 | Not Available | 520 | Open in IMG/M |
| 3300005363|Ga0008090_15422122 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300005447|Ga0066689_10752127 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005536|Ga0070697_101462375 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005713|Ga0066905_100710869 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300005713|Ga0066905_101063706 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300005719|Ga0068861_101639781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300005764|Ga0066903_100762570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1721 | Open in IMG/M |
| 3300005937|Ga0081455_10004395 | All Organisms → cellular organisms → Bacteria | 15848 | Open in IMG/M |
| 3300005937|Ga0081455_10275346 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300005981|Ga0081538_10037307 | All Organisms → cellular organisms → Bacteria | 3155 | Open in IMG/M |
| 3300005981|Ga0081538_10051592 | All Organisms → cellular organisms → Bacteria | 2468 | Open in IMG/M |
| 3300005981|Ga0081538_10078272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1775 | Open in IMG/M |
| 3300006852|Ga0075433_10298764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1426 | Open in IMG/M |
| 3300006865|Ga0073934_10032789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4940 | Open in IMG/M |
| 3300006871|Ga0075434_100907453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 896 | Open in IMG/M |
| 3300006871|Ga0075434_101242029 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300006871|Ga0075434_101566516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 668 | Open in IMG/M |
| 3300006904|Ga0075424_100158281 | All Organisms → cellular organisms → Bacteria | 2400 | Open in IMG/M |
| 3300006904|Ga0075424_100167384 | All Organisms → cellular organisms → Bacteria | 2331 | Open in IMG/M |
| 3300007076|Ga0075435_101730608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300009081|Ga0105098_10018828 | All Organisms → cellular organisms → Bacteria | 2622 | Open in IMG/M |
| 3300009081|Ga0105098_10034413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2005 | Open in IMG/M |
| 3300009081|Ga0105098_10104810 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300009081|Ga0105098_10313083 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300009081|Ga0105098_10484425 | Not Available | 628 | Open in IMG/M |
| 3300009157|Ga0105092_10005422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6755 | Open in IMG/M |
| 3300009157|Ga0105092_10009226 | All Organisms → cellular organisms → Bacteria | 5171 | Open in IMG/M |
| 3300009157|Ga0105092_10009247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5164 | Open in IMG/M |
| 3300009157|Ga0105092_10013063 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4361 | Open in IMG/M |
| 3300009157|Ga0105092_10016853 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3845 | Open in IMG/M |
| 3300009157|Ga0105092_10055717 | All Organisms → cellular organisms → Bacteria | 2127 | Open in IMG/M |
| 3300009157|Ga0105092_10058353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2078 | Open in IMG/M |
| 3300009157|Ga0105092_10064173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1983 | Open in IMG/M |
| 3300009157|Ga0105092_10066850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1944 | Open in IMG/M |
| 3300009157|Ga0105092_10131309 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300009157|Ga0105092_10151069 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1290 | Open in IMG/M |
| 3300009157|Ga0105092_10156460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1267 | Open in IMG/M |
| 3300009157|Ga0105092_10202554 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300009157|Ga0105092_10237878 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300009157|Ga0105092_10238104 | Not Available | 1021 | Open in IMG/M |
| 3300009157|Ga0105092_10293718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 916 | Open in IMG/M |
| 3300009157|Ga0105092_10388134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300009157|Ga0105092_10400617 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300009157|Ga0105092_10593689 | Not Available | 639 | Open in IMG/M |
| 3300009157|Ga0105092_10613310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylobacter → Methylobacter tundripaludum | 629 | Open in IMG/M |
| 3300009157|Ga0105092_10626560 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300009157|Ga0105092_10657969 | Not Available | 607 | Open in IMG/M |
| 3300009157|Ga0105092_10734429 | Not Available | 576 | Open in IMG/M |
| 3300009157|Ga0105092_10751545 | Not Available | 569 | Open in IMG/M |
| 3300009162|Ga0075423_12539058 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Oomycota | 559 | Open in IMG/M |
| 3300009162|Ga0075423_12911531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300009168|Ga0105104_10062803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2011 | Open in IMG/M |
| 3300009168|Ga0105104_10574683 | Not Available | 639 | Open in IMG/M |
| 3300009792|Ga0126374_11296403 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300009817|Ga0105062_1128086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300009818|Ga0105072_1002756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2807 | Open in IMG/M |
| 3300009818|Ga0105072_1021979 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300009818|Ga0105072_1025768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1083 | Open in IMG/M |
| 3300009822|Ga0105066_1127319 | Not Available | 575 | Open in IMG/M |
| 3300009836|Ga0105068_1008444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1644 | Open in IMG/M |
| 3300009837|Ga0105058_1002038 | All Organisms → cellular organisms → Bacteria | 3356 | Open in IMG/M |
| 3300009837|Ga0105058_1004137 | Not Available | 2609 | Open in IMG/M |
| 3300010043|Ga0126380_12019083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 528 | Open in IMG/M |
| 3300010046|Ga0126384_10003812 | All Organisms → cellular organisms → Bacteria | 9187 | Open in IMG/M |
| 3300010046|Ga0126384_10179297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1658 | Open in IMG/M |
| 3300010046|Ga0126384_10941055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300010046|Ga0126384_11009931 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300010048|Ga0126373_10007950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 8389 | Open in IMG/M |
| 3300010048|Ga0126373_12105379 | Not Available | 626 | Open in IMG/M |
| 3300010359|Ga0126376_10002085 | All Organisms → cellular organisms → Bacteria | 11191 | Open in IMG/M |
| 3300010362|Ga0126377_10152175 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2174 | Open in IMG/M |
| 3300012948|Ga0126375_10421352 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 971 | Open in IMG/M |
| 3300012961|Ga0164302_11232565 | Not Available | 600 | Open in IMG/M |
| 3300012971|Ga0126369_10189935 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1971 | Open in IMG/M |
| 3300013307|Ga0157372_11871045 | Not Available | 690 | Open in IMG/M |
| 3300014255|Ga0075320_1019900 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300014255|Ga0075320_1034749 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300014877|Ga0180074_1025674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1171 | Open in IMG/M |
| 3300015258|Ga0180093_1027091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1210 | Open in IMG/M |
| 3300017966|Ga0187776_10412253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 906 | Open in IMG/M |
| 3300018051|Ga0184620_10141371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 773 | Open in IMG/M |
| 3300018084|Ga0184629_10320451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300018084|Ga0184629_10557067 | Not Available | 590 | Open in IMG/M |
| 3300018084|Ga0184629_10658740 | Not Available | 530 | Open in IMG/M |
| 3300018465|Ga0190269_10580683 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 752 | Open in IMG/M |
| 3300021081|Ga0210379_10088582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1277 | Open in IMG/M |
| 3300021178|Ga0210408_10988336 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300021560|Ga0126371_10013336 | All Organisms → cellular organisms → Bacteria | 7459 | Open in IMG/M |
| 3300025324|Ga0209640_10234788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1550 | Open in IMG/M |
| 3300025324|Ga0209640_10389285 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300025324|Ga0209640_11061017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 620 | Open in IMG/M |
| 3300025908|Ga0207643_11040520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300025910|Ga0207684_10752720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 826 | Open in IMG/M |
| 3300026037|Ga0208655_1018167 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300027379|Ga0209842_1000132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 12783 | Open in IMG/M |
| 3300027490|Ga0209899_1014973 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300027646|Ga0209466_1004378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2954 | Open in IMG/M |
| 3300027650|Ga0256866_1118134 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300027722|Ga0209819_10000644 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10337 | Open in IMG/M |
| 3300027722|Ga0209819_10003006 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5336 | Open in IMG/M |
| 3300027722|Ga0209819_10003290 | All Organisms → cellular organisms → Bacteria | 5135 | Open in IMG/M |
| 3300027722|Ga0209819_10003306 | All Organisms → cellular organisms → Bacteria | 5122 | Open in IMG/M |
| 3300027722|Ga0209819_10005957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 3893 | Open in IMG/M |
| 3300027722|Ga0209819_10014114 | All Organisms → cellular organisms → Bacteria | 2611 | Open in IMG/M |
| 3300027722|Ga0209819_10014880 | All Organisms → cellular organisms → Bacteria | 2545 | Open in IMG/M |
| 3300027722|Ga0209819_10022288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2109 | Open in IMG/M |
| 3300027722|Ga0209819_10041854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1565 | Open in IMG/M |
| 3300027722|Ga0209819_10045020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1510 | Open in IMG/M |
| 3300027722|Ga0209819_10061095 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300027722|Ga0209819_10075467 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300027722|Ga0209819_10085432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1099 | Open in IMG/M |
| 3300027722|Ga0209819_10168506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 766 | Open in IMG/M |
| 3300027722|Ga0209819_10180361 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300027874|Ga0209465_10126038 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 1264 | Open in IMG/M |
| 3300027909|Ga0209382_11209601 | Not Available | 772 | Open in IMG/M |
| 3300027952|Ga0209889_1057185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300027956|Ga0209820_1083808 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300030620|Ga0302046_10747022 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300031231|Ga0170824_113970003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 605 | Open in IMG/M |
| 3300031720|Ga0307469_10007700 | All Organisms → cellular organisms → Bacteria | 5020 | Open in IMG/M |
| 3300031720|Ga0307469_12215977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300031740|Ga0307468_100424628 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1025 | Open in IMG/M |
| 3300031740|Ga0307468_101616423 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300031740|Ga0307468_102082941 | Not Available | 546 | Open in IMG/M |
| 3300031820|Ga0307473_10358935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 940 | Open in IMG/M |
| 3300031965|Ga0326597_11926200 | Not Available | 550 | Open in IMG/M |
| 3300032180|Ga0307471_100708469 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300032180|Ga0307471_100857512 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300032205|Ga0307472_100909608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 815 | Open in IMG/M |
| 3300032782|Ga0335082_10028880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 5898 | Open in IMG/M |
| 3300032892|Ga0335081_10310083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae | 2084 | Open in IMG/M |
| 3300032892|Ga0335081_11242303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 846 | Open in IMG/M |
| 3300033004|Ga0335084_11554014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300033004|Ga0335084_12107631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300033417|Ga0214471_10914774 | Not Available | 679 | Open in IMG/M |
| 3300034151|Ga0364935_0304414 | Not Available | 526 | Open in IMG/M |
| 3300034257|Ga0370495_0205505 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 28.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.93% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 6.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 6.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.10% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.05% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.44% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.83% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.83% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.83% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.22% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.22% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.22% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.61% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.61% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.61% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.61% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.61% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.61% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014255 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026037 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| 3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A01DRAFT_10750782 | 3300000579 | Forest Soil | MPAWIAGIQIRKDASGNIHVNLDSSASCWNDAIDGPLLEVT |
| AF_2010_repII_A01DRAFT_10028971 | 3300000580 | Forest Soil | RIAGIQARKEASGDIHVNPDSSTPCWNDAIDGFS* |
| AF_2010_repII_A01DRAFT_10054073 | 3300000580 | Forest Soil | PAWIAGIQTRKDPSGNIHVNLDSSTPCWNDTIEWPLLQNE* |
| AF_2010_repII_A01DRAFT_10625492 | 3300000580 | Forest Soil | MKKQFSVMPAWIAGIQVRTDASGDIHVSLDSSTPCWNDAIKGLYLT* |
| AF_2010_repII_A1DRAFT_100029244 | 3300000597 | Forest Soil | MKNPIFVMPARIAGIQARKEASGDIHVNPDSSTPCWNDAIDGFS* |
| AF_2010_repII_A100DRAFT_10153861 | 3300000655 | Forest Soil | AAWIAGIQVRKDASADIHVSLDSSTPCWNDTIEELY* |
| AF_2010_repII_A001DRAFT_100709622 | 3300000793 | Forest Soil | MKKQFSVMPAWIAGIQVRTDASGDIHVSLDSSTPCWNDXIKGLYLT* |
| AF_2010_repII_A001DRAFT_101327431 | 3300000793 | Forest Soil | MFVMPAWIAGIQIRRMLPRDIHVSLGSSTPCWNDAIKELY* |
| AP72_2010_repI_A100DRAFT_10094972 | 3300000837 | Forest Soil | MPAWIAGIQIRKDASGDIHVNLDSSTPCWNDDME* |
| JGI1027J12803_1012481732 | 3300000955 | Soil | MPAWIAGIPVRKDASGNNHVNLDSSTPCWNDANRG |
| Ga0055471_102339492 | 3300003987 | Natural And Restored Wetlands | MKIESTVMPAWMAGIQARKDASGNVHVNLDSSTPCWNDAI |
| Ga0055489_102050992 | 3300004145 | Natural And Restored Wetlands | FTNYENEDPVMPAWIAGIQSSQHASEDIHVGLDSSTPCWNDAIEGFYLN* |
| Ga0066398_100030611 | 3300004268 | Tropical Forest Soil | MKNSNFVMPAWIAGIQIRKDASGNIHVNLDSSAPCWNDAI |
| Ga0066398_101889331 | 3300004268 | Tropical Forest Soil | VIPAWIAGIQVRKDASEDVHVTLDSSNPCWNDTIKGLYLT* |
| Ga0066395_100027668 | 3300004633 | Tropical Forest Soil | MEICVMPAWIAGIQVRKGASGNIHVTRDSSTPCWNDTVEELY* |
| Ga0066395_102906292 | 3300004633 | Tropical Forest Soil | MKMQIFVMPAWMAGIQLREDASGDIHVNLDSSAPCWNDPLKGSA* |
| Ga0062594_1003526823 | 3300005093 | Soil | MKMQIFVMPAWIAGIQARKDAPDTSIVNLDSSTPCWNDVIEGFCWN* |
| Ga0065704_104985961 | 3300005289 | Switchgrass Rhizosphere | MQIIVMPAWIAGIQVRKDASGNVHVNLDSSTPCWNDAIEGFCLN* |
| Ga0065707_108022141 | 3300005295 | Switchgrass Rhizosphere | MKMQSFVMPAWIAGIQVRKDASGNVHVNLDSSTPCWNDVIEGFYLN* |
| Ga0066388_1045725672 | 3300005332 | Tropical Forest Soil | MKMQIFVMPAWMAGIQLREDASGDIRVNLDSSAPCWNDPLKGSA* |
| Ga0066388_1051990421 | 3300005332 | Tropical Forest Soil | MENVIFVMPALIASIQVHKDASGNIHVNLDSSTPCWNDVIEGS* |
| Ga0066388_1078131462 | 3300005332 | Tropical Forest Soil | MKMQIFVMPAWMAGIQLREDASGDVHVNLDSSAPCWNDPLKGSA* |
| Ga0066388_1082290722 | 3300005332 | Tropical Forest Soil | VMPAWMAGIQVRKDASGDIHVSLDSSTPCWNDAIEDVLQD* |
| Ga0008090_154221222 | 3300005363 | Tropical Rainforest Soil | MKMRVFVMPAWMAGIQVRKDASGDIHVSLDSSTPCWNDAIEGVLRD* |
| Ga0070708_1006466592 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAWIAGIQGGKDASVDIHVSLDSTTPCWNDALEKVSACSDRTLNA* |
| Ga0066689_107521271 | 3300005447 | Soil | MKMQSFVMPAWIAGIQVRKDAFGTSMQLDSSTPCWNDVIEGFCLN |
| Ga0070706_1007055722 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPCPFTRLQNLKMQIFVMPAWIAGIQARKDAYGDIRVNLDSSTPCWNDAIFTFFYD* |
| Ga0070697_1014623752 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MEIFVMPAWIAGISSQDAFGDIPVSLDSSTPCWNDAIEE* |
| Ga0066905_1007108692 | 3300005713 | Tropical Forest Soil | MINQRMKMEILVMPARVVGNQVRKDASGNIQVNLDSSTPSWNGAMKGSV* |
| Ga0066905_1010637061 | 3300005713 | Tropical Forest Soil | IFVMPAWIAGIQVRKDASGDIHVSLDSSTPCWNDQLKGGLN* |
| Ga0068861_1016397812 | 3300005719 | Switchgrass Rhizosphere | MKMQIFVMAAWIAGIQARKDAPDTSIVNLDSSTPCWNDVIEGFCWN* |
| Ga0066903_1007625701 | 3300005764 | Tropical Forest Soil | MQIFVMPAWIGGIRIRKDDSQDIHVSLDSSTPCWNDAIKKLY* |
| Ga0081455_1000439512 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MENVIFVMPALIAGIEVHKDASGNVHVNLDSSTPCWNDVIEGS* |
| Ga0081455_102753462 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKMQIILMPAWMAGIQSRKDASGNIHVKLDSSTPCWNDQLKGSA* |
| Ga0081538_100373072 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MKMESFVMPAWMAGIPVSQDASEDVHVGLDSSTPCWNDAMEELYQD* |
| Ga0081538_100515923 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MKTRMIVMPAWIAGIQIRKDAYRDIHVDLDSSPPCWNDAIEVLCWT* |
| Ga0081538_100782722 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MQITVMPAWMAGIQIREDASGNVHVNLDSSTPCWNDVIKRFFN* |
| Ga0075433_102987642 | 3300006852 | Populus Rhizosphere | MKMQIFVMLAWIAGIQVCKDASGNIHVSLDSSTPCWNDAVEGF* |
| Ga0073934_100327892 | 3300006865 | Hot Spring Sediment | MKMQIIVMPAWIAGMQVRKDASGDIHVNLDSSIPRWNDAIEGAA* |
| Ga0075434_1009074532 | 3300006871 | Populus Rhizosphere | MPEWIAGIQVHEDASGDIHVSLDSSTPCWNDAIWGA |
| Ga0075434_1012420291 | 3300006871 | Populus Rhizosphere | MKMVILVMPAWIAGIHQVRKDASGDVHVGLDSSAPCWNDG |
| Ga0075434_1015665162 | 3300006871 | Populus Rhizosphere | FVMPAWIAGIQIRKDASGHVHANLDSSTPCWNDAIETSPL* |
| Ga0075424_1001582811 | 3300006904 | Populus Rhizosphere | MPAWIAGIHQVRKDASEDIHVNLDSSTPCWNDAIE |
| Ga0075424_1001673841 | 3300006904 | Populus Rhizosphere | MPAWIAGTHQVRKDASGNVHVGLDSSAPCWNDGIE |
| Ga0075435_1017306082 | 3300007076 | Populus Rhizosphere | VMPAWIAGIQIRKDASGHVHANLDSSTPCWNDAIETSPL* |
| Ga0105098_100188282 | 3300009081 | Freshwater Sediment | MQIIVMPAWIAGIQIRKDASGDVHVNLDSSAPCWNDGIEGSA* |
| Ga0105098_100344132 | 3300009081 | Freshwater Sediment | MKMESFVMPAWMAGIQVRMDASGHIHVGLDSSTPCWNDGIEESYQD* |
| Ga0105098_101048101 | 3300009081 | Freshwater Sediment | MEIEITVMPAWMAGNQARKDASGNVHVDLDSSAPC |
| Ga0105098_103130831 | 3300009081 | Freshwater Sediment | MPAWIAGIQVCKDASGNIHVNLDSSTPYWNDAIEWGSALN* |
| Ga0105098_104844252 | 3300009081 | Freshwater Sediment | MKMQIVVMPVWMAGTQVRKDASEDIHVNLDSSTPCWNDESRGSA* |
| Ga0105092_100054227 | 3300009157 | Freshwater Sediment | MHMFVMPAWMAGIQARKDASGDIRVGLDSSTPCWNDAIGGFYLN* |
| Ga0105092_100092265 | 3300009157 | Freshwater Sediment | MKMQIVVMPAWIAGTQVRKDASGDIRAGLDSSTPCWNDGIEGFCLK* |
| Ga0105092_100092473 | 3300009157 | Freshwater Sediment | MEIFVMPAWIAGIQVRKDASGDIHVNLDSSTPCWNDVIEGFCLS* |
| Ga0105092_100130636 | 3300009157 | Freshwater Sediment | MQTSVMPAWMAGIQVRKDASGNVHVSLDSSAPCWNDTIEGSA* |
| Ga0105092_100168535 | 3300009157 | Freshwater Sediment | MKKQILVMPAWMAGTQVRKDASGDIHVNLDSSTPCWNDGIEVFCLN* |
| Ga0105092_100557172 | 3300009157 | Freshwater Sediment | MKMQIVVMPAWMAGTQVRKDASEDIHVNLDSSTPCWNDESRGSA* |
| Ga0105092_100583532 | 3300009157 | Freshwater Sediment | MKMQITVMPAGMAGIQIRKDASGNVHVNLDSSIPCWNGVIERFFN* |
| Ga0105092_100641732 | 3300009157 | Freshwater Sediment | MKMQIVVMPAWMAGTQVRKDASGDIHVNLDSSTPCWNDESRGSA* |
| Ga0105092_100668501 | 3300009157 | Freshwater Sediment | ARPQKKKIEITVMPAWMAGIQASKDVSGNVHVNLDSSAPCWNDAIGGLCLN* |
| Ga0105092_101313091 | 3300009157 | Freshwater Sediment | IVVMPAWMAGTQVRKDASGDIHVNLDSSTPCWNDAMESSA* |
| Ga0105092_101510691 | 3300009157 | Freshwater Sediment | MKMQIFVMPAWIAGIQIRKDASGDIHVSLDSSTPCWNDGIVGFCLK* |
| Ga0105092_101564601 | 3300009157 | Freshwater Sediment | MKMESFVMPAWMAGIQVRMDASGHIHVGLDSSTPCWNDGIE |
| Ga0105092_102025542 | 3300009157 | Freshwater Sediment | IAGIQIRKDASGDIHVSLDSSAPCWNDAIEGFCLN* |
| Ga0105092_102378781 | 3300009157 | Freshwater Sediment | MKMQSFVIPAWIAGIQVRKDASGNVHVNLDSSTPCWNDAIEGFC |
| Ga0105092_102381041 | 3300009157 | Freshwater Sediment | MKLQITVMPAWMAGIQIRKDASGDIHVNLDSSAPCWNDGIEGFCLY* |
| Ga0105092_102937182 | 3300009157 | Freshwater Sediment | MKMQIIVMPAWIAGIQVRKDASGNVHVNLDSSTPCWNDAIEGFCLN* |
| Ga0105092_103881342 | 3300009157 | Freshwater Sediment | MILPRPQNMKIQSFVMPAWIAGIQIRKDASGDIHVSLDSSTPCWNDGIVGFCLK* |
| Ga0105092_104006172 | 3300009157 | Freshwater Sediment | MEMQIFVMPAWIAGIQICKDASGDVHVNLDSSAPCWNDGIEGSA* |
| Ga0105092_105936891 | 3300009157 | Freshwater Sediment | QNMKMQIFVMPAWMAGTQVRKDASGDIHVNLDSSAPCWNDASRGSA* |
| Ga0105092_106133101 | 3300009157 | Freshwater Sediment | MKMQIFVMPAWIAGIQIRKDASGDIHVSLDSSTPCWNDGIV |
| Ga0105092_106265602 | 3300009157 | Freshwater Sediment | MQSFVMPAWIAGIQIRKDASGDIRVGLDSSTPCWKDGIEGFCLN* |
| Ga0105092_106579692 | 3300009157 | Freshwater Sediment | PAWMAGIQACKDASGDIHVNLDSSTPCWNDAIEGFCLN* |
| Ga0105092_107344291 | 3300009157 | Freshwater Sediment | MKMESFVMPAWMAGTQVRKDASGDIHVNLDSSTPCWNDESRGSA |
| Ga0105092_107515452 | 3300009157 | Freshwater Sediment | MKMQIVMPAWIAGIQIRKDASGDIHVSLDSSIPCWNDAIEGFCLN* |
| Ga0075423_125390582 | 3300009162 | Populus Rhizosphere | PAWIAGIQIRKDASGNIHVNLDSSTPCWNDVIERLYLK* |
| Ga0075423_129115311 | 3300009162 | Populus Rhizosphere | MPAWIAGIQVRKEASGDIHVDLDSSPPCWNDTIKSLCSKLSKTLLPIF |
| Ga0105104_100628032 | 3300009168 | Freshwater Sediment | MKMQIFVMPARIAGIQVRTDASGDIHVKLDSSTPCWNEPIEGSV* |
| Ga0105104_105746832 | 3300009168 | Freshwater Sediment | MKMQIFVMPAWIAGIQIRKDASGDIHVSLDSSTPCWNDTIEELSKCSDPE* |
| Ga0126374_112964032 | 3300009792 | Tropical Forest Soil | MKMQFFVMPAWIASIQVRKDASGNIHVSLDSSTPCWNDAIEGVLHKLT |
| Ga0105062_11280861 | 3300009817 | Groundwater Sand | MKMQILVMPAWIAGIQVRKDASGNVHVNLDSSTPCWND |
| Ga0105072_10027561 | 3300009818 | Groundwater Sand | MKMQILVMPAWIAGIQVRKDASGNVHVNLDSSTPCWNDAIEG |
| Ga0105072_10219791 | 3300009818 | Groundwater Sand | NMKMQIIVMPAWIAGIQVRKDASGNVHVNLIPALPCWNDAIEGFCLN* |
| Ga0105072_10257682 | 3300009818 | Groundwater Sand | MKMEIIVMPAWIAGIQVRKDASGNVHVNLDSSTPCWNDA |
| Ga0105066_11273191 | 3300009822 | Groundwater Sand | MKIQIIVMPAWIAGIQVRKDASGNVHVNLDSSTPCWNDAIEGFCLN* |
| Ga0105068_10084442 | 3300009836 | Groundwater Sand | MKMQIIVMPEWIAGIQVRKDASGNVHVNLDSSTPCWN |
| Ga0105058_10020382 | 3300009837 | Groundwater Sand | MKMQIIVMPAWISGIQVRKDASGNVHVNLIPALPCWNDAIEGFCLN* |
| Ga0105058_10041373 | 3300009837 | Groundwater Sand | MKMQIIVMPAWIAGNQVCKDASGNVHVNLDSSTPCWNDAIEGFCL |
| Ga0126380_120190831 | 3300010043 | Tropical Forest Soil | MPAWIDGIQARKDASGDIHINLDSSSPCWNDAIEVL |
| Ga0126384_100038123 | 3300010046 | Tropical Forest Soil | MLAWIAGIQVRKGASGNIHVTRDSSTPCWNDIVEELY* |
| Ga0126384_101792971 | 3300010046 | Tropical Forest Soil | MENVIFVMPALIAGIQVHKDASGSVHVNLDSSTPCWNDVIDV |
| Ga0126384_109410551 | 3300010046 | Tropical Forest Soil | MKMESFVMPAWTAGTQIRKDASREIHVNLDCSSPCRNFGG |
| Ga0126384_110099313 | 3300010046 | Tropical Forest Soil | MKMQFFVMPAWIASIQVRKDASGNIHVSLDSSTPCWNDTKLRTLHVLRRK |
| Ga0126373_1000795012 | 3300010048 | Tropical Forest Soil | ENATFVMAAWIAGIQIRKDASADIHVSLDSSTPCWNDTIEELY* |
| Ga0126373_121053792 | 3300010048 | Tropical Forest Soil | MKMQIFVMPAWMAGIQLREDASGDIHVNLDSSAPCWNDGIEEFCLK* |
| Ga0126376_1000208511 | 3300010359 | Tropical Forest Soil | METCVMLAWIAGIQVRKGASGNIHVTRDSSTPCWNDTVEELY* |
| Ga0126376_119854302 | 3300010359 | Tropical Forest Soil | AYARLQNLKTQIVMPAWIAGIQIRKDACGDIHVNLDSSTP* |
| Ga0126377_101521754 | 3300010362 | Tropical Forest Soil | MPAWIAGIQVRKDASGDIHVDLDSSAPCWNDGTDGLCFNWAKPI* |
| Ga0126375_104213521 | 3300012948 | Tropical Forest Soil | RMKTHTVVIPAWIAGIQARKDAFGNIRVNLDSST* |
| Ga0164302_112325651 | 3300012961 | Soil | MRNVDFVMPAWIAGIQVREDASGNIHVSLDSSAPCWNDSIKEGRT |
| Ga0126369_101899355 | 3300012971 | Tropical Forest Soil | MPAWIAGIQIRKDASGDIHVDLDSSLPCWNDGIAGLCFN* |
| Ga0157372_118710451 | 3300013307 | Corn Rhizosphere | QIFVMPAWIAGIQARKDAPDTSIVNLDSSTPCWNDVIEGFCWN* |
| Ga0075320_10199002 | 3300014255 | Natural And Restored Wetlands | MKMQIIVMPALMAGIQVRKDASGDIHVNLGSSTPCWNDAKEGF* |
| Ga0075320_10347491 | 3300014255 | Natural And Restored Wetlands | MKKPIFVMPAWIAGIQVRVQASADIHVNLDSSTPCW |
| Ga0180074_10256742 | 3300014877 | Soil | MKMEIFVMPAWIAGIQVRKDASGDIHVNLDSSTPCWNDVIEGFCLS* |
| Ga0180093_10270911 | 3300015258 | Soil | AWIAGIQVRKDASGNIHVNLDSSTPCWNDPIEEFCLN* |
| Ga0187776_104122532 | 3300017966 | Tropical Peatland | MHAENPNFVMPAWIAGIQIRKDASGNVHVNLDSSIPCWNNVIERFFN |
| Ga0184620_101413712 | 3300018051 | Groundwater Sediment | MKMQIFVMPAWIAGIQARKDASGNIHVNLDSSTPCWNDV |
| Ga0184629_103204512 | 3300018084 | Groundwater Sediment | MNKQIIVMPAWIAGIQVRKDASGNIHVSLDSSTPCWND |
| Ga0184629_105570671 | 3300018084 | Groundwater Sediment | MEIFVMPAWIAGIQVRKDASGDIHVNLDSSTPCWNDVIEGFCLS |
| Ga0184629_106587401 | 3300018084 | Groundwater Sediment | MKMEIFVMPAWIAGIQVCKDASGIIHVNLDSSTPCWND |
| Ga0190269_105806831 | 3300018465 | Soil | MKMQSSVMPAWIAGIQVRKDASGDIHVNLDSSTPCWNDVIEGFCLS |
| Ga0210379_100885823 | 3300021081 | Groundwater Sediment | MKMQIIVMPAWIAGIQVRKDASGNIHVSLGSSTPCWNDAKEGFCLNS |
| Ga0210408_109883361 | 3300021178 | Soil | MPAWIAGIQVRKDASGDIHVSLDSTTLCWNDALEK |
| Ga0210408_112637451 | 3300021178 | Soil | MSLRLQNMKTQIFVMPAWIAGIQRFHINQVRTDASGNIHVNLDSSTPCWNDARE |
| Ga0126371_100133362 | 3300021560 | Tropical Forest Soil | MLAWIAGIQVRKGASGNIHVTRDSSTPCWNDIVEELY |
| Ga0209640_102347882 | 3300025324 | Soil | MKTQIFVMPAWIAGIQVRTDASGDIHVNLDSGTPCWNDANEDWCLN |
| Ga0209640_103892851 | 3300025324 | Soil | AWIAGIQVRKDASGDIQVNLDSSTPCWNDVIEGFCLS |
| Ga0209640_110610171 | 3300025324 | Soil | MKMEIFVMPAWIAGIQIRKDASGAIHVNLDSSTPCWNDVIEGF |
| Ga0207643_110405201 | 3300025908 | Miscanthus Rhizosphere | MKMQIFVMPAWIAGIQARKDAPDTSIVNLDSSTPCWNDVIEGFCWN |
| Ga0207684_107527202 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIQIFVMPAWIAGIQVCTDASGNVHVSLDSSTPCWNDAIEGFCFKLTG |
| Ga0208655_10181671 | 3300026037 | Natural And Restored Wetlands | MPAWTAGIQVRRDASGDIHVNLGSGHPCRNDDIEEYSP |
| Ga0209842_100013215 | 3300027379 | Groundwater Sand | MKMQILVMPAWIAGIQVRKDASGNVHVNLDSSTPCWN |
| Ga0209899_10149731 | 3300027490 | Groundwater Sand | MKVQSFVMPAWIAGIQACEDASENVHVDLDSSSPCWNDVIEGFL |
| Ga0209466_10043781 | 3300027646 | Tropical Forest Soil | VIFVMPALIAGIQVHKDASGSVHVNLDSSTPWWNDVIDV |
| Ga0256866_11181343 | 3300027650 | Soil | MKMQISVMPAWIAGIQAPQDVSGDIDVNLDSSTPCWNDAVEGFCLNRCGPL |
| Ga0209819_100006442 | 3300027722 | Freshwater Sediment | MKMQIVVMPAWMAGTQVRRDASGDIHVDLDSSTPCWNDRIEGFCLK |
| Ga0209819_100030066 | 3300027722 | Freshwater Sediment | MQTSVMPAWMAGIQVRKDASGNVHVSLDSSAPCWNDTIEGSA |
| Ga0209819_100032905 | 3300027722 | Freshwater Sediment | MKMESFVMPAWMAGIQVRMDASGHIHVGLDSSTPCWNDGIEESYQD |
| Ga0209819_100033063 | 3300027722 | Freshwater Sediment | MQIIVMPAWIAGIQIRKDASGDVHVNLDSSAPCWNDGIEGSA |
| Ga0209819_100059574 | 3300027722 | Freshwater Sediment | MKMQIFVMPAWIAGIQIRKDASGDIHVSLDSSTPCWNDGIVGFCLK |
| Ga0209819_100141142 | 3300027722 | Freshwater Sediment | MKMQIVVMPAWMAGTQVRKDASEDIHVNLDSSTPCWNDESRGSA |
| Ga0209819_100148801 | 3300027722 | Freshwater Sediment | MKKQILVMPAWMAGTQVRKDASGDIHVNLDSSTPCWNDGIEVFCLN |
| Ga0209819_100222883 | 3300027722 | Freshwater Sediment | MKMQIVVMPAWIAGTQVRKDASGDIRAGLDSSTPCWNDGIEGFCLK |
| Ga0209819_100418543 | 3300027722 | Freshwater Sediment | MEMQIFVMPAWIAGIQICKDASGDVHVNLDSSAPCWNDGIEGSA |
| Ga0209819_100450201 | 3300027722 | Freshwater Sediment | MKMQIVVMPAWMAGTQVRKDASGDIHVNLDSSTPCWNDESRGSA |
| Ga0209819_100610954 | 3300027722 | Freshwater Sediment | MKLQITVMPAWMAGIQIRKDASGDIHVNLDSSAPCWNDGIEGFCLY |
| Ga0209819_100754671 | 3300027722 | Freshwater Sediment | MKMQIIVMPAWIAGIQVRKDASGNVHVNLDSSTPCWND |
| Ga0209819_100854322 | 3300027722 | Freshwater Sediment | MKMQITVMPAGMAGIQIRKDASGNVHVNLDSSIPCWNGVIERFFN |
| Ga0209819_101685061 | 3300027722 | Freshwater Sediment | MKMQSFVMPAWMAGIQVRKDASGDVHFNLDSSTPCWNDVRG |
| Ga0209819_101803612 | 3300027722 | Freshwater Sediment | MPAWIAGIQVRKDASGNVHVNLDSSTPCWNDAIEG |
| Ga0209465_101260382 | 3300027874 | Tropical Forest Soil | MKMQIFVMPAWMAGIQLREDASGDIHVNLDSSAPCWNDPLKGSA |
| Ga0209382_112096012 | 3300027909 | Populus Rhizosphere | NFVLPAWIAGIQIRKDASGNIHVNLDSSTPCWNDVIERLYLK |
| Ga0209889_10571851 | 3300027952 | Groundwater Sand | YLVMPAWMDGRHLGSQDASGDIHVGVDSSTPCWNDAIEGFYLN |
| Ga0209820_10838081 | 3300027956 | Freshwater Sediment | VVMPAWMAGTQVRKDASGDIHVNLDSSTPCWNDESRGSA |
| Ga0302046_107470221 | 3300030620 | Soil | MKMEIFVMPAWIAGIQVRKDASGDIHVNLDSSTPCWNDVIEGFCLS |
| Ga0170824_1139700032 | 3300031231 | Forest Soil | MQIFVMRARIAGIRVRKDASGDVHVSLDSSTPCWNDTIR |
| Ga0307469_100077004 | 3300031720 | Hardwood Forest Soil | MKMQIFVMLAWIAGIQVCKDASGNIHVSLDSSTPCWNDAVEGF |
| Ga0307469_122159771 | 3300031720 | Hardwood Forest Soil | MKITIFVMPAWIAGIHQVCKDASGDIHVNLDSSTPCWNDAVEGFCFELIEVLCPVFS |
| Ga0307468_1004246281 | 3300031740 | Hardwood Forest Soil | MKMEIFVMQVWIAGIQVRKDASGNIHVSLDSSIPCWNDAIEA |
| Ga0307468_1016164232 | 3300031740 | Hardwood Forest Soil | METVMPVWIAGIQVRKDASGNIHVNLGSSTPCWND |
| Ga0307468_1020829411 | 3300031740 | Hardwood Forest Soil | VMPARIAGIQARKDASANIHVNLDSGTPCWNDTIEELYSK |
| Ga0307473_103589352 | 3300031820 | Hardwood Forest Soil | MQICVMLAWIAGIQARKDAYGDIRVNLDSSTPCWNDAIFTFFYD |
| Ga0326597_119262001 | 3300031965 | Soil | MNKQIIVMPAWIAGIQVRKDASGNIHVNLDSSTPCWN |
| Ga0307471_1007084691 | 3300032180 | Hardwood Forest Soil | MKMVILVMPAWIAGIHQVRKDASEDVHVGLDSSAPCWN |
| Ga0307471_1008575122 | 3300032180 | Hardwood Forest Soil | MRNADFVMPAWIAGIQVREDASGNIHVSLDSSTPCWND |
| Ga0307472_1009096081 | 3300032205 | Hardwood Forest Soil | MKTQTFVLPAWIAGIQVRTDASENIHVNLDSSTPC |
| Ga0335082_100288802 | 3300032782 | Soil | MPAWIAGIQVPKDASGDIHVNLDSSAPCWNDAVESSG |
| Ga0335081_103100831 | 3300032892 | Soil | MPAWIAGIQICMDASGDVHVGLHSSNPCWNDETKGF |
| Ga0335081_112423032 | 3300032892 | Soil | KPGFVMPAWIAGIQARKDAPGDVHVNLDSSPPCWNDGIEGGCFK |
| Ga0335084_115540141 | 3300033004 | Soil | MKIQVFVMPAWIAGIKVCRDASGNIHVSLDSSTQCWNDASRGLL |
| Ga0335084_121076311 | 3300033004 | Soil | MKMESFVMPAWMAGIRAQDASGDIYVGLHSSTPCWNDGIEESY |
| Ga0214471_109147742 | 3300033417 | Soil | MKMEIFVMPAWIAGIQIRKDASGDIHVNLDSSTPCWNDVS |
| Ga0364935_0304414_2_109 | 3300034151 | Sediment | MPAWIAGIQARKDASGNIHVNLDSSTPCWNDVIVEF |
| Ga0370495_0205505_528_635 | 3300034257 | Untreated Peat Soil | MPAWIAGIVIRKDASGDIHVDIATLDSSTPCWNDVI |
| ⦗Top⦘ |